Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7046
Gene name
LocationContig_390:4090..5966
Strand-
Gene length (bp)1876
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05691 Raffinose_syn Raffinose synthase or seed imbibition protein Sip1 1.5E-50 27 331

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RX87|RFS6_ARATH Probable galactinol--sucrose galactosyltransferase 6 OS=Arabidopsis thaliana GN=RFS6 PE=2 SV=2 20 512 2.0E-49
sp|Q94A08|RFS2_ARATH Probable galactinol--sucrose galactosyltransferase 2 OS=Arabidopsis thaliana GN=RFS2 PE=2 SV=2 22 484 1.0E-42
sp|Q84VX0|RFS1_ARATH Probable galactinol--sucrose galactosyltransferase 1 OS=Arabidopsis thaliana GN=RFS1 PE=2 SV=1 20 517 2.0E-38
sp|Q5VQG4|RFS_ORYSJ Galactinol--sucrose galactosyltransferase OS=Oryza sativa subsp. japonica GN=RFS PE=1 SV=1 29 332 2.0E-31
sp|Q9FND9|RFS5_ARATH Probable galactinol--sucrose galactosyltransferase 5 OS=Arabidopsis thaliana GN=RFS5 PE=1 SV=1 29 332 3.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RX87|RFS6_ARATH Probable galactinol--sucrose galactosyltransferase 6 OS=Arabidopsis thaliana GN=RFS6 PE=2 SV=2 20 512 2.0E-49
sp|Q94A08|RFS2_ARATH Probable galactinol--sucrose galactosyltransferase 2 OS=Arabidopsis thaliana GN=RFS2 PE=2 SV=2 22 484 1.0E-42
sp|Q84VX0|RFS1_ARATH Probable galactinol--sucrose galactosyltransferase 1 OS=Arabidopsis thaliana GN=RFS1 PE=2 SV=1 20 517 2.0E-38
sp|Q5VQG4|RFS_ORYSJ Galactinol--sucrose galactosyltransferase OS=Oryza sativa subsp. japonica GN=RFS PE=1 SV=1 29 332 2.0E-31
sp|Q9FND9|RFS5_ARATH Probable galactinol--sucrose galactosyltransferase 5 OS=Arabidopsis thaliana GN=RFS5 PE=1 SV=1 29 332 3.0E-29
sp|Q97U94|AGAL_SULSO Alpha-galactosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=galS PE=1 SV=2 29 328 1.0E-28
sp|Q8VWN6|RFS_PEA Galactinol--sucrose galactosyltransferase OS=Pisum sativum GN=RFS PE=1 SV=1 29 328 5.0E-27
sp|Q93XK2|STSYN_PEA Stachyose synthase OS=Pisum sativum GN=STS1 PE=1 SV=1 41 385 2.0E-21
sp|Q9SYJ4|RFS4_ARATH Probable galactinol--sucrose galactosyltransferase 4 OS=Arabidopsis thaliana GN=RFS4 PE=2 SV=3 99 520 2.0E-20
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7046
MQYARRLVTPPQAAAAESVHVQRRENWYDGLGYCTWNALGQKLTEEKVLDAVQKLAEHEIDITSLIIDDNWQSIN
KKGESQFQYAWNEFEADREAFPRGLKGLVSQIRDQYPGIQHIAVWHALLGYWGGIAPGGKVDQSYKTVEVTCAGS
KRRNLPLGGPMTVVAEEDVDRFYNDFYRFLTDAGIDGVKTDAQFILDTWVSASVRRQLINKYLDTWSATSLRYFG
IKAISCMSQMPQALFHSQMPHNRPPLVVRNSDDFFPEIPASHPWHVWTNAHNSILTRLLNVLPDWDMFQTVHDYS
GFHAAARCVSGGPIYVTDVPGEHNMDLIGQMTGVTTQGRTVIFRPSDIGRSVCPYAGFDDGLLLKVGSQHHATSK
HGIGILGVFNISPEPLLEIVPLSCFPDTSPSLDYVVRAHATGKLSMPTRAGQPNSLLTVSLDTRGYEILCAYPLT
AFASEKHKGGWVANLGLVGKMTGCAAMSASNIHQDEKGVVSIETRLKALGVLGIYVSAPAARPAAHDLRATIGGQ
PVPQRFIRVSKEDESVFEVDLESAWKEMGIGASSGNEVEARVSFCG*
Coding >Hirsu2|7046
ATGCAGTACGCCAGGCGGCTTGTGACGCCTCCGCAAGCGGCGGCTGCGGAGAGTGTCCATGTACAACGAAGAGAG
AACTGGTACGATGGGCTCGGATACTGCACTTGGAACGCGCTTGGGCAAAAGCTCACAGAGGAGAAGGTCCTTGAT
GCGGTGCAGAAGCTGGCAGAGCACGAGATCGACATCACGAGCCTCATCATCGATGACAACTGGCAGTCCATCAAC
AAAAAGGGCGAAAGCCAGTTCCAGTACGCCTGGAACGAATTCGAGGCTGACCGAGAGGCCTTTCCACGCGGCCTA
AAGGGGTTGGTGTCGCAGATTCGAGATCAATACCCGGGGATCCAACACATTGCTGTCTGGCATGCTCTACTAGGT
TACTGGGGCGGCATCGCACCGGGCGGCAAGGTTGATCAGAGCTACAAGACTGTCGAGGTGACCTGCGCGGGCTCA
AAGCGTCGAAACCTTCCGCTTGGTGGCCCGATGACTGTGGTTGCGGAAGAGGATGTGGACAGGTTTTACAATGAT
TTTTATCGGTTCCTCACGGACGCGGGCATCGACGGCGTCAAAACGGACGCCCAGTTCATCCTGGACACCTGGGTC
AGCGCCTCCGTCCGTCGACAGCTCATCAACAAGTACTTGGACACCTGGTCGGCCACCTCGCTCCGCTACTTCGGC
ATCAAGGCCATATCATGCATGTCGCAGATGCCGCAGGCCCTCTTCCACTCGCAGATGCCGCACAACCGGCCGCCC
CTGGTGGTCCGCAACTCAGACGACTTCTTCCCCGAAATCCCGGCGTCTCACCCCTGGCACGTTTGGACCAATGCT
CACAACAGCATCTTGACGCGTCTTCTCAACGTCTTGCCCGACTGGGACATGTTCCAGACCGTCCACGATTACTCC
GGGTTCCATGCCGCAGCACGATGCGTGAGCGGCGGTCCGATCTACGTGACGGACGTGCCGGGAGAGCACAACATG
GACCTCATCGGCCAGATGACGGGCGTCACGACGCAGGGGAGAACGGTCATCTTCAGACCGAGCGACATCGGCAGG
TCTGTCTGCCCGTACGCCGGGTTCGATGATGGGTTGCTGCTCAAGGTCGGAAGCCAGCATCACGCGACGTCGAAG
CACGGCATTGGCATACTCGGCGTCTTCAACATCTCGCCCGAACCTCTGTTAGAGATAGTTCCCCTCTCGTGCTTT
CCAGACACGTCACCGTCACTCGACTATGTCGTCCGCGCCCACGCGACGGGCAAGTTGTCAATGCCGACTCGAGCC
GGACAGCCTAACTCGCTTCTAACCGTCTCACTCGACACGCGAGGATACGAAATCCTGTGCGCCTACCCCCTGACC
GCCTTCGCCAGCGAGAAGCACAAGGGCGGCTGGGTTGCCAACCTGGGGCTCGTGGGGAAGATGACGGGCTGCGCG
GCCATGTCGGCCAGCAACATCCACCAGGACGAAAAGGGAGTGGTGTCGATCGAAACACGGCTGAAGGCCCTGGGG
GTGCTCGGTATCTACGTCTCTGCGCCGGCAGCGAGGCCGGCCGCGCACGATCTGAGAGCGACCATCGGGGGCCAA
CCCGTCCCGCAGCGCTTCATCCGAGTGTCCAAGGAGGACGAGTCCGTGTTCGAAGTGGATCTCGAGTCGGCGTGG
AAGGAGATGGGAATCGGGGCGAGCTCCGGTAACGAGGTGGAAGCCCGTGTGTCTTTCTGTGGATAG
Transcript >Hirsu2|7046
ATGCAGTACGCCAGGCGGCTTGTGACGCCTCCGCAAGCGGCGGCTGCGGAGAGTGTCCATGTACAACGAAGAGAG
AACTGGTACGATGGGCTCGGATACTGCACTTGGAACGCGCTTGGGCAAAAGCTCACAGAGGAGAAGGTCCTTGAT
GCGGTGCAGAAGCTGGCAGAGCACGAGATCGACATCACGAGCCTCATCATCGATGACAACTGGCAGTCCATCAAC
AAAAAGGGCGAAAGCCAGTTCCAGTACGCCTGGAACGAATTCGAGGCTGACCGAGAGGCCTTTCCACGCGGCCTA
AAGGGGTTGGTGTCGCAGATTCGAGATCAATACCCGGGGATCCAACACATTGCTGTCTGGCATGCTCTACTAGGT
TACTGGGGCGGCATCGCACCGGGCGGCAAGGTTGATCAGAGCTACAAGACTGTCGAGGTGACCTGCGCGGGCTCA
AAGCGTCGAAACCTTCCGCTTGGTGGCCCGATGACTGTGGTTGCGGAAGAGGATGTGGACAGGTTTTACAATGAT
TTTTATCGGTTCCTCACGGACGCGGGCATCGACGGCGTCAAAACGGACGCCCAGTTCATCCTGGACACCTGGGTC
AGCGCCTCCGTCCGTCGACAGCTCATCAACAAGTACTTGGACACCTGGTCGGCCACCTCGCTCCGCTACTTCGGC
ATCAAGGCCATATCATGCATGTCGCAGATGCCGCAGGCCCTCTTCCACTCGCAGATGCCGCACAACCGGCCGCCC
CTGGTGGTCCGCAACTCAGACGACTTCTTCCCCGAAATCCCGGCGTCTCACCCCTGGCACGTTTGGACCAATGCT
CACAACAGCATCTTGACGCGTCTTCTCAACGTCTTGCCCGACTGGGACATGTTCCAGACCGTCCACGATTACTCC
GGGTTCCATGCCGCAGCACGATGCGTGAGCGGCGGTCCGATCTACGTGACGGACGTGCCGGGAGAGCACAACATG
GACCTCATCGGCCAGATGACGGGCGTCACGACGCAGGGGAGAACGGTCATCTTCAGACCGAGCGACATCGGCAGG
TCTGTCTGCCCGTACGCCGGGTTCGATGATGGGTTGCTGCTCAAGGTCGGAAGCCAGCATCACGCGACGTCGAAG
CACGGCATTGGCATACTCGGCGTCTTCAACATCTCGCCCGAACCTCTGTTAGAGATAGTTCCCCTCTCGTGCTTT
CCAGACACGTCACCGTCACTCGACTATGTCGTCCGCGCCCACGCGACGGGCAAGTTGTCAATGCCGACTCGAGCC
GGACAGCCTAACTCGCTTCTAACCGTCTCACTCGACACGCGAGGATACGAAATCCTGTGCGCCTACCCCCTGACC
GCCTTCGCCAGCGAGAAGCACAAGGGCGGCTGGGTTGCCAACCTGGGGCTCGTGGGGAAGATGACGGGCTGCGCG
GCCATGTCGGCCAGCAACATCCACCAGGACGAAAAGGGAGTGGTGTCGATCGAAACACGGCTGAAGGCCCTGGGG
GTGCTCGGTATCTACGTCTCTGCGCCGGCAGCGAGGCCGGCCGCGCACGATCTGAGAGCGACCATCGGGGGCCAA
CCCGTCCCGCAGCGCTTCATCCGAGTGTCCAAGGAGGACGAGTCCGTGTTCGAAGTGGATCTCGAGTCGGCGTGG
AAGGAGATGGGAATCGGGGCGAGCTCCGGTAACGAGGTGGAAGCCCGTGTGTCTTTCTGTGGATAG
Gene >Hirsu2|7046
ATGCAGTACGCCAGGCGGCTTGTGACGCCTCCGCAAGCGGCGGCTGCGGAGAGTGTCCATGTACAACGAAGAGAG
AACTGGTACGATGGGCTCGGATACTGTAGGCCAACCCATCTACTTGCAAGACTCCAGATTCAGCTCACTCCTATT
AGGCACTTGGAACGCGCTTGGGCAAAAGCTCACAGAGGAGAAGGTCCTTGATGCGGTGCAGAAGCTGGCAGAGCA
CGAGATCGACATCACGAGCCTCATCATCGATGACAACTGGCAGTCCATCAACAAAAAGGGCGAAAGCCAGTTCCA
GTACGCCTGGAACGAATTCGAGGCTGACCGAGAGGCCTTTCCACGCGGCCTAAAGGGGTTGGTGTCGCAGATTCG
AGATCAATACCCGGGGATCCAACACATTGCTGTCTGGCATGCTCTACTAGGTTACTGGGGCGGCATCGCACCGGG
CGGCAAGGTTGATCAGAGCTACAAGACTGTCGAGGTGACCTGCGCGGGCTCAAAGCGTCGAAACCTTCCGCTTGG
TGGCCCGATGACTGTGGTTGCGGAAGAGGATGTGGACAGGTTTTACAATGATTTTTATCGGTTCCTCACGGACGC
GGGCATCGACGGCGTCAAAACGGACGCCCAGTTCATCCTGGACACCTGGGTCAGCGCCTCCGTCCGTCGACAGCT
CATCAACAAGTACTTGGACACCTGGTCGGCCACCTCGCTCCGCTACTTCGGCATCAAGGCCATATCATGCATGTC
GCAGATGCCGCAGGCCCTCTTCCACTCGCAGATGCCGCACAACCGGCCGCCCCTGGTGGTCCGCAACTCAGACGA
CTTCTTCCCCGAAATCCCGGCGTCTCACCCCTGGCACGTTTGGACCAATGCTCACAACAGCATCTTGACGCGTCT
TCTCAACGTCTTGCCCGACTGGGACATGTTCCAGACCGTCCACGATTACTCCGGGTTCCATGCCGCAGCACGATG
CGTGAGCGGCGGTCCGATCTACGTGACGGACGTGCCGGGAGAGCACAACATGGACCTCATCGGCCAGATGACGGG
CGTCACGACGCAGGGGAGAACGGTCATCTTCAGACCGAGCGACATCGGCAGGTCTGTCTGCCCGTACGCCGGGTT
CGATGATGGGTTGCTGCTCAAGGTCGGAAGCCAGCATCACGGTGAGTTGCGGCCCTGAACGCAGGCGGGACAAGC
GCTGAAGGGGGAGAACCCAGCGACGTCGAAGCACGGCATTGGCATACTCGGCGTCTTCAACATCTCGCCCGAACC
TCTGTTAGAGATAGTTCCCCTCTCGTGCTTTCCAGACACGTCACCGTCACTCGACTATGTCGTCCGCGCCCACGC
GACGGGCAAGTTGTCAATGCCGACTCGAGCCGGACAGCCTAACTCGCTTCTAACCGTCTCACTCGACACGCGAGG
ATACGAAATCCTGTGCGCCTACCCCCTGACCGCCTTCGCCAGCGAGAAGCACAAGGGCGGCTGGGTTGCCAACCT
GGGGCTCGTGGGGAAGATGACGGGCTGCGCGGCCATGTCGGCCAGCAACATCCACCAGGACGAAAAGGGAGTGGT
GTCGATCGAAACACGGCTGAAGGCCCTGGGGGTGCTCGGTAGGCGAAGACGCTCACCAAGGCTCTTGAAATGCTG
CTGACCGAAGCTGTAAGGTATCTACGTCTCTGCGCCGGCAGCGAGGCCGGCCGCGCACGATCTGAGAGCGACCAT
CGGGGGCCAACCCGTCCCGCAGCGCTTCATCCGAGTGTCCAAGGAGGACGAGTCCGTGTTCGAAGTGGATCTCGA
GTCGGCGTGGAAGGAGATGGGAATCGGGGCGAGCTCCGGTAACGAGGTGGAAGCCCGTGTGTCTTTCTGTGGATA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail