Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7049
Gene name
LocationContig_390:11146..13839
Strand+
Gene length (bp)2693
Transcript length (bp)2595
Coding sequence length (bp)2595
Protein length (aa) 865

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00815 Histidinol_dh Histidinol dehydrogenase 3.1E-159 447 856
PF01502 PRA-CH Phosphoribosyl-AMP cyclohydrolase 2.6E-23 220 290
PF01503 PRA-PH Phosphoribosyl-ATP pyrophosphohydrolase 1.5E-12 298 377

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07685|HIS2_NEUCR Histidine biosynthesis trifunctional protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=his-3 PE=3 SV=3 1 859 0.0E+00
sp|P45353|HIS2_PICPA Histidine biosynthesis trifunctional protein OS=Komagataella pastoris GN=HIS4 PE=3 SV=1 152 859 0.0E+00
sp|O74712|HIS2_CANAX Histidine biosynthesis trifunctional protein OS=Candida albicans GN=HIS4 PE=3 SV=1 23 859 0.0E+00
sp|O13471|HIS2_KLULA Histidine biosynthesis trifunctional protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HIS4 PE=3 SV=2 189 859 0.0E+00
sp|Q12670|HIS2_SACBA Histidine biosynthesis trifunctional protein OS=Saccharomyces bayanus GN=HIS4 PE=3 SV=1 188 859 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07685|HIS2_NEUCR Histidine biosynthesis trifunctional protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=his-3 PE=3 SV=3 1 859 0.0E+00
sp|P45353|HIS2_PICPA Histidine biosynthesis trifunctional protein OS=Komagataella pastoris GN=HIS4 PE=3 SV=1 152 859 0.0E+00
sp|O74712|HIS2_CANAX Histidine biosynthesis trifunctional protein OS=Candida albicans GN=HIS4 PE=3 SV=1 23 859 0.0E+00
sp|O13471|HIS2_KLULA Histidine biosynthesis trifunctional protein OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HIS4 PE=3 SV=2 189 859 0.0E+00
sp|Q12670|HIS2_SACBA Histidine biosynthesis trifunctional protein OS=Saccharomyces bayanus GN=HIS4 PE=3 SV=1 188 859 0.0E+00
sp|P00815|HIS2_YEAST Histidine biosynthesis trifunctional protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIS4 PE=1 SV=3 188 859 0.0E+00
sp|Q9P777|HISX_SCHPO Histidinol dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=his2 PE=3 SV=1 430 855 1.0E-150
sp|Q9C5U8|HIS8_ARATH Histidinol dehydrogenase, chloroplastic OS=Arabidopsis thaliana GN=HISN8 PE=2 SV=1 452 864 4.0E-141
sp|Q5NAY4|HISX_ORYSJ Histidinol dehydrogenase, chloroplastic OS=Oryza sativa subsp. japonica GN=HDH PE=2 SV=1 452 861 3.0E-140
sp|P24226|HISX_BRAOC Histidinol dehydrogenase, chloroplastic OS=Brassica oleracea var. capitata GN=HDH PE=1 SV=1 439 863 4.0E-139
sp|P62459|HISX_PHOPR Histidinol dehydrogenase OS=Photobacterium profundum GN=hisD PE=3 SV=1 442 864 2.0E-128
sp|Q7MLS6|HISX_VIBVY Histidinol dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=hisD PE=3 SV=1 442 862 2.0E-125
sp|Q9F854|HISX_VIBCH Histidinol dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hisD PE=3 SV=2 425 859 2.0E-125
sp|Q87QL1|HISX_VIBPA Histidinol dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hisD PE=3 SV=1 442 859 4.0E-125
sp|Q8D8Q0|HISX_VIBVU Histidinol dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=hisD PE=3 SV=1 442 862 4.0E-125
sp|Q6D411|HISX_PECAS Histidinol dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hisD PE=3 SV=1 428 856 2.0E-124
sp|Q5QWP8|HISX_IDILO Histidinol dehydrogenase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=hisD PE=3 SV=1 434 855 5.0E-123
sp|Q5E638|HISX_VIBF1 Histidinol dehydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hisD PE=3 SV=1 442 859 7.0E-123
sp|Q9PM77|HISX_CAMJE Histidinol dehydrogenase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hisD PE=3 SV=1 425 859 3.0E-122
sp|Q8ABA9|HISX_BACTN Histidinol dehydrogenase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=hisD PE=3 SV=1 431 859 3.0E-121
sp|Q47XB8|HISX1_COLP3 Histidinol dehydrogenase 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=hisD1 PE=3 SV=1 442 858 1.0E-120
sp|Q9CLM4|HISX_PASMU Histidinol dehydrogenase OS=Pasteurella multocida (strain Pm70) GN=hisD PE=3 SV=1 425 859 4.0E-120
sp|Q8FG52|HISX_ECOL6 Histidinol dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hisD PE=3 SV=3 428 859 3.0E-119
sp|P06988|HISX_ECOLI Histidinol dehydrogenase OS=Escherichia coli (strain K12) GN=hisD PE=1 SV=5 428 859 4.0E-119
sp|Q32EE9|HISX_SHIDS Histidinol dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=hisD PE=3 SV=1 428 859 6.0E-119
sp|Q5LAZ8|HISX_BACFN Histidinol dehydrogenase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=hisD PE=3 SV=1 440 859 1.0E-118
sp|P44001|HISX_HAEIN Histidinol dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hisD PE=3 SV=1 425 860 2.0E-118
sp|Q4QN74|HISX_HAEI8 Histidinol dehydrogenase OS=Haemophilus influenzae (strain 86-028NP) GN=hisD PE=3 SV=1 425 860 3.0E-118
sp|Q8X8T3|HISX_ECO57 Histidinol dehydrogenase OS=Escherichia coli O157:H7 GN=hisD PE=3 SV=3 428 859 5.0E-118
sp|Q66C49|HISX_YERPS Histidinol dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hisD PE=3 SV=1 428 860 7.0E-118
sp|Q8ZFX5|HISX_YERPE Histidinol dehydrogenase OS=Yersinia pestis GN=hisD PE=3 SV=1 428 860 7.0E-118
sp|P10370|HISX_SALTY Histidinol dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hisD PE=1 SV=3 428 859 2.0E-117
sp|Q323J2|HISX_SHIBS Histidinol dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=hisD PE=3 SV=1 428 859 4.0E-117
sp|Q3Z0G5|HISX_SHISS Histidinol dehydrogenase OS=Shigella sonnei (strain Ss046) GN=hisD PE=3 SV=1 428 859 5.0E-117
sp|Q64RE7|HISX_BACFR Histidinol dehydrogenase OS=Bacteroides fragilis (strain YCH46) GN=hisD PE=3 SV=1 440 859 1.0E-116
sp|Q65RB1|HISX_MANSM Histidinol dehydrogenase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=hisD PE=3 SV=1 425 856 2.0E-116
sp|Q57MS3|HISX_SALCH Histidinol dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=hisD PE=3 SV=1 442 859 2.0E-116
sp|Q7N6I1|HIS8_PHOLL Putative histidine biosynthesis bifunctional protein HisCD OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hisCD PE=3 SV=1 442 860 3.0E-116
sp|P59401|HISX_SHIFL Histidinol dehydrogenase OS=Shigella flexneri GN=hisD PE=3 SV=2 428 856 3.0E-115
sp|Q5PDP3|HISX_SALPA Histidinol dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=hisD PE=3 SV=1 428 859 5.0E-115
sp|Q8Z5K0|HISX_SALTI Histidinol dehydrogenase OS=Salmonella typhi GN=hisD PE=3 SV=3 428 859 2.0E-114
sp|Q8P9P2|HISX_XANCP Histidinol dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=hisD PE=3 SV=1 425 856 1.0E-113
sp|Q4UU40|HISX_XANC8 Histidinol dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=hisD PE=3 SV=1 425 856 2.0E-113
sp|Q5HSJ3|HISX_CAMJR Histidinol dehydrogenase OS=Campylobacter jejuni (strain RM1221) GN=hisD PE=3 SV=1 425 859 3.0E-113
sp|Q3BUF7|HISX_XANC5 Histidinol dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=hisD PE=3 SV=1 425 856 7.0E-113
sp|Q8PLG9|HISX_XANAC Histidinol dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=hisD PE=3 SV=1 425 856 3.0E-111
sp|Q87C29|HISX_XYLFT Histidinol dehydrogenase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=hisD PE=3 SV=1 425 856 5.0E-109
sp|Q8EFB1|HISX_SHEON Histidinol dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=hisD PE=3 SV=1 447 856 2.0E-108
sp|Q7VQX0|HISX_BLOFL Histidinol dehydrogenase OS=Blochmannia floridanus GN=hisD PE=3 SV=1 432 859 3.0E-107
sp|Q492K3|HISX_BLOPB Histidinol dehydrogenase OS=Blochmannia pennsylvanicus (strain BPEN) GN=hisD PE=3 SV=1 418 863 4.0E-106
sp|Q9PBC5|HISX_XYLFA Histidinol dehydrogenase OS=Xylella fastidiosa (strain 9a5c) GN=hisD PE=3 SV=1 425 856 4.0E-106
sp|P57201|HISX_BUCAI Histidinol dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=hisD PE=3 SV=1 442 862 1.0E-105
sp|Q5H0L1|HISX_XANOR Histidinol dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=hisD PE=3 SV=1 425 856 1.0E-105
sp|Q2P3K3|HISX_XANOM Histidinol dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=hisD PE=3 SV=1 425 856 1.0E-105
sp|Q3ICF0|HISX_PSEHT Histidinol dehydrogenase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=hisD PE=3 SV=1 442 857 1.0E-103
sp|Q8TL41|HISX_METAC Histidinol dehydrogenase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hisD PE=3 SV=1 431 862 2.0E-99
sp|Q465R4|HISX_METBF Histidinol dehydrogenase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hisD PE=3 SV=1 431 862 2.0E-98
sp|Q9ZHE6|HISX_BUCAP Histidinol dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=hisD PE=3 SV=1 468 862 2.0E-97
sp|P59398|HISX_BUCBP Histidinol dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=hisD PE=3 SV=1 433 856 2.0E-97
sp|Q8PZR8|HISX_METMA Histidinol dehydrogenase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hisD PE=3 SV=1 423 862 5.0E-95
sp|Q5ZW87|HISX_LEGPH Histidinol dehydrogenase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=hisD PE=3 SV=1 442 859 2.0E-94
sp|Q02136|HISX_LACLA Histidinol dehydrogenase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=hisD PE=3 SV=3 424 859 6.0E-94
sp|Q81G06|HISX_BACCR Histidinol dehydrogenase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisD PE=3 SV=1 451 856 4.0E-93
sp|Q5WX91|HISX_LEGPL Histidinol dehydrogenase OS=Legionella pneumophila (strain Lens) GN=hisD PE=3 SV=1 442 859 1.0E-92
sp|Q5X5W9|HISX_LEGPA Histidinol dehydrogenase OS=Legionella pneumophila (strain Paris) GN=hisD PE=3 SV=1 442 859 4.0E-92
sp|O30027|HISX_ARCFU Histidinol dehydrogenase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hisD PE=3 SV=1 457 859 7.0E-92
sp|Q81T62|HISX_BACAN Histidinol dehydrogenase OS=Bacillus anthracis GN=hisD PE=3 SV=1 451 856 8.0E-92
sp|Q6HLE7|HISX_BACHK Histidinol dehydrogenase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisD PE=3 SV=1 451 856 1.0E-91
sp|Q97KI2|HISX_CLOAB Histidinol dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hisD PE=3 SV=1 437 857 1.0E-91
sp|O26327|HISX_METTH Histidinol dehydrogenase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hisD PE=3 SV=1 453 857 2.0E-91
sp|Q58851|HISX_METJA Histidinol dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hisD PE=3 SV=1 451 857 2.0E-91
sp|Q63DX2|HISX_BACCZ Histidinol dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=hisD PE=3 SV=1 451 856 3.0E-91
sp|P62456|HISX_BACC1 Histidinol dehydrogenase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisD PE=3 SV=1 451 856 5.0E-91
sp|Q8R882|HISX_CALS4 Histidinol dehydrogenase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=hisD PE=3 SV=1 424 858 1.0E-89
sp|P60862|HISX_METMP Histidinol dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=hisD PE=3 SV=1 423 857 3.0E-87
sp|Q9K6Z2|HISX_BACHD Histidinol dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hisD PE=3 SV=1 442 856 5.0E-87
sp|Q5WDH8|HISX2_BACSK Histidinol dehydrogenase 2 OS=Bacillus clausii (strain KSM-K16) GN=hisD2 PE=3 SV=1 442 859 2.0E-86
sp|Q8GDP4|HISX_HELMO Histidinol dehydrogenase (Fragment) OS=Heliobacillus mobilis GN=hisD PE=3 SV=1 457 856 1.0E-85
sp|Q2RGV8|HISX_MOOTA Histidinol dehydrogenase OS=Moorella thermoacetica (strain ATCC 39073) GN=hisD PE=3 SV=1 451 855 3.0E-85
sp|Q92E84|HISX_LISIN Histidinol dehydrogenase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hisD PE=3 SV=1 434 857 4.0E-85
sp|P60859|HISX_GEOSL Histidinol dehydrogenase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=hisD PE=3 SV=1 435 857 5.0E-85
sp|Q8Y9G1|HISX_LISMO Histidinol dehydrogenase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hisD PE=3 SV=1 457 857 5.0E-85
sp|Q5MZ26|HISX_SYNP6 Histidinol dehydrogenase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=hisD PE=3 SV=1 457 860 6.0E-85
sp|Q3Z878|HISX_DEHM1 Histidinol dehydrogenase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=hisD PE=3 SV=1 455 856 9.0E-85
sp|Q313T7|HISX_DESAG Histidinol dehydrogenase OS=Desulfovibrio alaskensis (strain G20) GN=hisD PE=3 SV=1 447 856 2.0E-84
sp|Q5KVC6|HISX_GEOKA Histidinol dehydrogenase OS=Geobacillus kaustophilus (strain HTA426) GN=hisD PE=3 SV=1 442 856 6.0E-84
sp|O34651|HISX_BACSU Histidinol dehydrogenase OS=Bacillus subtilis (strain 168) GN=hisD PE=3 SV=1 442 859 1.0E-83
sp|Q8DGR2|HISX_THEEB Histidinol dehydrogenase OS=Thermosynechococcus elongatus (strain BP-1) GN=hisD PE=3 SV=1 416 857 2.0E-83
sp|P59399|HISX_LACPL Histidinol dehydrogenase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=hisD PE=3 SV=1 437 856 8.0E-83
sp|Q3ZXL7|HISX_DEHMC Histidinol dehydrogenase OS=Dehalococcoides mccartyi (strain CBDB1) GN=hisD PE=3 SV=1 455 856 1.0E-82
sp|Q8DTQ7|HISX_STRMU Histidinol dehydrogenase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=hisD PE=3 SV=1 425 855 2.0E-82
sp|Q39YP7|HISX_GEOMG Histidinol dehydrogenase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hisD PE=3 SV=1 455 857 2.0E-82
sp|Q8F393|HISX_LEPIN Histidinol dehydrogenase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=hisD PE=3 SV=1 454 855 2.0E-82
sp|P62458|HISX_LEPIC Histidinol dehydrogenase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=hisD PE=3 SV=1 454 855 3.0E-82
sp|Q722Y3|HISX_LISMF Histidinol dehydrogenase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hisD PE=3 SV=1 434 857 4.0E-82
sp|Q8YWL4|HISX2_NOSS1 Histidinol dehydrogenase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisD2 PE=3 SV=1 422 857 5.0E-82
sp|Q6FEC8|HISX_ACIAD Histidinol dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=hisD PE=3 SV=1 450 857 1.0E-81
sp|Q3M5D3|HISX2_ANAVT Histidinol dehydrogenase 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hisD2 PE=3 SV=1 422 857 2.0E-81
sp|Q3A133|HISX_PELCD Histidinol dehydrogenase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hisD PE=3 SV=1 447 857 3.0E-81
sp|Q7V5N9|HISX_PROMM Histidinol dehydrogenase OS=Prochlorococcus marinus (strain MIT 9313) GN=hisD PE=3 SV=1 439 856 4.0E-81
sp|O59667|HIS2_SCHPO Histidine biosynthesis bifunctional protein his7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=his7 PE=3 SV=1 167 396 7.0E-81
sp|Q8ESR8|HISX_OCEIH Histidinol dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hisD PE=3 SV=1 460 861 2.0E-80
sp|Q4FNE2|HISX1_PELUB Histidinol dehydrogenase 1 OS=Pelagibacter ubique (strain HTCC1062) GN=hisD1 PE=3 SV=1 438 857 5.0E-80
sp|Q65EF9|HISX_BACLD Histidinol dehydrogenase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=hisD PE=3 SV=1 442 860 1.0E-79
sp|Q3J079|HISX1_RHOS4 Histidinol dehydrogenase 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hisD1 PE=3 SV=1 435 860 1.0E-79
sp|Q7U8K7|HISX_SYNPX Histidinol dehydrogenase OS=Synechococcus sp. (strain WH8102) GN=hisD PE=3 SV=1 432 856 5.0E-79
sp|Q3AR25|HISX_CHLCH Histidinol dehydrogenase OS=Chlorobium chlorochromatii (strain CaD3) GN=hisD PE=3 SV=1 451 857 1.0E-78
sp|Q8G2R2|HISX_BRUSU Histidinol dehydrogenase OS=Brucella suis biovar 1 (strain 1330) GN=hisD PE=1 SV=1 451 856 1.0E-78
sp|Q57F99|HISX_BRUAB Histidinol dehydrogenase OS=Brucella abortus biovar 1 (strain 9-941) GN=hisD PE=3 SV=1 451 856 1.0E-78
sp|Q2YPB8|HISX_BRUA2 Histidinol dehydrogenase OS=Brucella abortus (strain 2308) GN=hisD PE=3 SV=1 451 856 1.0E-78
sp|Q8KEY6|HISX_CHLTE Histidinol dehydrogenase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hisD PE=3 SV=1 435 859 2.0E-78
sp|Q92S26|HISX1_RHIME Histidinol dehydrogenase 1 OS=Rhizobium meliloti (strain 1021) GN=hisD1 PE=3 SV=1 451 856 3.0E-78
sp|P62457|HISX_DESVH Histidinol dehydrogenase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=hisD PE=3 SV=1 451 855 3.0E-78
sp|Q8YF59|HISX_BRUME Histidinol dehydrogenase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hisD PE=3 SV=1 451 856 4.0E-78
sp|Q82W26|HISX_NITEU Histidinol dehydrogenase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hisD PE=3 SV=1 453 857 1.0E-77
sp|Q46J19|HISX_PROMT Histidinol dehydrogenase OS=Prochlorococcus marinus (strain NATL2A) GN=hisD PE=3 SV=1 407 855 2.0E-77
sp|Q7VA26|HISX_PROMA Histidinol dehydrogenase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=hisD PE=3 SV=1 416 855 3.0E-77
sp|Q7NL02|HISX_GLOVI Histidinol dehydrogenase OS=Gloeobacter violaceus (strain PCC 7421) GN=hisD PE=3 SV=1 457 860 6.0E-77
sp|Q47AL5|HISX_DECAR Histidinol dehydrogenase OS=Dechloromonas aromatica (strain RCB) GN=hisD PE=3 SV=1 451 858 7.0E-77
sp|Q6ANR3|HISX_DESPS Histidinol dehydrogenase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=hisD PE=3 SV=1 438 857 8.0E-77
sp|Q9RSI4|HISX_DEIRA Histidinol dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hisD PE=3 SV=1 455 857 2.0E-76
sp|Q606Q2|HISX_METCA Histidinol dehydrogenase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=hisD PE=1 SV=1 423 858 2.0E-76
sp|P73058|HISX1_SYNY3 Histidinol dehydrogenase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hisD1 PE=3 SV=1 425 855 3.0E-76
sp|P60861|HISX_RHOPA Histidinol dehydrogenase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hisD PE=3 SV=1 460 858 3.0E-76
sp|Q318Q4|HISX_PROM9 Histidinol dehydrogenase OS=Prochlorococcus marinus (strain MIT 9312) GN=hisD PE=3 SV=1 417 856 3.0E-76
sp|Q9HVW9|HISX_PSEAE Histidinol dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hisD PE=3 SV=1 425 856 6.0E-76
sp|Q48EC9|HISX_PSE14 Histidinol dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=hisD PE=3 SV=1 425 862 7.0E-76
sp|Q5V574|HISX_HALMA Histidinol dehydrogenase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisD PE=3 SV=1 451 856 8.0E-76
sp|Q4ZNV9|HISX_PSEU2 Histidinol dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hisD PE=3 SV=1 425 860 1.0E-75
sp|Q87WV5|HISX_PSESM Histidinol dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hisD PE=3 SV=1 425 862 3.0E-75
sp|Q9X0D1|HISX_THEMA Histidinol dehydrogenase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=hisD PE=3 SV=1 441 855 3.0E-75
sp|Q3IQR5|HISX_NATPD Histidinol dehydrogenase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hisD PE=3 SV=1 457 856 6.0E-75
sp|P28736|HISX_MYCSM Histidinol dehydrogenase OS=Mycobacterium smegmatis GN=hisD PE=3 SV=1 425 856 9.0E-75
sp|Q3SW26|HISX_NITWN Histidinol dehydrogenase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hisD PE=3 SV=2 460 856 1.0E-74
sp|Q5FS83|HISX_GLUOX Histidinol dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=hisD PE=3 SV=1 425 856 1.0E-74
sp|Q9JTH9|HISX_NEIMA Histidinol dehydrogenase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=hisD PE=3 SV=1 455 857 2.0E-74
sp|Q7V004|HISX_PROMP Histidinol dehydrogenase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hisD PE=3 SV=1 439 856 3.0E-74
sp|Q7M8K9|HISX_WOLSU Histidinol dehydrogenase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hisD PE=3 SV=1 425 856 3.0E-74
sp|Q5F7D8|HISX_NEIG1 Histidinol dehydrogenase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=hisD PE=3 SV=1 455 857 4.0E-74
sp|Q5LL27|HISX3_RUEPO Histidinol dehydrogenase 3 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisD3 PE=3 SV=1 447 860 4.0E-74
sp|Q5SKC1|HISX_THET8 Histidinol dehydrogenase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=hisD PE=3 SV=1 455 855 6.0E-74
sp|P59400|HISX_PSEPK Histidinol dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=hisD PE=3 SV=1 425 856 6.0E-74
sp|P62460|HISX_THET2 Histidinol dehydrogenase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hisD PE=3 SV=1 455 855 7.0E-74
sp|Q483H8|HISX2_COLP3 Histidinol dehydrogenase 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=hisD2 PE=3 SV=1 436 852 7.0E-74
sp|Q3KHZ2|HISX_PSEPF Histidinol dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=hisD PE=3 SV=1 425 857 8.0E-74
sp|Q9JYH8|HISX_NEIMB Histidinol dehydrogenase OS=Neisseria meningitidis serogroup B (strain MC58) GN=hisD PE=3 SV=1 455 857 9.0E-74
sp|O66976|HISX_AQUAE Histidinol dehydrogenase OS=Aquifex aeolicus (strain VF5) GN=hisD PE=3 SV=1 437 855 9.0E-74
sp|Q3J7H1|HISX_NITOC Histidinol dehydrogenase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisD PE=3 SV=1 425 857 1.0E-73
sp|Q4KI73|HISX_PSEF5 Histidinol dehydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hisD PE=3 SV=2 425 856 1.0E-73
sp|P59397|HISX_BRADU Histidinol dehydrogenase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hisD PE=3 SV=1 460 856 1.0E-73
sp|Q8UHX1|HISX_AGRFC Histidinol dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=hisD PE=3 SV=1 451 856 2.0E-73
sp|Q3AD53|HISX_CARHZ Histidinol dehydrogenase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=hisD PE=3 SV=1 437 858 3.0E-73
sp|Q5YYQ0|HISX_NOCFA Histidinol dehydrogenase OS=Nocardia farcinica (strain IFM 10152) GN=hisD PE=3 SV=1 422 856 3.0E-73
sp|Q5P790|HISX_AROAE Histidinol dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=hisD PE=3 SV=1 457 856 4.0E-73
sp|Q2RQM7|HISX_RHORT Histidinol dehydrogenase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=hisD PE=3 SV=1 427 856 1.0E-72
sp|P9WNW9|HISX_MYCTU Histidinol dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hisD PE=1 SV=2 424 856 2.0E-72
sp|P9WNW8|HISX_MYCTO Histidinol dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hisD PE=3 SV=2 424 856 2.0E-72
sp|P63951|HISX_MYCBO Histidinol dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=hisD PE=3 SV=1 424 856 3.0E-72
sp|Q30TA4|HISX_SULDN Histidinol dehydrogenase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=hisD PE=3 SV=1 457 856 8.0E-72
sp|Q8CQ95|HISX_STAES Histidinol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hisD PE=3 SV=1 451 855 1.0E-71
sp|Q5HKN8|HISX_STAEQ Histidinol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hisD PE=3 SV=1 451 855 2.0E-71
sp|Q3B5E3|HISX_CHLL7 Histidinol dehydrogenase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hisD PE=3 SV=1 438 857 2.0E-71
sp|Q7P0F6|HISX_CHRVO Histidinol dehydrogenase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hisD PE=3 SV=1 425 856 8.0E-71
sp|Q4JW59|HISX_CORJK Histidinol dehydrogenase OS=Corynebacterium jeikeium (strain K411) GN=hisD PE=3 SV=1 425 855 9.0E-71
sp|Q67KH6|HISX_SYMTH Histidinol dehydrogenase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=hisD PE=3 SV=1 438 863 1.0E-70
sp|Q4FQF8|HISX_PSYA2 Histidinol dehydrogenase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=hisD PE=3 SV=1 453 857 2.0E-70
sp|Q8FNZ0|HISX_COREF Histidinol dehydrogenase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hisD PE=3 SV=1 452 859 2.0E-70
sp|Q3MEV7|HISX1_ANAVT Histidinol dehydrogenase 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hisD1 PE=3 SV=1 432 860 2.0E-70
sp|Q2YAU5|HISX_NITMU Histidinol dehydrogenase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=hisD PE=3 SV=1 457 855 4.0E-70
sp|B0SS41|HISX_LEPBP Histidinol dehydrogenase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=hisD PE=3 SV=1 457 859 6.0E-70
sp|B0S9F2|HISX_LEPBA Histidinol dehydrogenase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=hisD PE=3 SV=1 457 859 6.0E-70
sp|Q7UX39|HISX_RHOBA Histidinol dehydrogenase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hisD PE=3 SV=1 454 855 7.0E-70
sp|Q31GY9|HISX_THICR Histidinol dehydrogenase OS=Thiomicrospira crunogena (strain XCL-2) GN=hisD PE=3 SV=1 439 857 7.0E-70
sp|Q8NNT5|HISX_CORGL Histidinol dehydrogenase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=hisD PE=3 SV=1 452 859 8.0E-70
sp|Q5LVV1|HISX1_RUEPO Histidinol dehydrogenase 1 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisD1 PE=3 SV=1 437 856 1.0E-69
sp|Q46WL2|HISX_CUPPJ Histidinol dehydrogenase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hisD PE=3 SV=1 423 857 2.0E-69
sp|Q9HPW5|HISX_HALSA Histidinol dehydrogenase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hisD PE=3 SV=1 451 856 2.0E-69
sp|Q82AA6|HISX_STRAW Histidinol dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hisD PE=3 SV=1 452 856 2.0E-69
sp|Q989E7|HISX1_RHILO Histidinol dehydrogenase 1 OS=Rhizobium loti (strain MAFF303099) GN=hisD1 PE=3 SV=1 457 856 2.0E-69
sp|Q9RH05|HISX_ZYMMO Histidinol dehydrogenase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=hisD PE=3 SV=3 424 856 3.0E-69
sp|Q9A5V1|HISX_CAUCR Histidinol dehydrogenase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hisD PE=3 SV=1 422 860 4.0E-69
sp|Q7VFF5|HISX_HELHP Histidinol dehydrogenase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=hisD PE=3 SV=1 456 863 5.0E-69
sp|Q7VSZ1|HISX_BORPE Histidinol dehydrogenase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hisD PE=3 SV=1 424 856 6.0E-69
sp|Q7W2Y4|HISX_BORPA Histidinol dehydrogenase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hisD PE=3 SV=1 424 856 6.0E-69
sp|Q7WDY4|HISX_BORBR Histidinol dehydrogenase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hisD PE=3 SV=1 424 856 6.0E-69
sp|P60858|HISX_CORDI Histidinol dehydrogenase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=hisD PE=3 SV=1 422 859 6.0E-69
sp|Q8TXG3|HISX_METKA Histidinol dehydrogenase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hisD PE=3 SV=1 453 855 7.0E-69
sp|Q39K91|HISX_BURL3 Histidinol dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hisD PE=3 SV=1 423 858 9.0E-69
sp|O33775|HISX_SULSO Histidinol dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hisD PE=3 SV=1 443 855 1.0E-68
sp|Q63Q86|HISX_BURPS Histidinol dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=hisD PE=3 SV=1 423 857 2.0E-68
sp|Q3JMZ6|HISX_BURP1 Histidinol dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) GN=hisD PE=3 SV=1 423 857 2.0E-68
sp|P16245|HISX_STRCO Histidinol dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hisD PE=3 SV=3 454 856 2.0E-68
sp|Q8YSM8|HISX1_NOSS1 Histidinol dehydrogenase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisD1 PE=3 SV=1 432 857 2.0E-68
sp|Q62GD9|HISX_BURMA Histidinol dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=hisD PE=3 SV=1 451 857 3.0E-68
sp|Q8XV79|HISX_RALSO Histidinol dehydrogenase OS=Ralstonia solanacearum (strain GMI1000) GN=hisD PE=3 SV=1 423 857 7.0E-68
sp|Q9CC57|HISX_MYCLE Histidinol dehydrogenase OS=Mycobacterium leprae (strain TN) GN=hisD PE=3 SV=1 451 856 8.0E-68
sp|Q845V3|HISX_BURM1 Histidinol dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hisD PE=3 SV=2 451 857 2.0E-67
sp|O59626|HISX_PYRFU Histidinol dehydrogenase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hisD PE=3 SV=2 457 855 3.0E-67
sp|Q5HCL9|HISX_STAAC Histidinol dehydrogenase OS=Staphylococcus aureus (strain COL) GN=hisD PE=3 SV=1 451 855 3.0E-65
sp|P63954|HISX_STAAW Histidinol dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=hisD PE=3 SV=1 442 855 3.0E-65
sp|P63953|HISX_STAAN Histidinol dehydrogenase OS=Staphylococcus aureus (strain N315) GN=hisD PE=3 SV=1 442 855 3.0E-65
sp|P63952|HISX_STAAM Histidinol dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hisD PE=3 SV=1 442 855 3.0E-65
sp|Q6GDC6|HISX_STAAR Histidinol dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=hisD PE=3 SV=1 442 855 4.0E-65
sp|Q5JFR5|HISX_THEKO Histidinol dehydrogenase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hisD PE=3 SV=1 457 855 4.0E-65
sp|Q6G5Z7|HISX_STAAS Histidinol dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=hisD PE=3 SV=1 451 855 5.0E-65
sp|Q4A044|HISX_STAS1 Histidinol dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hisD PE=3 SV=1 451 855 2.0E-64
sp|Q47QS9|HISX_THEFY Histidinol dehydrogenase OS=Thermobifida fusca (strain YX) GN=hisD PE=3 SV=1 422 856 2.0E-64
sp|Q3SI67|HISX_THIDA Histidinol dehydrogenase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hisD PE=3 SV=1 423 858 2.0E-64
sp|Q2YZB4|HISX_STAAB Histidinol dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hisD PE=3 SV=1 451 855 7.0E-64
sp|Q970Y9|HISX_SULTO Histidinol dehydrogenase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hisD PE=3 SV=1 438 855 8.0E-64
sp|P60860|HISX_MYCPA Histidinol dehydrogenase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=hisD PE=3 SV=1 425 856 7.0E-61
sp|Q988P7|HISX2_RHILO Histidinol dehydrogenase 2 OS=Rhizobium loti (strain MAFF303099) GN=hisD2 PE=3 SV=1 452 864 8.0E-61
sp|Q4J8I8|HISX_SULAC Histidinol dehydrogenase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hisD PE=3 SV=1 444 823 9.0E-61
sp|Q4FMH0|HISX2_PELUB Histidinol dehydrogenase 2 OS=Pelagibacter ubique (strain HTCC1062) GN=hisD2 PE=3 SV=1 456 857 2.0E-60
sp|Q6KZD1|HISX_PICTO Histidinol dehydrogenase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=hisD PE=3 SV=1 453 856 2.0E-60
sp|Q6A8L5|HISX_PROAC Histidinol dehydrogenase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=hisD PE=3 SV=1 451 855 1.0E-59
sp|Q8G4S9|HISX_BIFLO Histidinol dehydrogenase OS=Bifidobacterium longum (strain NCC 2705) GN=hisD PE=3 SV=1 424 856 2.0E-57
sp|Q46N53|HPSN_CUPPJ Sulfopropanediol 3-dehydrogenase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=hpsN PE=1 SV=1 439 856 4.0E-57
sp|Q987C6|HISX3_RHILO Histidinol dehydrogenase 3 OS=Rhizobium loti (strain MAFF303099) GN=hisD3 PE=3 SV=1 457 859 6.0E-57
sp|Q5WIU9|HISX1_BACSK Histidinol dehydrogenase 1 OS=Bacillus clausii (strain KSM-K16) GN=hisD1 PE=3 SV=1 455 857 6.0E-56
sp|Q6AE76|HISX_LEIXX Histidinol dehydrogenase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=hisD PE=3 SV=1 451 856 6.0E-55
sp|Q5LUS2|HISX2_RUEPO Histidinol dehydrogenase 2 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisD2 PE=3 SV=1 512 859 2.0E-54
sp|Q930I4|HISX2_RHIME Histidinol dehydrogenase 2 OS=Rhizobium meliloti (strain 1021) GN=hisD2 PE=3 SV=1 442 852 5.0E-54
sp|Q3J4H6|HISX2_RHOS4 Putative histidinol dehydrogenase 2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hisD2 PE=3 SV=1 442 852 6.0E-51
sp|Q8GKZ1|HISX_SALEN Histidinol dehydrogenase (Fragment) OS=Salmonella enteritidis GN=hisD PE=3 SV=1 573 734 2.0E-43
sp|Q9RQ82|HISX_BUCMH Histidinol dehydrogenase (Fragment) OS=Buchnera aphidicola subsp. Melaphis rhois GN=hisD PE=3 SV=1 442 626 9.0E-36
sp|Q9L6I1|HISX_THIRO Histidinol dehydrogenase (Fragment) OS=Thiocapsa roseopersicina GN=hisD PE=3 SV=1 630 855 5.0E-34
sp|Q9RQ85|HISX_BUCSC Histidinol dehydrogenase (Fragment) OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=hisD PE=3 SV=1 442 626 1.0E-28
sp|Q9RQ88|HISX_BUCDN Histidinol dehydrogenase (Fragment) OS=Buchnera aphidicola subsp. Diuraphis noxia GN=hisD PE=3 SV=1 431 626 7.0E-27
sp|P62349|HIS2_PHOPR Histidine biosynthesis bifunctional protein HisIE OS=Photobacterium profundum GN=hisI PE=3 SV=1 189 378 5.0E-24
sp|Q8ZY17|HISX_PYRAE Histidinol dehydrogenase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=hisD PE=3 SV=1 450 852 7.0E-24
sp|Q8CXM8|HIS2_OCEIH Histidine biosynthesis bifunctional protein HisIE OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=hisI PE=3 SV=1 204 375 2.0E-23
sp|Q9RWD6|HIS2_DEIRA Histidine biosynthesis bifunctional protein HisIE OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hisI PE=3 SV=1 202 381 3.0E-23
sp|P58853|HIS2_PYRFU Histidine biosynthesis bifunctional protein HisIE OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hisI PE=3 SV=1 200 375 1.0E-22
sp|Q8EFB6|HIS2_SHEON Histidine biosynthesis bifunctional protein HisIE OS=Shewanella oneidensis (strain MR-1) GN=hisI PE=3 SV=1 200 385 6.0E-22
sp|Q8R886|HIS2_CALS4 Histidine biosynthesis bifunctional protein HisIE OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=hisI PE=3 SV=1 204 378 7.0E-22
sp|Q8D8Q6|HIS2_VIBVU Histidine biosynthesis bifunctional protein HisIE OS=Vibrio vulnificus (strain CMCP6) GN=hisI PE=3 SV=1 200 371 4.0E-21
sp|P62350|HIS2_THET2 Histidine biosynthesis bifunctional protein HisIE OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=hisI PE=3 SV=1 204 352 8.0E-21
sp|P72946|HISX2_SYNY3 Putative histidinol dehydrogenase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hisD2 PE=3 SV=1 536 795 1.0E-20
sp|O67780|HIS2_AQUAE Histidine biosynthesis bifunctional protein HisIE OS=Aquifex aeolicus (strain VF5) GN=hisI PE=3 SV=1 203 375 2.0E-20
sp|Q7U635|HIS2_SYNPX Histidine biosynthesis bifunctional protein HisIE OS=Synechococcus sp. (strain WH8102) GN=hisI PE=3 SV=1 204 378 2.0E-20
sp|Q7MAQ8|HIS2_WOLSU Histidine biosynthesis bifunctional protein HisIE OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=hisI PE=3 SV=1 205 387 2.0E-20
sp|Q7MLS0|HIS2_VIBVY Histidine biosynthesis bifunctional protein HisIE OS=Vibrio vulnificus (strain YJ016) GN=hisI PE=3 SV=1 200 371 6.0E-20
sp|Q87QK5|HIS2_VIBPA Histidine biosynthesis bifunctional protein HisIE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hisI PE=3 SV=1 200 371 1.0E-19
sp|P74755|HIS2_SYNY3 Histidine biosynthesis bifunctional protein HisIE OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hisI PE=3 SV=2 204 390 2.0E-19
sp|O34912|HIS2_BACSU Histidine biosynthesis bifunctional protein HisIE OS=Bacillus subtilis (strain 168) GN=hisI PE=3 SV=1 203 352 3.0E-19
sp|O24714|HIS2_KLEPN Histidine biosynthesis bifunctional protein HisIE OS=Klebsiella pneumoniae GN=hisI PE=3 SV=1 200 378 3.0E-19
sp|Q7NLB5|HIS2_GLOVI Histidine biosynthesis bifunctional protein HisIE OS=Gloeobacter violaceus (strain PCC 7421) GN=hisI PE=3 SV=1 203 371 5.0E-19
sp|Q9K6Z7|HIS2_BACHD Histidine biosynthesis bifunctional protein HisIE OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hisI PE=3 SV=1 204 352 1.0E-18
sp|P06989|HIS2_ECOLI Histidine biosynthesis bifunctional protein HisIE OS=Escherichia coli (strain K12) GN=hisI PE=3 SV=3 200 375 1.0E-18
sp|Q8YS28|HIS2_NOSS1 Histidine biosynthesis bifunctional protein HisIE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hisI PE=3 SV=1 204 386 2.0E-18
sp|Q9KSW7|HIS2_VIBCH Histidine biosynthesis bifunctional protein HisIE OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hisI PE=3 SV=1 201 371 3.0E-18
sp|B3QU88|HIS3_CHLT3 Phosphoribosyl-AMP cyclohydrolase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=hisI PE=3 SV=1 203 290 1.0E-17
sp|P37793|HIS2_SHIFL Histidine biosynthesis bifunctional protein HisIE OS=Shigella flexneri GN=hisI PE=3 SV=1 200 355 3.0E-17
sp|Q3Z0F9|HIS2_SHISS Histidine biosynthesis bifunctional protein HisIE OS=Shigella sonnei (strain Ss046) GN=hisI PE=3 SV=1 200 355 6.0E-17
sp|Q9S5G3|HIS2_ECO57 Histidine biosynthesis bifunctional protein HisIE OS=Escherichia coli O157:H7 GN=hisI PE=3 SV=1 200 355 6.0E-17
sp|Q8FG47|HIS2_ECOL6 Histidine biosynthesis bifunctional protein HisIE OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hisI PE=3 SV=1 200 355 1.0E-16
sp|Q7VJ02|HIS2_HELHP Histidine biosynthesis bifunctional protein HisIE OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=hisI PE=3 SV=1 205 358 1.0E-16
sp|Q8ZFY1|HIS2_YERPE Histidine biosynthesis bifunctional protein HisIE OS=Yersinia pestis GN=hisI PE=3 SV=1 200 355 2.0E-16
sp|Q9X0C5|HIS2_THEMA Histidine biosynthesis bifunctional protein HisIE OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=hisI PE=3 SV=1 205 378 2.0E-16
sp|Q47QS0|HIS3_THEFY Phosphoribosyl-AMP cyclohydrolase OS=Thermobifida fusca (strain YX) GN=hisI PE=3 SV=1 202 290 3.0E-16
sp|P10367|HIS2_SALTY Histidine biosynthesis bifunctional protein HisIE OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hisI PE=3 SV=2 200 375 3.0E-16
sp|Q9PM71|HIS2_CAMJE Histidine biosynthesis bifunctional protein HisIE OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=hisI PE=3 SV=1 203 378 4.0E-16
sp|Q9CLL8|HIS2_PASMU Histidine biosynthesis bifunctional protein HisIE OS=Pasteurella multocida (strain Pm70) GN=hisI PE=3 SV=1 201 381 5.0E-16
sp|Q8Z5J6|HIS2_SALTI Histidine biosynthesis bifunctional protein HisIE OS=Salmonella typhi GN=hisI PE=3 SV=1 200 355 6.0E-16
sp|Q9RPQ3|HIS2_THEP3 Histidine biosynthesis bifunctional protein HisIE OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=hisI PE=3 SV=1 204 371 6.0E-16
sp|Q8DM88|HIS2_THEEB Histidine biosynthesis bifunctional protein HisIE OS=Thermosynechococcus elongatus (strain BP-1) GN=hisI PE=3 SV=1 204 378 1.0E-15
sp|Q1GGT9|HIS3_RUEST Phosphoribosyl-AMP cyclohydrolase OS=Ruegeria sp. (strain TM1040) GN=hisI PE=3 SV=1 204 290 1.0E-15
sp|Q7TUC7|HIS2_PROMP Histidine biosynthesis bifunctional protein HisIE OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=hisI PE=3 SV=1 204 378 2.0E-15
sp|Q9ZHE0|HIS2_BUCAP Histidine biosynthesis bifunctional protein HisIE OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=hisI PE=3 SV=2 201 355 2.0E-15
sp|Q2RTY3|HIS3_RHORT Phosphoribosyl-AMP cyclohydrolase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=hisI PE=3 SV=1 194 317 2.0E-15
sp|O28329|HIS3_ARCFU Phosphoribosyl-AMP cyclohydrolase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hisI PE=3 SV=1 204 290 3.0E-15
sp|Q02130|HIS2_LACLA Histidine biosynthesis bifunctional protein HisIE OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=hisI PE=3 SV=2 201 371 3.0E-15
sp|P44434|HIS2_HAEIN Histidine biosynthesis bifunctional protein HisIE OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hisI PE=3 SV=1 203 355 4.0E-15
sp|Q8PLG5|HIS2_XANAC Histidine biosynthesis bifunctional protein HisIE OS=Xanthomonas axonopodis pv. citri (strain 306) GN=hisI PE=3 SV=1 195 378 8.0E-15
sp|Q8P9N8|HIS2_XANCP Histidine biosynthesis bifunctional protein HisIE OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=hisI PE=3 SV=1 194 378 1.0E-14
sp|Q87C35|HIS2_XYLFT Histidine biosynthesis bifunctional protein HisIE OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=hisI PE=3 SV=1 203 378 1.0E-14
sp|Q9PBD1|HIS2_XYLFA Histidine biosynthesis bifunctional protein HisIE OS=Xylella fastidiosa (strain 9a5c) GN=hisI PE=3 SV=1 203 378 3.0E-14
sp|Q8A7Z7|HIS2_BACTN Histidine biosynthesis bifunctional protein HisIE OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=hisI PE=3 SV=1 200 378 4.0E-14
sp|Q166D6|HIS3_ROSDO Phosphoribosyl-AMP cyclohydrolase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=hisI PE=3 SV=1 204 290 8.0E-14
sp|Q0BWU4|HIS3_HYPNA Phosphoribosyl-AMP cyclohydrolase OS=Hyphomonas neptunium (strain ATCC 15444) GN=hisI PE=3 SV=1 203 290 8.0E-14
sp|P57207|HIS2_BUCAI Histidine biosynthesis bifunctional protein HisIE OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=hisI PE=3 SV=1 197 355 9.0E-14
sp|B8GU33|HIS3_THISH Phosphoribosyl-AMP cyclohydrolase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=hisI PE=3 SV=1 202 290 1.0E-13
sp|A0AG14|HIS3_LISW6 Phosphoribosyl-AMP cyclohydrolase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=hisI PE=3 SV=1 198 290 1.0E-13
sp|B3EM52|HIS3_CHLPB Phosphoribosyl-AMP cyclohydrolase OS=Chlorobium phaeobacteroides (strain BS1) GN=hisI PE=3 SV=1 203 290 1.0E-13
sp|Q03K83|HIS3_STRTD Phosphoribosyl-AMP cyclohydrolase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=hisI PE=3 SV=1 200 290 2.0E-13
sp|Q3AT43|HIS3_CHLCH Phosphoribosyl-AMP cyclohydrolase OS=Chlorobium chlorochromatii (strain CaD3) GN=hisI PE=3 SV=1 203 290 2.0E-13
sp|Q7TV28|HIS2_PROMM Histidine biosynthesis bifunctional protein HisIE OS=Prochlorococcus marinus (strain MIT 9313) GN=hisI PE=3 SV=1 204 371 2.0E-13
sp|A9A5W9|HIS3_NITMS Phosphoribosyl-AMP cyclohydrolase OS=Nitrosopumilus maritimus (strain SCM1) GN=hisI PE=3 SV=1 200 290 2.0E-13
sp|B7HKD5|HIS3_BACC7 Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain AH187) GN=hisI PE=3 SV=1 204 290 3.0E-13
sp|A1B9F2|HIS3_PARDP Phosphoribosyl-AMP cyclohydrolase OS=Paracoccus denitrificans (strain Pd 1222) GN=hisI PE=3 SV=1 203 290 3.0E-13
sp|Q8CQ91|HIS2_STAES Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hisI PE=3 SV=1 200 390 3.0E-13
sp|Q8Y9G6|HIS3_LISMO Phosphoribosyl-AMP cyclohydrolase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=hisI PE=3 SV=1 200 293 4.0E-13
sp|Q722Y8|HIS3_LISMF Phosphoribosyl-AMP cyclohydrolase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=hisI PE=3 SV=1 200 293 4.0E-13
sp|C1L0J1|HIS3_LISMC Phosphoribosyl-AMP cyclohydrolase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=hisI PE=3 SV=1 200 293 4.0E-13
sp|B6IMI3|HIS3_RHOCS Phosphoribosyl-AMP cyclohydrolase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=hisI PE=3 SV=1 203 290 4.0E-13
sp|Q6HLE2|HIS3_BACHK Phosphoribosyl-AMP cyclohydrolase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=hisI PE=3 SV=1 204 290 4.0E-13
sp|Q63DW7|HIS3_BACCZ Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain ZK / E33L) GN=hisI PE=3 SV=1 204 290 4.0E-13
sp|B8DA63|HIS3_LISMH Phosphoribosyl-AMP cyclohydrolase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=hisI PE=3 SV=1 200 293 5.0E-13
sp|A5G0S8|HIS3_ACICJ Phosphoribosyl-AMP cyclohydrolase OS=Acidiphilium cryptum (strain JF-5) GN=hisI PE=3 SV=1 204 290 6.0E-13
sp|Q92E89|HIS3_LISIN Phosphoribosyl-AMP cyclohydrolase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=hisI PE=3 SV=1 198 293 6.0E-13
sp|B9IV01|HIS3_BACCQ Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain Q1) GN=hisI PE=3 SV=1 204 290 7.0E-13
sp|A1BDQ9|HIS3_CHLPD Phosphoribosyl-AMP cyclohydrolase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=hisI PE=3 SV=1 204 290 8.0E-13
sp|Q8NUI4|HIS2_STAAW Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus aureus (strain MW2) GN=hisI PE=3 SV=1 200 388 8.0E-13
sp|Q6G603|HIS2_STAAS Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus aureus (strain MSSA476) GN=hisI PE=3 SV=1 200 388 8.0E-13
sp|Q6GDD2|HIS2_STAAR Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus aureus (strain MRSA252) GN=hisI PE=3 SV=1 200 388 8.0E-13
sp|Q5HCM5|HIS2_STAAC Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus aureus (strain COL) GN=hisI PE=3 SV=1 200 388 8.0E-13
sp|Q5HKP3|HIS2_STAEQ Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hisI PE=3 SV=1 200 390 9.0E-13
sp|B9KRK6|HIS3_RHOSK Phosphoribosyl-AMP cyclohydrolase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=hisI PE=3 SV=1 195 290 9.0E-13
sp|Q28PE4|HIS3_JANSC Phosphoribosyl-AMP cyclohydrolase OS=Jannaschia sp. (strain CCS1) GN=hisI PE=3 SV=1 203 290 1.0E-12
sp|C3KVX7|HIS3_CLOB6 Phosphoribosyl-AMP cyclohydrolase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=hisI PE=3 SV=1 203 290 1.0E-12
sp|A8LK58|HIS3_DINSH Phosphoribosyl-AMP cyclohydrolase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=hisI PE=3 SV=1 204 290 1.0E-12
sp|Q8KF68|HIS3_CHLTE Phosphoribosyl-AMP cyclohydrolase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=hisI PE=3 SV=1 203 290 1.0E-12
sp|C1EMQ8|HIS3_BACC3 Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain 03BB102) GN=hisI PE=3 SV=1 204 290 1.0E-12
sp|A0RBM3|HIS3_BACAH Phosphoribosyl-AMP cyclohydrolase OS=Bacillus thuringiensis (strain Al Hakam) GN=hisI PE=3 SV=1 204 290 1.0E-12
sp|Q3IMJ0|HIS3_NATPD Phosphoribosyl-AMP cyclohydrolase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hisI PE=3 SV=1 205 295 1.0E-12
sp|Q2S3T1|HIS3_SALRD Phosphoribosyl-AMP cyclohydrolase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=hisI PE=3 SV=1 203 290 1.0E-12
sp|P9WMM7|HIS3_MYCTU Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=hisI PE=1 SV=1 203 290 1.0E-12
sp|P9WMM6|HIS3_MYCTO Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=hisI PE=3 SV=1 203 290 1.0E-12
sp|A5U2W2|HIS3_MYCTA Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=hisI PE=3 SV=1 203 290 1.0E-12
sp|C1ANM8|HIS3_MYCBT Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=hisI PE=3 SV=1 203 290 1.0E-12
sp|A1KJ22|HIS3_MYCBP Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=hisI PE=3 SV=1 203 290 1.0E-12
sp|P0A5B4|HIS3_MYCBO Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=hisI PE=3 SV=1 203 290 1.0E-12
sp|B1ILB1|HIS3_CLOBK Phosphoribosyl-AMP cyclohydrolase OS=Clostridium botulinum (strain Okra / Type B1) GN=hisI PE=3 SV=1 204 290 1.0E-12
sp|Q53158|HIS3_RHOS4 Phosphoribosyl-AMP cyclohydrolase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=hisI PE=3 SV=1 195 290 2.0E-12
sp|B2UX19|HIS3_CLOBA Phosphoribosyl-AMP cyclohydrolase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=hisI PE=3 SV=1 200 290 2.0E-12
sp|P64356|HIS2_STAAN Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus aureus (strain N315) GN=hisI PE=3 SV=1 200 388 2.0E-12
sp|P64355|HIS2_STAAM Histidine biosynthesis bifunctional protein HisIE OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hisI PE=3 SV=1 200 388 2.0E-12
sp|A7GMV1|HIS3_BACCN Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=hisI PE=3 SV=1 201 290 2.0E-12
sp|B7JFZ6|HIS3_BACC0 Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain AH820) GN=hisI PE=3 SV=1 204 290 2.0E-12
sp|P60540|HIS3_BACAN Phosphoribosyl-AMP cyclohydrolase OS=Bacillus anthracis GN=hisI PE=3 SV=1 204 290 2.0E-12
sp|C3L9P6|HIS3_BACAC Phosphoribosyl-AMP cyclohydrolase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=hisI PE=3 SV=1 204 290 2.0E-12
sp|Q7VD07|HIS2_PROMA Histidine biosynthesis bifunctional protein HisIE OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=hisI PE=3 SV=1 204 355 2.0E-12
sp|A3PJ78|HIS3_RHOS1 Phosphoribosyl-AMP cyclohydrolase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=hisI PE=3 SV=1 195 290 2.0E-12
sp|Q0A9D7|HIS3_ALKEH Phosphoribosyl-AMP cyclohydrolase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=hisI PE=3 SV=1 184 290 3.0E-12
sp|Q7N6I6|HIS2_PHOLL Histidine biosynthesis bifunctional protein HisIE OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hisI PE=3 SV=1 205 355 3.0E-12
sp|P60541|HIS3_CORDI Phosphoribosyl-AMP cyclohydrolase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=hisI PE=3 SV=1 204 290 3.0E-12
sp|B3QLJ0|HIS3_CHLP8 Phosphoribosyl-AMP cyclohydrolase OS=Chlorobaculum parvum (strain NCIB 8327) GN=hisI PE=3 SV=1 204 290 3.0E-12
sp|P62393|HIS3_BACC1 Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=hisI PE=3 SV=1 204 290 4.0E-12
sp|A4FLL5|HIS3_SACEN Phosphoribosyl-AMP cyclohydrolase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=hisI PE=3 SV=1 202 290 4.0E-12
sp|A4WRQ0|HIS3_RHOS5 Phosphoribosyl-AMP cyclohydrolase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=hisI PE=3 SV=1 204 290 4.0E-12
sp|Q8DTR4|HIS3_STRMU Phosphoribosyl-AMP cyclohydrolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=hisI PE=3 SV=1 204 290 4.0E-12
sp|Q4JW51|HIS3_CORJK Phosphoribosyl-AMP cyclohydrolase OS=Corynebacterium jeikeium (strain K411) GN=hisI PE=3 SV=1 203 290 5.0E-12
sp|Q8NNT9|HIS3_CORGL Phosphoribosyl-AMP cyclohydrolase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=hisI PE=3 SV=1 204 290 5.0E-12
sp|Q2LVG1|HIS3_SYNAS Phosphoribosyl-AMP cyclohydrolase OS=Syntrophus aciditrophicus (strain SB) GN=hisI PE=3 SV=1 203 315 7.0E-12
sp|B3EFT2|HIS3_CHLL2 Phosphoribosyl-AMP cyclohydrolase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=hisI PE=3 SV=1 204 290 8.0E-12
sp|Q9HN23|HIS3_HALSA Phosphoribosyl-AMP cyclohydrolase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hisI PE=3 SV=1 199 290 8.0E-12
sp|B0R7I1|HIS3_HALS3 Phosphoribosyl-AMP cyclohydrolase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hisI PE=3 SV=1 199 290 8.0E-12
sp|A4SG83|HIS3_CHLPM Phosphoribosyl-AMP cyclohydrolase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=hisI PE=3 SV=1 204 290 8.0E-12
sp|A5I247|HIS3_CLOBH Phosphoribosyl-AMP cyclohydrolase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=hisI PE=3 SV=1 204 290 9.0E-12
sp|A7FU83|HIS3_CLOB1 Phosphoribosyl-AMP cyclohydrolase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=hisI PE=3 SV=1 204 290 9.0E-12
sp|Q21FQ0|HIS3_SACD2 Phosphoribosyl-AMP cyclohydrolase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=hisI PE=3 SV=1 196 290 1.0E-11
sp|Q5LST2|HIS3_RUEPO Phosphoribosyl-AMP cyclohydrolase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=hisI PE=3 SV=1 204 290 1.0E-11
sp|Q58825|HIS3_METJA Phosphoribosyl-AMP cyclohydrolase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hisI PE=3 SV=1 205 290 1.0E-11
sp|Q0BTI5|HIS3_GRABC Phosphoribosyl-AMP cyclohydrolase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=hisI PE=3 SV=1 204 290 1.0E-11
sp|Q4K3E4|HIS32_PSEF5 Phosphoribosyl-AMP cyclohydrolase 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hisI2 PE=3 SV=1 184 290 1.0E-11
sp|A0RZ79|HIS3_CENSY Phosphoribosyl-AMP cyclohydrolase OS=Cenarchaeum symbiosum (strain A) GN=hisI PE=3 SV=1 200 290 2.0E-11
sp|A4QFF8|HIS3_CORGB Phosphoribosyl-AMP cyclohydrolase OS=Corynebacterium glutamicum (strain R) GN=hisI PE=3 SV=1 204 290 2.0E-11
sp|B0KM39|HIS3_PSEPG Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas putida (strain GB-1) GN=hisI PE=3 SV=1 197 290 2.0E-11
sp|Q88D15|HIS3_PSEPK Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas putida (strain KT2440) GN=hisI PE=3 SV=1 197 290 2.0E-11
sp|A5WA48|HIS3_PSEP1 Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=hisI PE=3 SV=1 197 290 2.0E-11
sp|Q3B281|HIS3_CHLL7 Phosphoribosyl-AMP cyclohydrolase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=hisI PE=3 SV=1 204 290 2.0E-11
sp|A6LT23|HIS3_CLOB8 Phosphoribosyl-AMP cyclohydrolase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=hisI PE=3 SV=1 200 290 2.0E-11
sp|A1VHE5|HIS3_DESVV Phosphoribosyl-AMP cyclohydrolase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=hisI PE=3 SV=1 204 315 2.0E-11
sp|P62386|HIS3_DESVH Phosphoribosyl-AMP cyclohydrolase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=hisI PE=3 SV=1 204 315 2.0E-11
sp|Q5UZH6|HIS3_HALMA Phosphoribosyl-AMP cyclohydrolase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hisI PE=3 SV=1 205 290 3.0E-11
sp|A0PP21|HIS3_MYCUA Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium ulcerans (strain Agy99) GN=hisI PE=3 SV=1 177 290 3.0E-11
sp|O82768|HIS2_ARATH Histidine biosynthesis bifunctional protein hisIE, chloroplastic OS=Arabidopsis thaliana GN=HISN2 PE=1 SV=1 203 371 3.0E-11
sp|B1J2S5|HIS3_PSEPW Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas putida (strain W619) GN=hisI PE=3 SV=1 197 290 3.0E-11
sp|C1FN43|HIS3_CLOBJ Phosphoribosyl-AMP cyclohydrolase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=hisI PE=3 SV=1 205 290 3.0E-11
sp|Q18DH0|HIS3_HALWD Phosphoribosyl-AMP cyclohydrolase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=hisI PE=3 SV=1 203 315 3.0E-11
sp|Q6A8P2|HIS3_PROAC Phosphoribosyl-AMP cyclohydrolase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=hisI PE=3 SV=1 204 290 4.0E-11
sp|A4T9N1|HIS3_MYCGI Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium gilvum (strain PYR-GCK) GN=hisI PE=3 SV=1 203 290 4.0E-11
sp|A2STB6|HIS3_METLZ Phosphoribosyl-AMP cyclohydrolase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=hisI PE=3 SV=1 203 290 5.0E-11
sp|A1WXS8|HIS3_HALHL Phosphoribosyl-AMP cyclohydrolase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=hisI PE=3 SV=1 203 290 6.0E-11
sp|Q30VD6|HIS3_DESAG Phosphoribosyl-AMP cyclohydrolase OS=Desulfovibrio alaskensis (strain G20) GN=hisI PE=3 SV=1 198 315 6.0E-11
sp|A4YSB5|HIS3_BRASO Phosphoribosyl-AMP cyclohydrolase OS=Bradyrhizobium sp. (strain ORS278) GN=hisI PE=3 SV=1 204 290 6.0E-11
sp|Q88UE4|HIS3_LACPL Phosphoribosyl-AMP cyclohydrolase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=hisI PE=3 SV=1 200 290 7.0E-11
sp|B2HQA9|HIS3_MYCMM Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=hisI PE=3 SV=1 177 290 8.0E-11
sp|Q81G01|HIS3_BACCR Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=hisI PE=3 SV=1 204 290 8.0E-11
sp|B7HHG6|HIS3_BACC4 Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain B4264) GN=hisI PE=3 SV=1 204 290 9.0E-11
sp|A1U670|HIS3_MARHV Phosphoribosyl-AMP cyclohydrolase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=hisI PE=3 SV=1 190 290 9.0E-11
sp|Q82A89|HIS3_STRAW Phosphoribosyl-AMP cyclohydrolase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=hisI PE=3 SV=1 203 301 9.0E-11
sp|B4S4Y9|HIS3_PROA2 Phosphoribosyl-AMP cyclohydrolase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=hisI PE=3 SV=1 204 290 1.0E-10
sp|Q7VQW4|HIS2_BLOFL Histidine biosynthesis bifunctional protein HisIE OS=Blochmannia floridanus GN=hisI PE=3 SV=1 177 358 1.0E-10
sp|C1A0L2|HIS3_RHOE4 Phosphoribosyl-AMP cyclohydrolase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=hisI PE=3 SV=1 204 290 1.0E-10
sp|Q2KTT0|HIS3_BORA1 Phosphoribosyl-AMP cyclohydrolase OS=Bordetella avium (strain 197N) GN=hisI PE=3 SV=1 203 290 1.0E-10
sp|A4FZQ7|HIS3_METM5 Phosphoribosyl-AMP cyclohydrolase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=hisI PE=3 SV=1 205 290 1.0E-10
sp|Q2W4W4|HIS3_MAGSA Phosphoribosyl-AMP cyclohydrolase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=hisI PE=3 SV=1 203 290 1.0E-10
sp|Q5FPD9|HIS3_GLUOX Phosphoribosyl-AMP cyclohydrolase OS=Gluconobacter oxydans (strain 621H) GN=hisI PE=3 SV=1 203 290 1.0E-10
sp|Q1I3S7|HIS3_PSEE4 Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas entomophila (strain L48) GN=hisI PE=3 SV=1 197 290 2.0E-10
sp|B4SCX8|HIS3_PELPB Phosphoribosyl-AMP cyclohydrolase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=hisI PE=3 SV=1 204 290 2.0E-10
sp|A1SL49|HIS3_NOCSJ Phosphoribosyl-AMP cyclohydrolase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=hisI PE=3 SV=1 202 290 2.0E-10
sp|B9JFG9|HIS3_AGRRK Phosphoribosyl-AMP cyclohydrolase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=hisI PE=3 SV=1 204 290 2.0E-10
sp|Q1QMS2|HIS3_NITHX Phosphoribosyl-AMP cyclohydrolase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=hisI PE=3 SV=1 204 290 2.0E-10
sp|Q97KH7|HIS3_CLOAB Phosphoribosyl-AMP cyclohydrolase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hisI PE=3 SV=1 200 290 2.0E-10
sp|Q9HUB7|HIS3_PSEAE Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=hisI PE=3 SV=1 203 290 2.0E-10
sp|Q02EV1|HIS3_PSEAB Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=hisI PE=3 SV=1 203 290 2.0E-10
sp|B7V3F9|HIS3_PSEA8 Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas aeruginosa (strain LESB58) GN=hisI PE=3 SV=1 203 290 2.0E-10
sp|A6VDI9|HIS3_PSEA7 Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas aeruginosa (strain PA7) GN=hisI PE=3 SV=1 203 290 2.0E-10
sp|A6X0X1|HIS3_OCHA4 Phosphoribosyl-AMP cyclohydrolase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=hisI PE=3 SV=1 204 290 2.0E-10
sp|B7INA4|HIS3_BACC2 Phosphoribosyl-AMP cyclohydrolase OS=Bacillus cereus (strain G9842) GN=hisI PE=3 SV=1 204 290 2.0E-10
sp|B3WED0|HIS3_LACCB Phosphoribosyl-AMP cyclohydrolase OS=Lactobacillus casei (strain BL23) GN=hisI PE=3 SV=1 192 290 2.0E-10
sp|C5CBK2|HIS3_MICLC Phosphoribosyl-AMP cyclohydrolase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=hisI PE=3 SV=1 204 290 3.0E-10
sp|Q82WM6|HIS3_NITEU Phosphoribosyl-AMP cyclohydrolase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=hisI PE=3 SV=1 196 316 3.0E-10
sp|Q8FP00|HIS3_COREF Phosphoribosyl-AMP cyclohydrolase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hisI PE=3 SV=1 181 290 3.0E-10
sp|C1ATY6|HIS3_RHOOB Phosphoribosyl-AMP cyclohydrolase OS=Rhodococcus opacus (strain B4) GN=hisI PE=3 SV=1 204 290 3.0E-10
sp|Q0SHY8|HIS3_RHOJR Phosphoribosyl-AMP cyclohydrolase OS=Rhodococcus jostii (strain RHA1) GN=hisI PE=3 SV=1 204 290 3.0E-10
sp|Q0AEU0|HIS3_NITEC Phosphoribosyl-AMP cyclohydrolase OS=Nitrosomonas eutropha (strain C91) GN=hisI PE=3 SV=1 203 316 3.0E-10
sp|Q98LQ5|HIS3_RHILO Phosphoribosyl-AMP cyclohydrolase OS=Rhizobium loti (strain MAFF303099) GN=hisI PE=3 SV=1 202 290 3.0E-10
sp|Q039B6|HIS3_LACC3 Phosphoribosyl-AMP cyclohydrolase OS=Lactobacillus casei (strain ATCC 334) GN=hisI PE=3 SV=1 192 290 4.0E-10
sp|A4VGE2|HIS3_PSEU5 Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas stutzeri (strain A1501) GN=hisI PE=3 SV=1 203 290 4.0E-10
sp|Q6AJV8|HIS3_DESPS Phosphoribosyl-AMP cyclohydrolase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=hisI PE=3 SV=1 203 318 4.0E-10
sp|Q0VML6|HIS3_ALCBS Phosphoribosyl-AMP cyclohydrolase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hisI PE=3 SV=1 204 290 4.0E-10
sp|Q7VSY5|HIS3_BORPE Phosphoribosyl-AMP cyclohydrolase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=hisI PE=3 SV=1 203 290 4.0E-10
sp|A0B8B3|HIS3_METTP Phosphoribosyl-AMP cyclohydrolase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=hisI PE=3 SV=1 202 290 4.0E-10
sp|Q3ST00|HIS3_NITWN Phosphoribosyl-AMP cyclohydrolase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hisI PE=3 SV=1 204 290 4.0E-10
sp|Q0W7V3|HIS3_METAR Phosphoribosyl-AMP cyclohydrolase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hisI PE=3 SV=1 203 300 5.0E-10
sp|B3PK83|HIS3_CELJU Phosphoribosyl-AMP cyclohydrolase OS=Cellvibrio japonicus (strain Ueda107) GN=hisI PE=3 SV=1 194 290 5.0E-10
sp|Q89IW3|HIS3_BRADU Phosphoribosyl-AMP cyclohydrolase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hisI PE=3 SV=1 204 290 5.0E-10
sp|A0LCF4|HIS3_MAGMM Phosphoribosyl-AMP cyclohydrolase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=hisI PE=3 SV=1 204 290 5.0E-10
sp|Q47AM4|HIS3_DECAR Phosphoribosyl-AMP cyclohydrolase OS=Dechloromonas aromatica (strain RCB) GN=hisI PE=3 SV=1 203 298 6.0E-10
sp|Q87UY9|HIS3_PSESM Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=hisI PE=3 SV=1 197 290 6.0E-10
sp|Q48PJ7|HIS3_PSE14 Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=hisI PE=3 SV=1 197 290 6.0E-10
sp|A7I9M0|HIS3_METB6 Phosphoribosyl-AMP cyclohydrolase OS=Methanoregula boonei (strain 6A8) GN=hisI PE=3 SV=1 204 313 6.0E-10
sp|Q4ZZG6|HIS3_PSEU2 Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=hisI PE=3 SV=1 197 290 7.0E-10
sp|A0QX88|HIS3_MYCS2 Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=hisI PE=3 SV=1 203 290 7.0E-10
sp|A5CZ72|HIS3_PELTS Phosphoribosyl-AMP cyclohydrolase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=hisI PE=3 SV=1 204 290 8.0E-10
sp|Q3J6Q0|HIS3_NITOC Phosphoribosyl-AMP cyclohydrolase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=hisI PE=3 SV=1 193 290 8.0E-10
sp|C1DHS5|HIS3_AZOVD Phosphoribosyl-AMP cyclohydrolase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=hisI PE=3 SV=1 203 290 8.0E-10
sp|Q89AX6|HIS2_BUCBP Histidine biosynthesis bifunctional protein HisIE OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=hisI PE=3 SV=1 188 381 8.0E-10
sp|B8FLE7|HIS3_DESAA Phosphoribosyl-AMP cyclohydrolase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=hisI PE=3 SV=1 200 293 8.0E-10
sp|Q1QWC3|HIS3_CHRSD Phosphoribosyl-AMP cyclohydrolase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=hisI PE=3 SV=1 194 290 8.0E-10
sp|Q4KJL5|HIS31_PSEF5 Phosphoribosyl-AMP cyclohydrolase 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=hisI1 PE=3 SV=1 203 290 9.0E-10
sp|A9HWB8|HIS3_BORPD Phosphoribosyl-AMP cyclohydrolase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=hisI PE=3 SV=1 203 290 9.0E-10
sp|A9A817|HIS3_METM6 Phosphoribosyl-AMP cyclohydrolase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=hisI PE=3 SV=1 205 290 9.0E-10
sp|Q1H4R1|HIS3_METFK Phosphoribosyl-AMP cyclohydrolase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=hisI PE=3 SV=1 197 290 9.0E-10
sp|C0QLA8|HIS3_DESAH Phosphoribosyl-AMP cyclohydrolase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=hisI PE=3 SV=1 200 290 1.0E-09
sp|Q7W2X8|HIS3_BORPA Phosphoribosyl-AMP cyclohydrolase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=hisI PE=3 SV=1 203 290 1.0E-09
sp|Q7WDX8|HIS3_BORBR Phosphoribosyl-AMP cyclohydrolase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=hisI PE=3 SV=1 203 290 1.0E-09
sp|Q9X7C3|HIS3_MYCLE Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium leprae (strain TN) GN=hisI PE=3 SV=1 203 290 1.0E-09
sp|B8ZRB5|HIS3_MYCLB Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium leprae (strain Br4923) GN=hisI PE=3 SV=1 203 290 1.0E-09
sp|A3CX32|HIS3_METMJ Phosphoribosyl-AMP cyclohydrolase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=hisI PE=3 SV=1 203 290 1.0E-09
sp|A6UT21|HIS3_META3 Phosphoribosyl-AMP cyclohydrolase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=hisI PE=3 SV=1 205 290 1.0E-09
sp|Q5YYP1|HIS3_NOCFA Phosphoribosyl-AMP cyclohydrolase OS=Nocardia farcinica (strain IFM 10152) GN=hisI PE=3 SV=1 204 293 1.0E-09
sp|P60543|HIS3_MYCPA Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=hisI PE=3 SV=1 203 290 1.0E-09
sp|A0QHH5|HIS3_MYCA1 Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium avium (strain 104) GN=hisI PE=3 SV=1 203 290 2.0E-09
sp|Q43925|HIS3_AZOCH Phosphoribosyl-AMP cyclohydrolase OS=Azotobacter chroococcum mcd 1 GN=hisI PE=3 SV=1 203 290 2.0E-09
sp|A1T8W8|HIS3_MYCVP Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=hisI PE=3 SV=1 203 290 2.0E-09
sp|B1W0N3|HIS3_STRGG Phosphoribosyl-AMP cyclohydrolase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=hisI PE=3 SV=1 203 290 2.0E-09
sp|O26347|HIS3_METTH Phosphoribosyl-AMP cyclohydrolase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hisI PE=1 SV=1 203 315 2.0E-09
sp|A5ELY1|HIS3_BRASB Phosphoribosyl-AMP cyclohydrolase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=hisI PE=3 SV=1 204 290 2.0E-09
sp|Q3KJC8|HIS3_PSEPF Phosphoribosyl-AMP cyclohydrolase OS=Pseudomonas fluorescens (strain Pf0-1) GN=hisI PE=3 SV=1 203 290 3.0E-09
sp|B3QE24|HIS3_RHOPT Phosphoribosyl-AMP cyclohydrolase OS=Rhodopseudomonas palustris (strain TIE-1) GN=hisI PE=3 SV=1 204 315 3.0E-09
sp|Q1B7H1|HIS3_MYCSS Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium sp. (strain MCS) GN=hisI PE=3 SV=1 203 290 3.0E-09
sp|A1UHK1|HIS3_MYCSK Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium sp. (strain KMS) GN=hisI PE=3 SV=1 203 290 3.0E-09
sp|Q0RFX5|HIS3_FRAAA Phosphoribosyl-AMP cyclohydrolase OS=Frankia alni (strain ACN14a) GN=hisI PE=3 SV=1 204 290 3.0E-09
sp|A3Q124|HIS3_MYCSJ Phosphoribosyl-AMP cyclohydrolase OS=Mycobacterium sp. (strain JLS) GN=hisI PE=3 SV=1 203 290 3.0E-09
sp|A8ZXG8|HIS3_DESOH Phosphoribosyl-AMP cyclohydrolase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=hisI PE=3 SV=1 200 290 5.0E-09
sp|Q11JM5|HIS3_CHESB Phosphoribosyl-AMP cyclohydrolase OS=Chelativorans sp. (strain BNC1) GN=hisI PE=3 SV=1 203 290 5.0E-09
sp|Q134L8|HIS3_RHOPS Phosphoribosyl-AMP cyclohydrolase OS=Rhodopseudomonas palustris (strain BisB5) GN=hisI PE=3 SV=1 204 290 5.0E-09
sp|Q39UE8|HIS3_GEOMG Phosphoribosyl-AMP cyclohydrolase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=hisI PE=3 SV=1 204 290 6.0E-09
sp|Q9S2U1|HIS3_STRCO Phosphoribosyl-AMP cyclohydrolase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hisI PE=3 SV=1 203 290 7.0E-09
sp|A1KAV3|HIS3_AZOSB Phosphoribosyl-AMP cyclohydrolase OS=Azoarcus sp. (strain BH72) GN=hisI PE=3 SV=1 203 290 7.0E-09
sp|Q2NGK6|HIS3_METST Phosphoribosyl-AMP cyclohydrolase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=hisI PE=3 SV=1 213 290 7.0E-09
sp|Q8TS96|HIS3_METAC Phosphoribosyl-AMP cyclohydrolase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hisI PE=3 SV=1 203 308 8.0E-09
sp|Q39K84|HIS3_BURL3 Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=hisI PE=3 SV=1 203 290 8.0E-09
sp|Q845U6|HIS3_BURM1 Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=hisI PE=3 SV=2 203 290 8.0E-09
sp|A8A9Z2|HIS3_IGNH4 Phosphoribosyl-AMP cyclohydrolase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=hisI PE=3 SV=1 190 290 9.0E-09
sp|Q3SEU9|HIS3_THIDA Phosphoribosyl-AMP cyclohydrolase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=hisI PE=3 SV=1 204 290 9.0E-09
sp|A0K3V9|HIS3_BURCH Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia cenocepacia (strain HI2424) GN=hisI PE=3 SV=1 203 290 1.0E-08
sp|B1JUA6|HIS3_BURCC Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia cenocepacia (strain MC0-3) GN=hisI PE=3 SV=1 203 290 1.0E-08
sp|Q1BS32|HIS3_BURCA Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia cenocepacia (strain AU 1054) GN=hisI PE=3 SV=1 203 290 1.0E-08
sp|Q7UJC4|HIS3_RHOBA Phosphoribosyl-AMP cyclohydrolase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=hisI PE=3 SV=1 205 290 1.0E-08
sp|A5G6I6|HIS3_GEOUR Phosphoribosyl-AMP cyclohydrolase OS=Geobacter uraniireducens (strain Rf4) GN=hisI PE=3 SV=1 204 290 1.0E-08
sp|Q3M244|HIS3_ANAVT Phosphoribosyl-AMP cyclohydrolase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hisI PE=3 SV=1 205 302 1.0E-08
sp|A5V3S9|HIS3_SPHWW Phosphoribosyl-AMP cyclohydrolase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=hisI PE=3 SV=1 204 290 1.0E-08
sp|Q0BIW3|HIS3_BURCM Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=hisI PE=3 SV=1 203 290 1.0E-08
sp|B1YRW2|HIS3_BURA4 Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia ambifaria (strain MC40-6) GN=hisI PE=3 SV=1 203 290 1.0E-08
sp|Q212N1|HIS3_RHOPB Phosphoribosyl-AMP cyclohydrolase OS=Rhodopseudomonas palustris (strain BisB18) GN=hisI PE=3 SV=1 204 290 1.0E-08
sp|Q8G0L3|HIS3_BRUSU Phosphoribosyl-AMP cyclohydrolase OS=Brucella suis biovar 1 (strain 1330) GN=hisI PE=3 SV=2 204 290 1.0E-08
sp|B0CGM5|HIS3_BRUSI Phosphoribosyl-AMP cyclohydrolase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=hisI PE=3 SV=1 204 290 1.0E-08
sp|A9M587|HIS3_BRUC2 Phosphoribosyl-AMP cyclohydrolase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=hisI PE=3 SV=1 204 290 1.0E-08
sp|Q8YH95|HIS3_BRUME Phosphoribosyl-AMP cyclohydrolase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=hisI PE=3 SV=1 204 290 1.0E-08
sp|C0RJ48|HIS3_BRUMB Phosphoribosyl-AMP cyclohydrolase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=hisI PE=3 SV=1 204 290 1.0E-08
sp|Q57D60|HIS3_BRUAB Phosphoribosyl-AMP cyclohydrolase OS=Brucella abortus biovar 1 (strain 9-941) GN=hisI PE=3 SV=1 204 290 1.0E-08
sp|B2S5T1|HIS3_BRUA1 Phosphoribosyl-AMP cyclohydrolase OS=Brucella abortus (strain S19) GN=hisI PE=3 SV=1 204 290 1.0E-08
sp|P58836|HIS3_METKA Phosphoribosyl-AMP cyclohydrolase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=hisI PE=3 SV=1 205 290 1.0E-08
sp|C6E0X3|HIS3_GEOSM Phosphoribosyl-AMP cyclohydrolase OS=Geobacter sp. (strain M21) GN=hisI PE=3 SV=1 204 290 1.0E-08
sp|B5EE14|HIS3_GEOBB Phosphoribosyl-AMP cyclohydrolase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=hisI PE=3 SV=1 204 290 1.0E-08
sp|Q2YQ02|HIS3_BRUA2 Phosphoribosyl-AMP cyclohydrolase OS=Brucella abortus (strain 2308) GN=hisI PE=3 SV=1 204 290 1.0E-08
sp|B9M8U6|HIS3_GEODF Phosphoribosyl-AMP cyclohydrolase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=hisI PE=3 SV=1 200 290 1.0E-08
sp|Q9AAY5|HIS3_CAUCR Phosphoribosyl-AMP cyclohydrolase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=hisI PE=3 SV=1 203 290 2.0E-08
sp|B8GZS0|HIS3_CAUCN Phosphoribosyl-AMP cyclohydrolase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=hisI PE=3 SV=1 203 290 2.0E-08
sp|B4E642|HIS3_BURCJ Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=hisI PE=3 SV=1 203 290 2.0E-08
sp|A4JAX0|HIS3_BURVG Phosphoribosyl-AMP cyclohydrolase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=hisI PE=3 SV=1 203 290 2.0E-08
sp|A5CXC7|HIS3_VESOH Phosphoribosyl-AMP cyclohydrolase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=hisI PE=3 SV=1 204 290 2.0E-08
sp|Q465C4|HIS3_METBF Phosphoribosyl-AMP cyclohydrolase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hisI PE=3 SV=1 204 317 3.0E-08
sp|A6VIS0|HIS3_METM7 Phosphoribosyl-AMP cyclohydrolase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=hisI PE=3 SV=1 205 290 3.0E-08
sp|P60544|HIS3_RHOPA Phosphoribosyl-AMP cyclohydrolase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hisI PE=3 SV=1 204 307 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0000105 histidine biosynthetic process Yes
GO:0051287 NAD binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0004635 phosphoribosyl-AMP cyclohydrolase activity Yes
GO:0008270 zinc ion binding Yes
GO:0004399 histidinol dehydrogenase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0071704 organic substance metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0005488 binding No
GO:0052803 imidazole-containing compound metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0043436 oxoacid metabolic process No
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0043169 cation binding No
GO:0046394 carboxylic acid biosynthetic process No
GO:0008150 biological_process No
GO:0016814 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines No
GO:0036094 small molecule binding No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0003674 molecular_function No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:1901605 alpha-amino acid metabolic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044281 small molecule metabolic process No
GO:0006547 histidine metabolic process No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0009073 aromatic amino acid family biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0019238 cyclohydrolase activity No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0016787 hydrolase activity No
GO:0048037 cofactor binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0009072 aromatic amino acid family metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046914 transition metal ion binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0050662 coenzyme binding No
GO:0016491 oxidoreductase activity No
GO:0019438 aromatic compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7049
METELPLPFLVSVAIPPGLAGLDGLSREEVSLLGNPFLEATPTVEEKLARFFNRHNYEFHAHVDATSLDSQEGVT
ALLDRGARRVFVAPDALPQYAGFGGRVLPVVSTLDLSAASKDGLLIKEFDLDAAGLDKFVDQAQKAKVRNLYLKP
VARADPAKFLEVARKCNAIPVLPSTALTTDKNDGARLLLSKVIAASWTSDRPDGLVPTVVTDESGVALGLAYSSE
ESILEALKTQTGVYQSRKRGLWIKGATSGDTQELVRLSLDCDSDALRFVVRQKNRFCHLDQFGCFGDLRGIPALE
QTLKSRKVSAPEGSYTARLFSDEKLLRAKIMEEAEELCAAQSPQDVAFEAADLIYFALTKAVGSGVSLADIEANL
DAKGLKVTRRQGDAKGKWAEKEGIQSAPAASSKPEQQKQADKAQEGRIVMQRIDASKATEAELLEKLKRPSQKSP
EAILKIVTPIIDEVRRGGDKAVLAYTHKFEKATSLTSPVLKAPFPKELMQLDAETMEAMDTSFENIRKFHSAQRE
DKALSVETMPGVVCGRFSRPIERVGLYIPGGTAVLPSTALMLGVPAMVAGCKKIVFASPPRADGRITPEIVYAAH
KVGAESIVLAGGAQAVAALAYGTESVSKVDKILGPGNQFVTAAKMHVSNDTNAGVGIDMPAGPSEVLVVADAAAN
PAFVASDLLSQAEHGADSQVVLVAVGLAEAELRAIDDEVHAQATALPRVDIVRAAIAHSVTVLVPSVDEAMRISN
EYAPEHLILQLRDAARLVDKVTNAGSVFIGEWTPESVGDYSAGVNHSLPTYGFAKQYSGVNLGSFTKHITCSNLT
AAGLRNVGPAVMQLARVEELEAHRRAVEIRLRHMDAKKL*
Coding >Hirsu2|7049
ATGGAGACGGAGCTACCTTTGCCCTTCCTGGTCAGCGTGGCCATCCCGCCGGGCCTGGCCGGCCTCGACGGCCTG
AGCCGCGAAGAAGTGTCGCTGCTGGGCAATCCCTTCTTGGAGGCGACGCCGACCGTCGAGGAGAAGCTTGCCCGC
TTCTTCAACCGCCACAACTACGAGTTCCACGCCCACGTCGACGCCACCAGCCTCGACTCTCAGGAAGGCGTCACG
GCCCTTCTCGACCGCGGCGCGCGGAGGGTCTTCGTCGCCCCGGACGCTCTGCCGCAGTACGCCGGCTTCGGGGGC
CGGGTGCTGCCCGTCGTCTCGACCCTTGACCTGTCTGCCGCCTCCAAGGACGGACTGCTGATCAAGGAGTTCGAC
CTCGATGCCGCCGGACTGGACAAGTTCGTCGACCAGGCGCAAAAAGCCAAGGTCCGGAACCTGTACCTCAAGCCT
GTGGCGCGGGCCGACCCGGCCAAGTTTCTCGAGGTTGCCCGGAAGTGCAACGCCATCCCTGTCCTACCCTCCACC
GCGCTCACGACGGACAAGAACGACGGCGCGAGGCTGCTCCTGTCAAAGGTCATCGCCGCGTCCTGGACGTCCGAC
CGGCCGGACGGCCTGGTGCCCACCGTCGTCACGGACGAGTCGGGCGTCGCCCTCGGCCTCGCCTACTCGAGCGAG
GAGAGCATCCTCGAGGCATTGAAGACGCAGACGGGCGTCTACCAGAGCAGGAAGAGGGGCCTATGGATCAAGGGA
GCCACCTCGGGCGACACCCAGGAGCTGGTCCGCCTGTCGCTCGACTGCGACAGCGACGCTCTCCGGTTCGTCGTC
CGGCAAAAGAACCGCTTCTGCCACCTGGACCAGTTCGGCTGTTTCGGCGACCTTCGAGGCATTCCGGCCCTCGAG
CAGACGCTCAAGTCGAGGAAAGTGTCCGCCCCTGAGGGCTCCTATACCGCACGCCTCTTCTCCGACGAGAAGCTG
CTGCGGGCGAAGATCATGGAGGAGGCGGAGGAGCTCTGCGCCGCCCAGTCGCCCCAGGACGTCGCCTTCGAGGCC
GCCGATCTCATCTACTTCGCCCTGACCAAGGCGGTCGGCTCGGGCGTCAGCCTGGCCGACATCGAAGCCAACCTC
GACGCCAAGGGCTTGAAGGTGACGAGGAGACAGGGCGACGCCAAGGGCAAGTGGGCGGAGAAGGAGGGCATCCAA
TCCGCTCCCGCGGCCTCCTCCAAGCCGGAACAGCAGAAACAGGCCGACAAGGCCCAGGAGGGCCGAATCGTGATG
CAGAGGATTGACGCGAGCAAGGCCACCGAGGCAGAGCTCCTGGAGAAGCTCAAGCGGCCGTCGCAGAAGTCGCCC
GAGGCCATCCTCAAGATCGTGACGCCCATCATCGACGAGGTGCGGCGGGGCGGAGACAAGGCGGTGCTGGCGTAC
ACGCACAAGTTCGAGAAGGCGACGTCGCTGACGTCGCCCGTGCTCAAGGCGCCCTTCCCCAAGGAGCTGATGCAG
CTGGACGCGGAGACGATGGAGGCCATGGACACGTCGTTTGAGAACATCCGCAAGTTCCACAGCGCGCAGAGGGAG
GACAAGGCGCTCTCGGTGGAGACGATGCCGGGCGTCGTCTGCGGCCGCTTCTCGCGGCCGATCGAGCGGGTGGGC
CTGTACATACCGGGCGGCACGGCGGTGCTGCCGAGCACGGCACTGATGCTCGGGGTGCCGGCCATGGTGGCGGGC
TGCAAGAAGATCGTGTTCGCGTCGCCGCCGCGGGCAGACGGGCGGATCACGCCCGAGATCGTCTACGCGGCGCAC
AAGGTCGGGGCCGAGAGCATCGTGCTGGCGGGCGGGGCGCAGGCGGTGGCGGCGCTGGCGTACGGGACCGAGAGC
GTCAGCAAGGTCGACAAGATCCTCGGGCCGGGCAACCAGTTCGTGACGGCGGCCAAGATGCACGTCAGCAACGAC
ACCAACGCCGGCGTCGGCATCGACATGCCGGCCGGGCCGTCCGAGGTGCTCGTCGTCGCCGACGCGGCCGCCAAC
CCGGCCTTCGTCGCGTCGGACCTGCTGTCGCAGGCCGAGCACGGCGCCGACAGCCAGGTCGTCCTCGTTGCCGTC
GGCCTGGCCGAGGCCGAGCTGCGGGCCATCGACGACGAGGTGCACGCGCAGGCGACGGCCCTGCCGCGCGTCGAC
ATCGTCCGCGCCGCCATCGCCCACTCCGTCACCGTCCTCGTCCCCTCCGTCGACGAGGCCATGCGCATCAGCAAC
GAGTACGCGCCCGAGCACCTGATCCTGCAGCTGCGCGACGCCGCCCGCCTCGTCGACAAGGTCACCAACGCCGGC
AGCGTCTTCATCGGCGAATGGACGCCCGAGAGCGTCGGCGACTACTCCGCCGGCGTCAACCACTCGCTACCGACG
TACGGCTTCGCCAAGCAGTACTCGGGCGTCAACCTCGGCTCCTTCACCAAGCACATCACCTGCTCCAACCTGACG
GCCGCCGGCCTGCGCAACGTCGGCCCGGCCGTCATGCAGCTCGCGCGCGTGGAGGAGCTCGAGGCCCACCGGCGG
GCCGTCGAGATCCGCCTGCGCCACATGGACGCCAAAAAGCTCTGA
Transcript >Hirsu2|7049
ATGGAGACGGAGCTACCTTTGCCCTTCCTGGTCAGCGTGGCCATCCCGCCGGGCCTGGCCGGCCTCGACGGCCTG
AGCCGCGAAGAAGTGTCGCTGCTGGGCAATCCCTTCTTGGAGGCGACGCCGACCGTCGAGGAGAAGCTTGCCCGC
TTCTTCAACCGCCACAACTACGAGTTCCACGCCCACGTCGACGCCACCAGCCTCGACTCTCAGGAAGGCGTCACG
GCCCTTCTCGACCGCGGCGCGCGGAGGGTCTTCGTCGCCCCGGACGCTCTGCCGCAGTACGCCGGCTTCGGGGGC
CGGGTGCTGCCCGTCGTCTCGACCCTTGACCTGTCTGCCGCCTCCAAGGACGGACTGCTGATCAAGGAGTTCGAC
CTCGATGCCGCCGGACTGGACAAGTTCGTCGACCAGGCGCAAAAAGCCAAGGTCCGGAACCTGTACCTCAAGCCT
GTGGCGCGGGCCGACCCGGCCAAGTTTCTCGAGGTTGCCCGGAAGTGCAACGCCATCCCTGTCCTACCCTCCACC
GCGCTCACGACGGACAAGAACGACGGCGCGAGGCTGCTCCTGTCAAAGGTCATCGCCGCGTCCTGGACGTCCGAC
CGGCCGGACGGCCTGGTGCCCACCGTCGTCACGGACGAGTCGGGCGTCGCCCTCGGCCTCGCCTACTCGAGCGAG
GAGAGCATCCTCGAGGCATTGAAGACGCAGACGGGCGTCTACCAGAGCAGGAAGAGGGGCCTATGGATCAAGGGA
GCCACCTCGGGCGACACCCAGGAGCTGGTCCGCCTGTCGCTCGACTGCGACAGCGACGCTCTCCGGTTCGTCGTC
CGGCAAAAGAACCGCTTCTGCCACCTGGACCAGTTCGGCTGTTTCGGCGACCTTCGAGGCATTCCGGCCCTCGAG
CAGACGCTCAAGTCGAGGAAAGTGTCCGCCCCTGAGGGCTCCTATACCGCACGCCTCTTCTCCGACGAGAAGCTG
CTGCGGGCGAAGATCATGGAGGAGGCGGAGGAGCTCTGCGCCGCCCAGTCGCCCCAGGACGTCGCCTTCGAGGCC
GCCGATCTCATCTACTTCGCCCTGACCAAGGCGGTCGGCTCGGGCGTCAGCCTGGCCGACATCGAAGCCAACCTC
GACGCCAAGGGCTTGAAGGTGACGAGGAGACAGGGCGACGCCAAGGGCAAGTGGGCGGAGAAGGAGGGCATCCAA
TCCGCTCCCGCGGCCTCCTCCAAGCCGGAACAGCAGAAACAGGCCGACAAGGCCCAGGAGGGCCGAATCGTGATG
CAGAGGATTGACGCGAGCAAGGCCACCGAGGCAGAGCTCCTGGAGAAGCTCAAGCGGCCGTCGCAGAAGTCGCCC
GAGGCCATCCTCAAGATCGTGACGCCCATCATCGACGAGGTGCGGCGGGGCGGAGACAAGGCGGTGCTGGCGTAC
ACGCACAAGTTCGAGAAGGCGACGTCGCTGACGTCGCCCGTGCTCAAGGCGCCCTTCCCCAAGGAGCTGATGCAG
CTGGACGCGGAGACGATGGAGGCCATGGACACGTCGTTTGAGAACATCCGCAAGTTCCACAGCGCGCAGAGGGAG
GACAAGGCGCTCTCGGTGGAGACGATGCCGGGCGTCGTCTGCGGCCGCTTCTCGCGGCCGATCGAGCGGGTGGGC
CTGTACATACCGGGCGGCACGGCGGTGCTGCCGAGCACGGCACTGATGCTCGGGGTGCCGGCCATGGTGGCGGGC
TGCAAGAAGATCGTGTTCGCGTCGCCGCCGCGGGCAGACGGGCGGATCACGCCCGAGATCGTCTACGCGGCGCAC
AAGGTCGGGGCCGAGAGCATCGTGCTGGCGGGCGGGGCGCAGGCGGTGGCGGCGCTGGCGTACGGGACCGAGAGC
GTCAGCAAGGTCGACAAGATCCTCGGGCCGGGCAACCAGTTCGTGACGGCGGCCAAGATGCACGTCAGCAACGAC
ACCAACGCCGGCGTCGGCATCGACATGCCGGCCGGGCCGTCCGAGGTGCTCGTCGTCGCCGACGCGGCCGCCAAC
CCGGCCTTCGTCGCGTCGGACCTGCTGTCGCAGGCCGAGCACGGCGCCGACAGCCAGGTCGTCCTCGTTGCCGTC
GGCCTGGCCGAGGCCGAGCTGCGGGCCATCGACGACGAGGTGCACGCGCAGGCGACGGCCCTGCCGCGCGTCGAC
ATCGTCCGCGCCGCCATCGCCCACTCCGTCACCGTCCTCGTCCCCTCCGTCGACGAGGCCATGCGCATCAGCAAC
GAGTACGCGCCCGAGCACCTGATCCTGCAGCTGCGCGACGCCGCCCGCCTCGTCGACAAGGTCACCAACGCCGGC
AGCGTCTTCATCGGCGAATGGACGCCCGAGAGCGTCGGCGACTACTCCGCCGGCGTCAACCACTCGCTACCGACG
TACGGCTTCGCCAAGCAGTACTCGGGCGTCAACCTCGGCTCCTTCACCAAGCACATCACCTGCTCCAACCTGACG
GCCGCCGGCCTGCGCAACGTCGGCCCGGCCGTCATGCAGCTCGCGCGCGTGGAGGAGCTCGAGGCCCACCGGCGG
GCCGTCGAGATCCGCCTGCGCCACATGGACGCCAAAAAGCTCTGA
Gene >Hirsu2|7049
ATGGAGACGGAGCTACCTTTGCCCTTCCTGGTCAGCGTGGCCATCCCGCCGGGCCTGGCCGGCCTCGACGGCCTG
AGCCGCGAAGAAGTGTCGCTGCTGGGCAATCCCTTCTTGGAGGCGACGCCGACCGTCGAGGAGAAGCTTGCCCGC
TTCTTCAACCGCCACAACTACGAGTTCCACGCCCACGTCGACGCCACCAGCCTCGACTCTCAGGAAGGCGTCACG
GCCCTTCTCGACCGCGGCGCGCGGAGGGTCTTCGTCGCCCCGGACGCTCTGCCGCAGTACGCCGGCTTCGGGGGC
CGGGTGCTGCCCGTCGTCTCGACCCTTGACCTGTCTGCCGCCTCCAAGGACGGACTGCTGATCAAGGAGTTCGAC
CTCGATGCCGCCGGACTGGACAAGTTCGTCGACCAGGCGCAAAAAGCCAAGGTCCGGAACCTGTACCTCAAGCCT
GTGGCGCGGGCCGACCCGGCCAAGTTTCTCGAGGTTGCCCGGAAGTGCAACGCCATCCCTGTCCTACCCTCCACC
GCGCTCACGACGGACAAGAACGACGGCGCGAGGCTGCTCCTGTCAAAGGTCATCGCCGCGTCCTGGACGTCCGAC
CGGCCGGACGGCCTGGTGCCCACCGTCGTCACGGACGAGTCGGGCGTCGCCCTCGGCCTCGCCTACTCGAGCGAG
GAGAGCATCCTCGAGGCATTGAAGACGCAGACGGGCGTCTACCAGAGCAGGAAGAGGGGCCTATGGATCAAGGGA
GCCACCTCGGGCGACACCCAGGAGCTGGTCCGCCTGTCGCTCGACTGCGACAGCGACGCTCTCCGGTTCGTCGTC
CGGCAAAAGAACCGCTTCTGCCACCTGGACCAGTTCGGCTGTTTCGGCGACCTTCGAGGCATTCCGGCCCTCGAG
CAGACGCTCAAGTCGAGGAAAGTGTCCGCCCCTGAGGGCTCCTATACCGCACGCCTCTTCTCCGACGAGAAGCTG
CTGCGGGCGAAGATCATGGAGGAGGCGGAGGAGCTCTGCGCCGCCCAGTCGCCCCAGGACGTCGCCTTCGAGGCC
GCCGATCTCATCTACTTCGCCCTGACCAAGGCGGTCGGCTCGGGCGTCAGCCTGGCCGACATCGAAGCCAACCTC
GACGCCAAGGGCTTGAAGGTGACGAGGAGACAGGGCGACGCCAAGGGCAAGTGGGCGGAGAAGGAGGGCATCCAA
TCCGCTCCCGCGGCCTCCTCCAAGCCGGAACAGCAGAAACAGGCCGACAAGGCCCAGGAGGGCCGAATCGTGATG
CAGAGGATTGACGCGAGCAAGGCCACCGAGGCAGAGCTCCTGGAGAAGCTCAAGCGGCCGTCGCAGAAGTCGCCC
GAGGCCATCCTCAAGATCGTGACGCCCATCATCGACGAGGTGCGGCGGGGCGGAGACAAGGCGGTGCTGGCGTAC
ACGCACAAGTTCGAGAAGGCGACGTCGCTGACGTCGCCCGTGCTCAAGGCGCCCTTCCCCAAGGAGCTGATGCAG
CTGGACGCGGAGACGATGGAGGCCATGGACACGTCGTTTGAGAACATCCGCAAGTTCCACAGCGCGCAGAGGGAG
GACAAGGCGCTCTCGGTGGAGACGATGCCGGGCGTCGTCTGCGGCCGCTTCTCGCGGCCGATCGAGCGGGTGGGC
CTGTACATACCGGGCGGCACGGCGGTGCTGCCGAGCACGGCACTGATGCTCGGGGTGCCGGCCATGGTGGCGGGC
TGCAAGAAGATCGTGTTCGCGTCGCCGCCGCGGGCAGACGGGCGGATCACGCCCGAGATCGTCTACGCGGCGCAC
AAGGTCGGGGCCGAGAGCATCGTGCTGGCGGGCGGGGCGCAGGCGGTGGCGGCGCTGGCGTACGGGACCGAGAGC
GTCAGCAAGGTCGACAAGATCCTCGGGCCGGGCAACCAGTTCGTGACGGCGGCCAAGATGCACGTCAGCAACGAC
ACCAACGCCGGCGTCGGCATCGACATGCCGGCCGGGCCGTCCGAGGTGCTCGTCGTCGCCGACGCGGCCGCCAAC
CCGGCCTTCGTCGCGTCGGACCTGCTGTCGCAGGCCGAGCACGGCGCCGACAGCCAGGTCGTCCTCGTTGCCGTC
GGCCTGGCCGAGGCCGAGCTGCGGGCCATCGACGACGAGGTGCACGCGCAGGCGACGGCCCTGCCGCGCGTCGAC
ATCGTCCGCGCCGCCATCGCCCACTCCGTCACCGTCCTCGTCCCCTCCGTCGACGAGGCCATGCGCATCAGCAAC
GAGTACGCGCCCGAGCACCTGATCCTGCAGCTGCGCGACGCCGCCCGCCTCGTCGACAAGGTCACCAACGCCGGC
AGCGTCTTCATCGGCGAATGGACGCCCGAGAGCGTCGGCGACTACTCCGCCGGCGTCAACCACTCGCTACGTACG
CTTCTCCATCTTCTGCTCCCTCCCCCCCTCGCCACCCCCGTATCTCTCCCGTGAGCTAACTCCCGCCCCCCGCCT
CTTTCCCTCCCGCGACAGCGACGTACGGCTTCGCCAAGCAGTACTCGGGCGTCAACCTCGGCTCCTTCACCAAGC
ACATCACCTGCTCCAACCTGACGGCCGCCGGCCTGCGCAACGTCGGCCCGGCCGTCATGCAGCTCGCGCGCGTGG
AGGAGCTCGAGGCCCACCGGCGGGCCGTCGAGATCCGCCTGCGCCACATGGACGCCAAAAAGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail