Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|705
Gene name
LocationContig_1142:5752..7810
Strand-
Gene length (bp)2058
Transcript length (bp)1800
Coding sequence length (bp)1800
Protein length (aa) 600

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00743 FMO-like Flavin-binding monooxygenase-like 5.5E-23 2 212
PF00743 FMO-like Flavin-binding monooxygenase-like 3.1E-10 372 541
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 9.8E-12 1 208
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 7.7E-11 5 209
PF13434 Lys_Orn_oxgnase L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase 2.6E-05 93 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 2 541 7.0E-35
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 2 540 8.0E-35
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 2 541 2.0E-33
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 2 540 2.0E-33
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 2 551 6.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8HZ69|FMO2_GORGO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Gorilla gorilla gorilla GN=FMO2 PE=3 SV=3 2 541 7.0E-35
sp|Q8HZ70|FMO2_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pan troglodytes GN=FMO2 PE=3 SV=3 2 540 8.0E-35
sp|P36366|FMO2_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Cavia porcellus GN=FMO2 PE=2 SV=2 2 541 2.0E-33
sp|Q5REK0|FMO2_PONAB Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Pongo abelii GN=FMO2 PE=2 SV=3 2 540 2.0E-33
sp|P17635|FMO2_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Oryctolagus cuniculus GN=FMO2 PE=1 SV=3 2 551 6.0E-33
sp|Q28505|FMO2_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Macaca mulatta GN=FMO2 PE=2 SV=2 2 540 2.0E-32
sp|Q6IRI9|FMO2_RAT Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Rattus norvegicus GN=Fmo2 PE=2 SV=3 2 541 8.0E-31
sp|Q99518|FMO2_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Homo sapiens GN=FMO2 PE=1 SV=4 2 511 8.0E-30
sp|Q8K2I3|FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus GN=Fmo2 PE=1 SV=3 2 541 1.0E-29
sp|Q8K4C0|FMO5_RAT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Rattus norvegicus GN=Fmo5 PE=1 SV=3 2 577 3.0E-25
sp|Q9EQ76|FMO3_RAT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Rattus norvegicus GN=Fmo3 PE=1 SV=1 2 568 8.0E-24
sp|P97872|FMO5_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Mus musculus GN=Fmo5 PE=1 SV=4 2 577 8.0E-24
sp|P49109|FMO5_CAVPO Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Cavia porcellus GN=FMO5 PE=2 SV=2 2 541 1.0E-23
sp|Q95LA1|FMO3_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Canis lupus familiaris GN=FMO3 PE=2 SV=3 2 576 2.0E-23
sp|O60774|FMO6_HUMAN Putative dimethylaniline monooxygenase [N-oxide-forming] 6 OS=Homo sapiens GN=FMO6P PE=5 SV=1 2 570 4.0E-22
sp|Q04799|FMO5_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Oryctolagus cuniculus GN=FMO5 PE=1 SV=2 2 544 1.0E-21
sp|Q8K4B7|FMO4_RAT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Rattus norvegicus GN=Fmo4 PE=2 SV=3 2 541 2.0E-21
sp|P49326|FMO5_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 5 OS=Homo sapiens GN=FMO5 PE=1 SV=2 2 579 1.0E-18
sp|P31512|FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens GN=FMO4 PE=1 SV=3 2 210 2.0E-18
sp|Q8SPQ7|FMO3_MACMU Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Macaca mulatta GN=FMO3 PE=2 SV=3 2 217 7.0E-17
sp|Q7YS44|FMO3_PANTR Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Pan troglodytes GN=FMO3 PE=3 SV=3 2 572 2.0E-16
sp|P31513|FMO3_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Homo sapiens GN=FMO3 PE=1 SV=5 2 572 2.0E-16
sp|P36367|FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus GN=FMO4 PE=2 SV=2 2 210 3.0E-16
sp|Q8VHG0|FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus GN=Fmo4 PE=1 SV=3 2 210 3.0E-16
sp|P36365|FMO1_RAT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Rattus norvegicus GN=Fmo1 PE=1 SV=2 2 195 9.0E-16
sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 2 217 5.0E-15
sp|P50285|FMO1_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Mus musculus GN=Fmo1 PE=1 SV=1 2 195 9.0E-15
sp|Q95LA2|FMO1_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Canis lupus familiaris GN=FMO1 PE=2 SV=3 2 192 2.0E-14
sp|Q8MP06|SNO1_TYRJA Senecionine N-oxygenase OS=Tyria jacobaeae GN=sno1 PE=1 SV=1 2 192 4.0E-14
sp|Q01740|FMO1_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Homo sapiens GN=FMO1 PE=2 SV=3 2 195 5.0E-14
sp|P17636|FMO1_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Oryctolagus cuniculus GN=FMO1 PE=1 SV=3 2 192 2.0E-13
sp|Q8HYJ9|FMO3_BOVIN Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Bos taurus GN=FMO3 PE=2 SV=1 2 217 2.0E-13
sp|P16549|FMO1_PIG Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Sus scrofa GN=FMO1 PE=1 SV=3 2 195 3.0E-13
sp|P32417|FMO3_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Oryctolagus cuniculus GN=FMO3 PE=1 SV=3 2 217 1.0E-12
sp|Q9SVU0|YUC8_ARATH Probable indole-3-pyruvate monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 5 216 4.0E-11
sp|O64489|YUC9_ARATH Probable indole-3-pyruvate monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 5 218 1.0E-10
sp|Q9LKC0|YUC5_ARATH Probable indole-3-pyruvate monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 5 218 1.0E-10
sp|Q9FKE7|FMO2_ARATH Putative flavin-containing monooxygenase 2 OS=Arabidopsis thaliana GN=FMO2 PE=3 SV=2 2 192 3.0E-10
sp|O23024|YUC3_ARATH Probable indole-3-pyruvate monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 5 218 4.0E-10
sp|Q9SXE1|GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana GN=FMOGS-OX3 PE=2 SV=1 3 192 6.0E-10
sp|O49312|YUC7_ARATH Probable indole-3-pyruvate monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=2 SV=1 5 216 8.0E-10
sp|Q9SVQ1|YUC2_ARATH Indole-3-pyruvate monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=1 SV=1 5 216 4.0E-09
sp|Q9C8U0|GSXL5_ARATH Flavin-containing monooxygenase FMO GS-OX-like 5 OS=Arabidopsis thaliana GN=At1g63370 PE=2 SV=2 3 195 1.0E-08
sp|Q9SXD5|GSXL3_ARATH Flavin-containing monooxygenase FMO GS-OX-like 3 OS=Arabidopsis thaliana GN=At1g62620 PE=2 SV=2 3 195 1.0E-08
sp|Q9LMA1|FMO1_ARATH Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana GN=FMO1 PE=2 SV=1 2 192 1.0E-08
sp|Q8VZ59|YUC6_ARATH Indole-3-pyruvate monooxygenase YUCCA6 OS=Arabidopsis thaliana GN=YUC6 PE=1 SV=1 5 216 1.0E-08
sp|Q9LPL3|YUC11_ARATH Probable indole-3-pyruvate monooxygenase YUCCA11 OS=Arabidopsis thaliana GN=YUC11 PE=2 SV=1 3 208 2.0E-08
sp|Q94K43|GSOX2_ARATH Flavin-containing monooxygenase FMO GS-OX2 OS=Arabidopsis thaliana GN=FMOGS-OX2 PE=2 SV=1 50 223 3.0E-08
sp|O07085|CZCO_BACSU Uncharacterized oxidoreductase CzcO OS=Bacillus subtilis (strain 168) GN=czcO PE=1 SV=1 5 221 4.0E-08
sp|Q9SS04|GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana GN=FMOGS-OX1 PE=2 SV=1 3 192 4.0E-08
sp|P16549|FMO1_PIG Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Sus scrofa GN=FMO1 PE=1 SV=3 374 541 2.0E-07
sp|Q9FWW6|GSXL1_ARATH Flavin-containing monooxygenase FMO GS-OX-like 1 OS=Arabidopsis thaliana GN=At1g12160 PE=2 SV=1 3 192 2.0E-07
sp|Q01740|FMO1_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Homo sapiens GN=FMO1 PE=2 SV=3 356 541 4.0E-07
sp|A8MRX0|GSOX5_ARATH Flavin-containing monooxygenase FMO GS-OX5 OS=Arabidopsis thaliana GN=FMOGS-OX5 PE=2 SV=2 72 192 1.0E-06
sp|P50285|FMO1_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Mus musculus GN=Fmo1 PE=1 SV=1 356 541 1.0E-06
sp|Q95LA2|FMO1_CANLF Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Canis lupus familiaris GN=FMO1 PE=2 SV=3 356 541 1.0E-06
sp|P97501|FMO3_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 3 OS=Mus musculus GN=Fmo3 PE=1 SV=1 374 541 1.0E-06
sp|P36365|FMO1_RAT Dimethylaniline monooxygenase [N-oxide-forming] 1 OS=Rattus norvegicus GN=Fmo1 PE=1 SV=2 321 541 3.0E-06
sp|Q9FWW3|GSXL6_ARATH Flavin-containing monooxygenase FMO GS-OX-like 6 OS=Arabidopsis thaliana GN=At1g12130 PE=2 SV=1 50 192 4.0E-06
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 1 217 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0003824 catalytic activity No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0004497 monooxygenase activity No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 564 586 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|705
MKVAVVGGGPAGLATLKFLATAHEFFPIEPIEVRLFEAEAAIGGTFRHRVYEDAELVSSKYLTAFSDFRLPKEAP
DFVTPQKFVAYLHNYLKAFKLEEYIECSAEVKLIARGPGGVGHVLTIKKPDGREFLWDCDAVAICSGLHVHPNIP
DVPGIEKVPKVLHSSQFKRRSQFGEGTNVIVCGAGETGMDIAHLAVTSPTASVTLCHRDGFFCAPKIIPTPRGPN
QKGPVRPNKPVDTSVASLFDTAYAHPILQRSPLLWIAYDQWVKKMHFLISGTEEGPDQWKGKISKERKNLDSIFL
CKSDRALPYISEGHRSVSLWNRLRSGILNVPLKDTKGRRIDVMMWPSKVDEDGFVHVQEDGSDGSGPSKLIKADV
VVFATGYTPQFPFLGADYPRVTEADVRGVYQEGDTTVGFIGFVRPSIGAIPPLAEMQAQLWVLRLLQHQFPAQVP
RGPGPNAVAPYELDFKLHPRCGYDFFLTKRGVDHEAYAYQLALDIGSAPTMSFVVTKGWKLFFTWAMGSNFNSKF
RLVGPWKWEAGAEDIMRNELYGVVKRTGGFLYLLTYTIIPFVVFGTLSLALFAMSAIVGLLTSVLPKSATKRRD*
Coding >Hirsu2|705
ATGAAGGTTGCGGTCGTCGGTGGCGGCCCGGCTGGGCTCGCCACACTCAAGTTCCTGGCCACGGCCCATGAGTTC
TTCCCCATCGAGCCTATCGAGGTTCGCCTGTTCGAGGCAGAGGCTGCTATTGGTGGCACGTTCCGTCATCGAGTC
TATGAAGATGCTGAGCTTGTGTCGTCCAAGTACCTGACGGCCTTCTCCGACTTCCGGCTGCCCAAAGAGGCTCCC
GACTTCGTGACGCCTCAGAAGTTCGTTGCCTACCTTCACAACTACCTCAAGGCCTTCAAGCTCGAAGAGTACATC
GAGTGCAGTGCCGAGGTCAAACTCATCGCTCGCGGTCCGGGAGGAGTCGGACACGTCCTCACCATCAAGAAGCCG
GACGGGCGGGAGTTTCTCTGGGACTGCGACGCCGTCGCTATCTGCTCGGGTCTCCATGTCCACCCCAACATCCCC
GACGTCCCGGGCATCGAGAAGGTCCCCAAGGTCCTTCATTCGTCGCAGTTCAAGCGCCGGTCGCAGTTCGGCGAG
GGCACCAACGTCATTGTCTGCGGTGCGGGGGAAACCGGGATGGACATCGCGCATCTCGCGGTGACTTCCCCGACT
GCGTCCGTGACCTTGTGCCATCGCGATGGCTTCTTCTGTGCCCCGAAGATCATCCCGACCCCTCGCGGTCCTAAC
CAGAAGGGTCCGGTCCGGCCCAACAAGCCGGTCGACACGTCTGTCGCGAGCTTGTTCGACACGGCTTATGCCCAC
CCCATCTTGCAGCGAAGCCCGTTGCTGTGGATCGCCTATGACCAGTGGGTGAAGAAGATGCACTTCCTCATCTCG
GGCACCGAGGAAGGCCCCGACCAGTGGAAGGGTAAGATCAGCAAGGAGCGCAAGAACCTGGATTCCATCTTCCTC
TGCAAGTCGGATCGCGCCTTGCCGTACATCTCTGAGGGGCACCGCTCGGTGTCGCTGTGGAACCGCCTTCGGTCC
GGCATCCTCAACGTGCCGCTCAAAGACACCAAGGGAAGGCGCATCGATGTGATGATGTGGCCGAGCAAGGTGGAC
GAGGATGGCTTCGTGCACGTGCAGGAAGACGGATCCGACGGCTCGGGGCCGTCCAAGCTGATCAAGGCCGACGTT
GTCGTCTTCGCGACGGGCTACACCCCCCAGTTCCCTTTCCTGGGCGCCGACTATCCGCGGGTGACCGAAGCCGAC
GTGCGCGGCGTGTATCAGGAGGGCGACACGACGGTCGGCTTCATCGGATTCGTGCGCCCGTCCATCGGGGCCATC
CCGCCCCTGGCGGAGATGCAGGCCCAGCTCTGGGTCCTCCGACTCCTCCAGCACCAGTTCCCGGCCCAGGTGCCT
CGCGGGCCGGGACCCAACGCCGTCGCGCCCTATGAGCTGGACTTTAAGCTGCACCCTCGCTGCGGGTACGACTTC
TTCCTGACCAAGAGGGGAGTGGACCACGAGGCGTACGCGTACCAGCTGGCGCTCGACATCGGCTCCGCGCCGACC
ATGTCCTTTGTCGTGACCAAGGGATGGAAGCTCTTCTTCACCTGGGCCATGGGCTCCAACTTCAACAGCAAGTTC
CGCCTCGTCGGCCCCTGGAAGTGGGAGGCCGGCGCCGAGGACATCATGCGCAACGAGCTCTACGGCGTCGTCAAG
CGAACTGGCGGCTTCTTGTATCTTTTGACCTACACCATCATTCCCTTCGTCGTATTCGGCACGCTCAGCCTCGCC
TTGTTCGCCATGTCCGCCATCGTCGGGCTGCTGACGTCGGTTCTGCCGAAGTCGGCGACGAAGCGACGCGACTAG
Transcript >Hirsu2|705
ATGAAGGTTGCGGTCGTCGGTGGCGGCCCGGCTGGGCTCGCCACACTCAAGTTCCTGGCCACGGCCCATGAGTTC
TTCCCCATCGAGCCTATCGAGGTTCGCCTGTTCGAGGCAGAGGCTGCTATTGGTGGCACGTTCCGTCATCGAGTC
TATGAAGATGCTGAGCTTGTGTCGTCCAAGTACCTGACGGCCTTCTCCGACTTCCGGCTGCCCAAAGAGGCTCCC
GACTTCGTGACGCCTCAGAAGTTCGTTGCCTACCTTCACAACTACCTCAAGGCCTTCAAGCTCGAAGAGTACATC
GAGTGCAGTGCCGAGGTCAAACTCATCGCTCGCGGTCCGGGAGGAGTCGGACACGTCCTCACCATCAAGAAGCCG
GACGGGCGGGAGTTTCTCTGGGACTGCGACGCCGTCGCTATCTGCTCGGGTCTCCATGTCCACCCCAACATCCCC
GACGTCCCGGGCATCGAGAAGGTCCCCAAGGTCCTTCATTCGTCGCAGTTCAAGCGCCGGTCGCAGTTCGGCGAG
GGCACCAACGTCATTGTCTGCGGTGCGGGGGAAACCGGGATGGACATCGCGCATCTCGCGGTGACTTCCCCGACT
GCGTCCGTGACCTTGTGCCATCGCGATGGCTTCTTCTGTGCCCCGAAGATCATCCCGACCCCTCGCGGTCCTAAC
CAGAAGGGTCCGGTCCGGCCCAACAAGCCGGTCGACACGTCTGTCGCGAGCTTGTTCGACACGGCTTATGCCCAC
CCCATCTTGCAGCGAAGCCCGTTGCTGTGGATCGCCTATGACCAGTGGGTGAAGAAGATGCACTTCCTCATCTCG
GGCACCGAGGAAGGCCCCGACCAGTGGAAGGGTAAGATCAGCAAGGAGCGCAAGAACCTGGATTCCATCTTCCTC
TGCAAGTCGGATCGCGCCTTGCCGTACATCTCTGAGGGGCACCGCTCGGTGTCGCTGTGGAACCGCCTTCGGTCC
GGCATCCTCAACGTGCCGCTCAAAGACACCAAGGGAAGGCGCATCGATGTGATGATGTGGCCGAGCAAGGTGGAC
GAGGATGGCTTCGTGCACGTGCAGGAAGACGGATCCGACGGCTCGGGGCCGTCCAAGCTGATCAAGGCCGACGTT
GTCGTCTTCGCGACGGGCTACACCCCCCAGTTCCCTTTCCTGGGCGCCGACTATCCGCGGGTGACCGAAGCCGAC
GTGCGCGGCGTGTATCAGGAGGGCGACACGACGGTCGGCTTCATCGGATTCGTGCGCCCGTCCATCGGGGCCATC
CCGCCCCTGGCGGAGATGCAGGCCCAGCTCTGGGTCCTCCGACTCCTCCAGCACCAGTTCCCGGCCCAGGTGCCT
CGCGGGCCGGGACCCAACGCCGTCGCGCCCTATGAGCTGGACTTTAAGCTGCACCCTCGCTGCGGGTACGACTTC
TTCCTGACCAAGAGGGGAGTGGACCACGAGGCGTACGCGTACCAGCTGGCGCTCGACATCGGCTCCGCGCCGACC
ATGTCCTTTGTCGTGACCAAGGGATGGAAGCTCTTCTTCACCTGGGCCATGGGCTCCAACTTCAACAGCAAGTTC
CGCCTCGTCGGCCCCTGGAAGTGGGAGGCCGGCGCCGAGGACATCATGCGCAACGAGCTCTACGGCGTCGTCAAG
CGAACTGGCGGCTTCTTGTATCTTTTGACCTACACCATCATTCCCTTCGTCGTATTCGGCACGCTCAGCCTCGCC
TTGTTCGCCATGTCCGCCATCGTCGGGCTGCTGACGTCGGTTCTGCCGAAGTCGGCGACGAAGCGACGCGACTAG
Gene >Hirsu2|705
ATGAAGGTTGCGGTCGTCGGTGGCGGCCCGGCTGGGCTCGCCACACTCAAGTTCCTGGCCACGGCCCATGAGTTC
TTCCCCATCGAGCCTATCGAGGTTCGCCTGTTCGAGGCAGAGGCTGCTATTGGTGGCACGTTCCGTCATCGAGTC
TATGAAGATGCTGAGGTATGAAGCCCCTCGCATCCTGGCCCCGACTCTTGATGACGCTGCTGCTGATATGCCCGG
GTCACACGGATAGCTTGTGTCGTCCAAGTACCTGACGGCCTTCTCCGACTTCCGGCTGCCCAAAGAGGCTCCCGA
CTTCGTGACGCCTCAGAAGTTCGTTGCCTACCTTCACAACTACCTCAAGGCCTTCAAGCTCGAAGAGTACATCGA
GTGCAGTGCCGAGGTCAAACTCATCGCTCGCGGTCCGGGAGGAGTCGGACACGTCCTCACCATCAAGAAGCCGGA
CGGGCGGGAGTTTCTCTGGGACTGCGACGCCGTCGCTATCTGCTCGGGTCTCCATGTCCACCCCAACATCCCCGA
CGTCCCGGGCATCGAGAAGGTCCCCAAGGTCCTTCATTCGTCGCAGTTCAAGCGCCGGTCGCAGTTCGGCGAGGG
CACCAACGTCATTGTCTGCGGTGCGGGGGAAACCGGGATGGACATCGCGCATCTCGCGGTGACTTCCCCGACTGC
GTCCGTGACCTTGTGCCATCGCGATGGCTTCTTCTGTGCCCCGAAGGTAGGTCAAGCCTGCACCTTGGCCCGTTG
GCCTCTCGAAGATGAAACAAGACCCTGCTCACGCTGCCGATGATAGATCATCCCGACCCCTCGCGGTCCTAACCA
GAAGGGTCCGGTCCGGCCCAACAAGCCGGTCGACACGTCTGTCGCGAGCTTGTTCGACACGGCTTATGCCCACCC
CATCTTGCAGCGAAGCCCGTTGCTGTGGATCGCCTATGACCAGTGGGTGAAGAAGATGCACTTCCTCATCTCGGG
CACCGAGGAAGGCCCCGACCAGTGGAAGGGTAAGATCAGCAAGGAGCGCAAGAACCTGGATTCCAGTGAGTCCGG
CCCTGTACATGTATGCCATCTCCACCACTCTGACTGACTCGGGCAGTCTTCCTCTGCAAGTCGGATCGCGCCTTG
CCGTACATCTCTGAGGGGCACCGCTCGGTGTCGCTGTGGAACCGCCTTCGGTCCGGCATCCTCAACGTGCCGCTC
AAAGACACCAAGGGAAGGCGCATCGATGTGATGATGTGGCCGAGCAAGGTGGACGAGGATGGCTTCGTGCACGTG
CAGGAAGACGGATCCGACGGCTCGGGGCCGTCCAAGCTGATCAAGGCCGACGTTGTCGTCTTCGCGACGGGCTAC
ACCCCCCAGTTCCCTTTCCTGGGCGCCGACTATCCGCGGGTGACCGAAGCCGACGTGCGCGGCGTGTATCAGGAG
GGCGACACGACGGTCGGCTTCATCGGATTCGTGCGCCCGTCCATCGGGGCCATCCCGCCCCTGGCGGAGATGCAG
GCCCAGCTCTGGGTCCTCCGACTCCTCCAGCACCAGTTCCCGGCCCAGGTGCCTCGCGGGCCGGGACCCAACGCC
GTCGCGCCCTATGAGCTGGACTTTAAGCTGCACCCTCGCTGCGGGTACGACTTCTTCCTGACCAAGAGGGGAGTG
GACCACGAGGCGTACGCGTACCAGCTGGCGCTCGACATCGGCTCCGCGCCGACCATGTCCTTTGTCGTGACCAAG
GGATGGAAGCTCTTCTTCACCTGGGCCATGGGCTCCAACTTCAACAGCAAGTTCCGCCTCGTCGGCCCCTGGAAG
TGGGAGGCCGGCGCCGAGGACATCATGCGCAACGAGCTCTACGGCGTCGTCAAGCGAACTGGCGGCTTCTTGTGT
AAGTGTGGCGAGGGCTGAGGCGAGACCGACGCGGGCTAACTGAGCGCGGCAGATCTTTTGACCTACACCATCATT
CCCTTCGTCGTATTCGGCACGCTCAGCCTCGCCTTGTTCGCCATGTCCGCCATCGTCGGGCTGCTGACGTCGGTT
CTGCCGAAGTCGGCGACGAAGCGACGCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail