Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7046
Gene name
LocationContig_390:4090..5966
Strand-
Gene length (bp)1876
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05691 Raffinose_syn Raffinose synthase or seed imbibition protein Sip1 1.7E-50 27 331

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RX87|RFS6_ARATH Probable galactinol--sucrose galactosyltransferase 6 OS=Arabidopsis thaliana GN=RFS6 PE=2 SV=2 20 512 2.0E-49
sp|Q94A08|RFS2_ARATH Probable galactinol--sucrose galactosyltransferase 2 OS=Arabidopsis thaliana GN=RFS2 PE=2 SV=2 22 484 1.0E-42
sp|Q84VX0|RFS1_ARATH Probable galactinol--sucrose galactosyltransferase 1 OS=Arabidopsis thaliana GN=RFS1 PE=2 SV=1 20 517 2.0E-38
sp|Q5VQG4|RFS_ORYSJ Galactinol--sucrose galactosyltransferase OS=Oryza sativa subsp. japonica GN=RFS PE=1 SV=1 29 332 2.0E-31
sp|Q9FND9|RFS5_ARATH Probable galactinol--sucrose galactosyltransferase 5 OS=Arabidopsis thaliana GN=RFS5 PE=1 SV=1 29 332 3.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RX87|RFS6_ARATH Probable galactinol--sucrose galactosyltransferase 6 OS=Arabidopsis thaliana GN=RFS6 PE=2 SV=2 20 512 2.0E-49
sp|Q94A08|RFS2_ARATH Probable galactinol--sucrose galactosyltransferase 2 OS=Arabidopsis thaliana GN=RFS2 PE=2 SV=2 22 484 1.0E-42
sp|Q84VX0|RFS1_ARATH Probable galactinol--sucrose galactosyltransferase 1 OS=Arabidopsis thaliana GN=RFS1 PE=2 SV=1 20 517 2.0E-38
sp|Q5VQG4|RFS_ORYSJ Galactinol--sucrose galactosyltransferase OS=Oryza sativa subsp. japonica GN=RFS PE=1 SV=1 29 332 2.0E-31
sp|Q9FND9|RFS5_ARATH Probable galactinol--sucrose galactosyltransferase 5 OS=Arabidopsis thaliana GN=RFS5 PE=1 SV=1 29 332 3.0E-29
sp|Q97U94|AGAL_SULSO Alpha-galactosidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=galS PE=1 SV=2 29 328 1.0E-28
sp|Q8VWN6|RFS_PEA Galactinol--sucrose galactosyltransferase OS=Pisum sativum GN=RFS PE=1 SV=1 29 328 5.0E-27
sp|Q93XK2|STSYN_PEA Stachyose synthase OS=Pisum sativum GN=STS1 PE=1 SV=1 41 385 2.0E-21
sp|Q9SYJ4|RFS4_ARATH Probable galactinol--sucrose galactosyltransferase 4 OS=Arabidopsis thaliana GN=RFS4 PE=2 SV=3 99 520 2.0E-20
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5259 0.4448 0.5248 0.0653 0.0133 0.0066 0.169 0.0628 0.0917 0.0035

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6721
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|764
Ophiocordyceps australis map64 (Brazil) OphauB2|4385
Ophiocordyceps subramaniannii Hirsu2|7046 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7046
MQYARRLVTPPQAAAAESVHVQRRENWYDGLGYCTWNALGQKLTEEKVLDAVQKLAEHEIDITSLIIDDNWQSIN
KKGESQFQYAWNEFEADREAFPRGLKGLVSQIRDQYPGIQHIAVWHALLGYWGGIAPGGKVDQSYKTVEVTCAGS
KRRNLPLGGPMTVVAEEDVDRFYNDFYRFLTDAGIDGVKTDAQFILDTWVSASVRRQLINKYLDTWSATSLRYFG
IKAISCMSQMPQALFHSQMPHNRPPLVVRNSDDFFPEIPASHPWHVWTNAHNSILTRLLNVLPDWDMFQTVHDYS
GFHAAARCVSGGPIYVTDVPGEHNMDLIGQMTGVTTQGRTVIFRPSDIGRSVCPYAGFDDGLLLKVGSQHHATSK
HGIGILGVFNISPEPLLEIVPLSCFPDTSPSLDYVVRAHATGKLSMPTRAGQPNSLLTVSLDTRGYEILCAYPLT
AFASEKHKGGWVANLGLVGKMTGCAAMSASNIHQDEKGVVSIETRLKALGVLGIYVSAPAARPAAHDLRATIGGQ
PVPQRFIRVSKEDESVFEVDLESAWKEMGIGASSGNEVEARVSFCG*
Coding >Hirsu2|7046
ATGCAGTACGCCAGGCGGCTTGTGACGCCTCCGCAAGCGGCGGCTGCGGAGAGTGTCCATGTACAACGAAGAGAG
AACTGGTACGATGGGCTCGGATACTGCACTTGGAACGCGCTTGGGCAAAAGCTCACAGAGGAGAAGGTCCTTGAT
GCGGTGCAGAAGCTGGCAGAGCACGAGATCGACATCACGAGCCTCATCATCGATGACAACTGGCAGTCCATCAAC
AAAAAGGGCGAAAGCCAGTTCCAGTACGCCTGGAACGAATTCGAGGCTGACCGAGAGGCCTTTCCACGCGGCCTA
AAGGGGTTGGTGTCGCAGATTCGAGATCAATACCCGGGGATCCAACACATTGCTGTCTGGCATGCTCTACTAGGT
TACTGGGGCGGCATCGCACCGGGCGGCAAGGTTGATCAGAGCTACAAGACTGTCGAGGTGACCTGCGCGGGCTCA
AAGCGTCGAAACCTTCCGCTTGGTGGCCCGATGACTGTGGTTGCGGAAGAGGATGTGGACAGGTTTTACAATGAT
TTTTATCGGTTCCTCACGGACGCGGGCATCGACGGCGTCAAAACGGACGCCCAGTTCATCCTGGACACCTGGGTC
AGCGCCTCCGTCCGTCGACAGCTCATCAACAAGTACTTGGACACCTGGTCGGCCACCTCGCTCCGCTACTTCGGC
ATCAAGGCCATATCATGCATGTCGCAGATGCCGCAGGCCCTCTTCCACTCGCAGATGCCGCACAACCGGCCGCCC
CTGGTGGTCCGCAACTCAGACGACTTCTTCCCCGAAATCCCGGCGTCTCACCCCTGGCACGTTTGGACCAATGCT
CACAACAGCATCTTGACGCGTCTTCTCAACGTCTTGCCCGACTGGGACATGTTCCAGACCGTCCACGATTACTCC
GGGTTCCATGCCGCAGCACGATGCGTGAGCGGCGGTCCGATCTACGTGACGGACGTGCCGGGAGAGCACAACATG
GACCTCATCGGCCAGATGACGGGCGTCACGACGCAGGGGAGAACGGTCATCTTCAGACCGAGCGACATCGGCAGG
TCTGTCTGCCCGTACGCCGGGTTCGATGATGGGTTGCTGCTCAAGGTCGGAAGCCAGCATCACGCGACGTCGAAG
CACGGCATTGGCATACTCGGCGTCTTCAACATCTCGCCCGAACCTCTGTTAGAGATAGTTCCCCTCTCGTGCTTT
CCAGACACGTCACCGTCACTCGACTATGTCGTCCGCGCCCACGCGACGGGCAAGTTGTCAATGCCGACTCGAGCC
GGACAGCCTAACTCGCTTCTAACCGTCTCACTCGACACGCGAGGATACGAAATCCTGTGCGCCTACCCCCTGACC
GCCTTCGCCAGCGAGAAGCACAAGGGCGGCTGGGTTGCCAACCTGGGGCTCGTGGGGAAGATGACGGGCTGCGCG
GCCATGTCGGCCAGCAACATCCACCAGGACGAAAAGGGAGTGGTGTCGATCGAAACACGGCTGAAGGCCCTGGGG
GTGCTCGGTATCTACGTCTCTGCGCCGGCAGCGAGGCCGGCCGCGCACGATCTGAGAGCGACCATCGGGGGCCAA
CCCGTCCCGCAGCGCTTCATCCGAGTGTCCAAGGAGGACGAGTCCGTGTTCGAAGTGGATCTCGAGTCGGCGTGG
AAGGAGATGGGAATCGGGGCGAGCTCCGGTAACGAGGTGGAAGCCCGTGTGTCTTTCTGTGGATAG
Transcript >Hirsu2|7046
ATGCAGTACGCCAGGCGGCTTGTGACGCCTCCGCAAGCGGCGGCTGCGGAGAGTGTCCATGTACAACGAAGAGAG
AACTGGTACGATGGGCTCGGATACTGCACTTGGAACGCGCTTGGGCAAAAGCTCACAGAGGAGAAGGTCCTTGAT
GCGGTGCAGAAGCTGGCAGAGCACGAGATCGACATCACGAGCCTCATCATCGATGACAACTGGCAGTCCATCAAC
AAAAAGGGCGAAAGCCAGTTCCAGTACGCCTGGAACGAATTCGAGGCTGACCGAGAGGCCTTTCCACGCGGCCTA
AAGGGGTTGGTGTCGCAGATTCGAGATCAATACCCGGGGATCCAACACATTGCTGTCTGGCATGCTCTACTAGGT
TACTGGGGCGGCATCGCACCGGGCGGCAAGGTTGATCAGAGCTACAAGACTGTCGAGGTGACCTGCGCGGGCTCA
AAGCGTCGAAACCTTCCGCTTGGTGGCCCGATGACTGTGGTTGCGGAAGAGGATGTGGACAGGTTTTACAATGAT
TTTTATCGGTTCCTCACGGACGCGGGCATCGACGGCGTCAAAACGGACGCCCAGTTCATCCTGGACACCTGGGTC
AGCGCCTCCGTCCGTCGACAGCTCATCAACAAGTACTTGGACACCTGGTCGGCCACCTCGCTCCGCTACTTCGGC
ATCAAGGCCATATCATGCATGTCGCAGATGCCGCAGGCCCTCTTCCACTCGCAGATGCCGCACAACCGGCCGCCC
CTGGTGGTCCGCAACTCAGACGACTTCTTCCCCGAAATCCCGGCGTCTCACCCCTGGCACGTTTGGACCAATGCT
CACAACAGCATCTTGACGCGTCTTCTCAACGTCTTGCCCGACTGGGACATGTTCCAGACCGTCCACGATTACTCC
GGGTTCCATGCCGCAGCACGATGCGTGAGCGGCGGTCCGATCTACGTGACGGACGTGCCGGGAGAGCACAACATG
GACCTCATCGGCCAGATGACGGGCGTCACGACGCAGGGGAGAACGGTCATCTTCAGACCGAGCGACATCGGCAGG
TCTGTCTGCCCGTACGCCGGGTTCGATGATGGGTTGCTGCTCAAGGTCGGAAGCCAGCATCACGCGACGTCGAAG
CACGGCATTGGCATACTCGGCGTCTTCAACATCTCGCCCGAACCTCTGTTAGAGATAGTTCCCCTCTCGTGCTTT
CCAGACACGTCACCGTCACTCGACTATGTCGTCCGCGCCCACGCGACGGGCAAGTTGTCAATGCCGACTCGAGCC
GGACAGCCTAACTCGCTTCTAACCGTCTCACTCGACACGCGAGGATACGAAATCCTGTGCGCCTACCCCCTGACC
GCCTTCGCCAGCGAGAAGCACAAGGGCGGCTGGGTTGCCAACCTGGGGCTCGTGGGGAAGATGACGGGCTGCGCG
GCCATGTCGGCCAGCAACATCCACCAGGACGAAAAGGGAGTGGTGTCGATCGAAACACGGCTGAAGGCCCTGGGG
GTGCTCGGTATCTACGTCTCTGCGCCGGCAGCGAGGCCGGCCGCGCACGATCTGAGAGCGACCATCGGGGGCCAA
CCCGTCCCGCAGCGCTTCATCCGAGTGTCCAAGGAGGACGAGTCCGTGTTCGAAGTGGATCTCGAGTCGGCGTGG
AAGGAGATGGGAATCGGGGCGAGCTCCGGTAACGAGGTGGAAGCCCGTGTGTCTTTCTGTGGATAG
Gene >Hirsu2|7046
ATGCAGTACGCCAGGCGGCTTGTGACGCCTCCGCAAGCGGCGGCTGCGGAGAGTGTCCATGTACAACGAAGAGAG
AACTGGTACGATGGGCTCGGATACTGTAGGCCAACCCATCTACTTGCAAGACTCCAGATTCAGCTCACTCCTATT
AGGCACTTGGAACGCGCTTGGGCAAAAGCTCACAGAGGAGAAGGTCCTTGATGCGGTGCAGAAGCTGGCAGAGCA
CGAGATCGACATCACGAGCCTCATCATCGATGACAACTGGCAGTCCATCAACAAAAAGGGCGAAAGCCAGTTCCA
GTACGCCTGGAACGAATTCGAGGCTGACCGAGAGGCCTTTCCACGCGGCCTAAAGGGGTTGGTGTCGCAGATTCG
AGATCAATACCCGGGGATCCAACACATTGCTGTCTGGCATGCTCTACTAGGTTACTGGGGCGGCATCGCACCGGG
CGGCAAGGTTGATCAGAGCTACAAGACTGTCGAGGTGACCTGCGCGGGCTCAAAGCGTCGAAACCTTCCGCTTGG
TGGCCCGATGACTGTGGTTGCGGAAGAGGATGTGGACAGGTTTTACAATGATTTTTATCGGTTCCTCACGGACGC
GGGCATCGACGGCGTCAAAACGGACGCCCAGTTCATCCTGGACACCTGGGTCAGCGCCTCCGTCCGTCGACAGCT
CATCAACAAGTACTTGGACACCTGGTCGGCCACCTCGCTCCGCTACTTCGGCATCAAGGCCATATCATGCATGTC
GCAGATGCCGCAGGCCCTCTTCCACTCGCAGATGCCGCACAACCGGCCGCCCCTGGTGGTCCGCAACTCAGACGA
CTTCTTCCCCGAAATCCCGGCGTCTCACCCCTGGCACGTTTGGACCAATGCTCACAACAGCATCTTGACGCGTCT
TCTCAACGTCTTGCCCGACTGGGACATGTTCCAGACCGTCCACGATTACTCCGGGTTCCATGCCGCAGCACGATG
CGTGAGCGGCGGTCCGATCTACGTGACGGACGTGCCGGGAGAGCACAACATGGACCTCATCGGCCAGATGACGGG
CGTCACGACGCAGGGGAGAACGGTCATCTTCAGACCGAGCGACATCGGCAGGTCTGTCTGCCCGTACGCCGGGTT
CGATGATGGGTTGCTGCTCAAGGTCGGAAGCCAGCATCACGGTGAGTTGCGGCCCTGAACGCAGGCGGGACAAGC
GCTGAAGGGGGAGAACCCAGCGACGTCGAAGCACGGCATTGGCATACTCGGCGTCTTCAACATCTCGCCCGAACC
TCTGTTAGAGATAGTTCCCCTCTCGTGCTTTCCAGACACGTCACCGTCACTCGACTATGTCGTCCGCGCCCACGC
GACGGGCAAGTTGTCAATGCCGACTCGAGCCGGACAGCCTAACTCGCTTCTAACCGTCTCACTCGACACGCGAGG
ATACGAAATCCTGTGCGCCTACCCCCTGACCGCCTTCGCCAGCGAGAAGCACAAGGGCGGCTGGGTTGCCAACCT
GGGGCTCGTGGGGAAGATGACGGGCTGCGCGGCCATGTCGGCCAGCAACATCCACCAGGACGAAAAGGGAGTGGT
GTCGATCGAAACACGGCTGAAGGCCCTGGGGGTGCTCGGTAGGCGAAGACGCTCACCAAGGCTCTTGAAATGCTG
CTGACCGAAGCTGTAAGGTATCTACGTCTCTGCGCCGGCAGCGAGGCCGGCCGCGCACGATCTGAGAGCGACCAT
CGGGGGCCAACCCGTCCCGCAGCGCTTCATCCGAGTGTCCAAGGAGGACGAGTCCGTGTTCGAAGTGGATCTCGA
GTCGGCGTGGAAGGAGATGGGAATCGGGGCGAGCTCCGGTAACGAGGTGGAAGCCCGTGTGTCTTTCTGTGGATA
G

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail