Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7045
Gene name
LocationContig_390:1249..3085
Strand-
Gene length (bp)1836
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00478 IMPDH IMP dehydrogenase / GMP reductase domain 2.1E-129 44 528
PF00571 CBS CBS domain 2.6E-03 132 178
PF00571 CBS CBS domain 1.1E-05 188 240
PF01070 FMN_dh FMN-dependent dehydrogenase 2.8E-07 286 402

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SFX7|IMDH_NEUCR Inosine-5'-monophosphate dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU03117 PE=3 SV=1 12 539 0.0E+00
sp|Q4WHZ9|IMDH_ASPFU Inosine-5'-monophosphate dehydrogenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G03610 PE=3 SV=1 5 539 0.0E+00
sp|P50094|IMDH4_YEAST Inosine-5'-monophosphate dehydrogenase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMD4 PE=1 SV=1 13 538 0.0E+00
sp|Q5KP44|IMDH_CRYNJ Inosine-5'-monophosphate dehydrogenase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNA04240 PE=3 SV=1 12 539 0.0E+00
sp|O00086|IMDH_CANAX Inosine-5'-monophosphate dehydrogenase OS=Candida albicans GN=IMH3 PE=2 SV=1 12 538 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SFX7|IMDH_NEUCR Inosine-5'-monophosphate dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU03117 PE=3 SV=1 12 539 0.0E+00
sp|Q4WHZ9|IMDH_ASPFU Inosine-5'-monophosphate dehydrogenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G03610 PE=3 SV=1 5 539 0.0E+00
sp|P50094|IMDH4_YEAST Inosine-5'-monophosphate dehydrogenase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMD4 PE=1 SV=1 13 538 0.0E+00
sp|Q5KP44|IMDH_CRYNJ Inosine-5'-monophosphate dehydrogenase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNA04240 PE=3 SV=1 12 539 0.0E+00
sp|O00086|IMDH_CANAX Inosine-5'-monophosphate dehydrogenase OS=Candida albicans GN=IMH3 PE=2 SV=1 12 538 0.0E+00
sp|Q59Q46|IMDH_CANAL Inosine-5'-monophosphate dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IMH3 PE=1 SV=2 12 538 0.0E+00
sp|P50095|IMDH3_YEAST Inosine-5'-monophosphate dehydrogenase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMD3 PE=1 SV=1 10 538 0.0E+00
sp|P38697|IMDH2_YEAST Inosine-5'-monophosphate dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMD2 PE=1 SV=1 10 538 0.0E+00
sp|Q12658|IMDH_PNECA Inosine-5'-monophosphate dehydrogenase OS=Pneumocystis carinii GN=GUA1 PE=1 SV=2 22 539 0.0E+00
sp|O14344|IMDH_SCHPO Inosine-5'-monophosphate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gua1 PE=2 SV=1 15 538 0.0E+00
sp|B0UXP9|IMDH2_DANRE Inosine-5'-monophosphate dehydrogenase 2 OS=Danio rerio GN=impdh2 PE=3 SV=1 25 538 0.0E+00
sp|P12268|IMDH2_HUMAN Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens GN=IMPDH2 PE=1 SV=2 25 538 0.0E+00
sp|P20839|IMDH1_HUMAN Inosine-5'-monophosphate dehydrogenase 1 OS=Homo sapiens GN=IMPDH1 PE=1 SV=2 25 538 0.0E+00
sp|P24547|IMDH2_MOUSE Inosine-5'-monophosphate dehydrogenase 2 OS=Mus musculus GN=Impdh2 PE=1 SV=2 25 538 0.0E+00
sp|A0JNA3|IMDH1_BOVIN Inosine-5'-monophosphate dehydrogenase 1 OS=Bos taurus GN=IMPDH1 PE=2 SV=2 25 538 0.0E+00
sp|F6S675|IMDH1_XENTR Inosine-5'-monophosphate dehydrogenase 1 OS=Xenopus tropicalis GN=impdh1 PE=3 SV=1 25 538 0.0E+00
sp|E9PU28|IMDH2_RAT Inosine-5'-monophosphate dehydrogenase 2 OS=Rattus norvegicus GN=Impdh2 PE=1 SV=1 25 538 0.0E+00
sp|Q3SWY3|IMDH2_BOVIN Inosine-5'-monophosphate dehydrogenase 2 OS=Bos taurus GN=IMPDH2 PE=2 SV=1 25 538 0.0E+00
sp|P50096|IMDH1_MOUSE Inosine-5'-monophosphate dehydrogenase 1 OS=Mus musculus GN=Impdh1 PE=1 SV=2 25 538 0.0E+00
sp|Q5RGV1|IMDH3_DANRE Inosine-5'-monophosphate dehydrogenase 1b OS=Danio rerio GN=impdh1b PE=2 SV=1 25 538 0.0E+00
sp|D3ZLZ7|IMDH1_RAT Inosine-5'-monophosphate dehydrogenase 1 OS=Rattus norvegicus GN=Impdh1 PE=3 SV=1 25 538 0.0E+00
sp|P12269|IMDH2_CRIGR Inosine-5'-monophosphate dehydrogenase 2 OS=Cricetulus griseus GN=IMPDH2 PE=1 SV=1 25 538 0.0E+00
sp|Q6GMG5|IMDH1_DANRE Inosine-5'-monophosphate dehydrogenase 1a OS=Danio rerio GN=impdh1a PE=2 SV=1 25 529 0.0E+00
sp|F7CYY5|IMDH2_XENTR Inosine-5'-monophosphate dehydrogenase 2 OS=Xenopus tropicalis GN=impdh2 PE=3 SV=1 25 538 0.0E+00
sp|Q07152|IMDH_DROME Inosine-5'-monophosphate dehydrogenase OS=Drosophila melanogaster GN=ras PE=1 SV=1 28 538 0.0E+00
sp|Q54QQ0|IMDH_DICDI Inosine-5'-monophosphate dehydrogenase OS=Dictyostelium discoideum GN=impdh PE=1 SV=1 24 537 0.0E+00
sp|Q8F4Q4|IMDH_LEPIN Inosine-5'-monophosphate dehydrogenase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=guaB PE=3 SV=1 29 529 0.0E+00
sp|Q4VRV8|IMDH_TOXGO Inosine-5'-monophosphate dehydrogenase OS=Toxoplasma gondii PE=1 SV=1 29 539 2.0E-179
sp|P39567|IMDH1_YEAST Putative inosine-5'-monophosphate dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMD1 PE=5 SV=1 10 380 6.0E-163
sp|P21620|IMDH_LEIDO Inosine-5'-monophosphate dehydrogenase OS=Leishmania donovani PE=1 SV=1 28 539 1.0E-161
sp|Q9GZH3|IMDH_CAEEL Inosine-5'-monophosphate dehydrogenase OS=Caenorhabditis elegans GN=T22D1.3 PE=3 SV=2 29 538 2.0E-157
sp|P50098|IMDH_TRYBB Inosine-5'-monophosphate dehydrogenase OS=Trypanosoma brucei brucei PE=3 SV=1 28 539 1.0E-156
sp|Q84XA3|IMDH_VIGUN Inosine-5'-monophosphate dehydrogenase OS=Vigna unguiculata GN=impdh PE=1 SV=1 46 538 2.0E-126
sp|Q9SA34|IMDH2_ARATH Inosine-5'-monophosphate dehydrogenase 2 OS=Arabidopsis thaliana GN=At1g16350 PE=1 SV=1 46 538 3.0E-119
sp|P47996|IMDH1_ARATH Inosine-5'-monophosphate dehydrogenase 1 OS=Arabidopsis thaliana GN=IMPDH PE=2 SV=1 46 538 1.0E-116
sp|O67820|IMDH_AQUAE Inosine-5'-monophosphate dehydrogenase OS=Aquifex aeolicus (strain VF5) GN=guaB PE=3 SV=1 44 506 2.0E-106
sp|O50316|IMDH_CHLP8 Inosine-5'-monophosphate dehydrogenase OS=Chlorobaculum parvum (strain NCIB 8327) GN=guaB PE=3 SV=3 37 522 4.0E-106
sp|Q9KGN8|IMDH_BACHD Inosine-5'-monophosphate dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=guaB PE=3 SV=1 44 508 5.0E-105
sp|P21879|IMDH_BACSU Inosine-5'-monophosphate dehydrogenase OS=Bacillus subtilis (strain 168) GN=guaB PE=1 SV=2 44 506 8.0E-105
sp|Q8CMQ7|IMDH_STAES Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=guaB PE=3 SV=1 45 507 2.0E-102
sp|Q5HRX2|IMDH_STAEQ Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=guaB PE=3 SV=1 45 507 2.0E-102
sp|Q49UU8|IMDH_STAS1 Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=guaB PE=3 SV=1 45 507 2.0E-101
sp|Q7UJL3|IMDH_RHOBA Inosine-5'-monophosphate dehydrogenase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=guaB PE=3 SV=1 44 527 5.0E-101
sp|Q6GC82|IMDH_STAAS Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=guaB PE=3 SV=1 45 507 7.0E-101
sp|Q6GJQ7|IMDH_STAAR Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=guaB PE=3 SV=1 45 507 7.0E-101
sp|P99106|IMDH_STAAN Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain N315) GN=guaB PE=1 SV=1 45 507 7.0E-101
sp|P65169|IMDH_STAAM Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=guaB PE=3 SV=1 45 507 7.0E-101
sp|Q5HIQ7|IMDH_STAAC Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain COL) GN=guaB PE=3 SV=1 45 507 7.0E-101
sp|Q2YVL6|IMDH_STAAB Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=guaB PE=3 SV=1 45 507 7.0E-101
sp|Q2G0Y7|IMDH_STAA8 Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=guaB PE=3 SV=1 45 507 7.0E-101
sp|Q2FJM6|IMDH_STAA3 Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=guaB PE=3 SV=1 45 507 7.0E-101
sp|Q8NY70|IMDH_STAAW Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=guaB PE=3 SV=1 45 507 3.0E-100
sp|Q4L385|IMDH_STAHJ Inosine-5'-monophosphate dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=guaB PE=3 SV=1 45 505 2.0E-99
sp|P56088|IMDH_HELPY Inosine-5'-monophosphate dehydrogenase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=guaB PE=3 SV=1 45 507 1.0E-98
sp|Q9ZL14|IMDH_HELPJ Inosine-5'-monophosphate dehydrogenase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=guaB PE=3 SV=1 45 507 2.0E-98
sp|Q8G3N6|IMDH_BIFLO Inosine-5'-monophosphate dehydrogenase OS=Bifidobacterium longum (strain NCC 2705) GN=guaB PE=3 SV=1 44 504 2.0E-97
sp|Q8KCW4|IMDH_CHLTE Inosine-5'-monophosphate dehydrogenase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=guaB PE=3 SV=1 37 522 1.0E-96
sp|P0C0H6|IMDH_STRPY Inosine-5'-monophosphate dehydrogenase OS=Streptococcus pyogenes GN=guaB PE=1 SV=2 44 507 1.0E-93
sp|P68839|IMDH_STRP8 Inosine-5'-monophosphate dehydrogenase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=guaB PE=3 SV=2 44 507 1.0E-93
sp|Q5X9A3|IMDH_STRP6 Inosine-5'-monophosphate dehydrogenase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=guaB PE=1 SV=3 44 507 1.0E-93
sp|P0C0H7|IMDH_STRP1 Inosine-5'-monophosphate dehydrogenase OS=Streptococcus pyogenes serotype M1 GN=guaB PE=3 SV=2 44 507 1.0E-93
sp|P0DB89|IMDH_STRPQ Inosine-5'-monophosphate dehydrogenase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=guaB PE=3 SV=1 44 507 4.0E-93
sp|P0DB88|IMDH_STRP3 Inosine-5'-monophosphate dehydrogenase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=guaB PE=3 SV=1 44 507 4.0E-93
sp|P31002|IMDH_ACICA Inosine-5'-monophosphate dehydrogenase OS=Acinetobacter calcoaceticus GN=guaB PE=3 SV=1 37 529 8.0E-91
sp|Q9HLK8|IMDH_THEAC Inosine-5'-monophosphate dehydrogenase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=guaB PE=3 SV=1 44 507 2.0E-90
sp|P9WKI7|IMDH_MYCTU Inosine-5'-monophosphate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=guaB PE=1 SV=1 44 507 5.0E-89
sp|P9WKI6|IMDH_MYCTO Inosine-5'-monophosphate dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=guaB PE=3 SV=1 44 507 5.0E-89
sp|P65168|IMDH_MYCBO Inosine-5'-monophosphate dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=guaB PE=3 SV=1 44 507 5.0E-89
sp|Q49729|IMDH_MYCLE Inosine-5'-monophosphate dehydrogenase OS=Mycobacterium leprae (strain TN) GN=guaB PE=3 SV=1 44 507 7.0E-87
sp|Q9L6B7|IMDH_PASMU Inosine-5'-monophosphate dehydrogenase OS=Pasteurella multocida (strain Pm70) GN=guaB PE=3 SV=1 45 505 7.0E-85
sp|A9A5Y7|IMDH_NITMS Inosine-5'-monophosphate dehydrogenase OS=Nitrosopumilus maritimus (strain SCM1) GN=guaB PE=3 SV=1 44 507 1.0E-83
sp|P44334|IMDH_HAEIN Inosine-5'-monophosphate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=guaB PE=3 SV=1 41 505 3.0E-83
sp|Q59011|IMDH_METJA Inosine-5'-monophosphate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=guaB PE=3 SV=1 46 527 2.0E-82
sp|Q9KH33|IMDH_RHITR Inosine-5'-monophosphate dehydrogenase OS=Rhizobium tropici GN=guaB PE=3 SV=1 45 506 4.0E-82
sp|Q0WD32|IMDH_YERPE Inosine-5'-monophosphate dehydrogenase OS=Yersinia pestis GN=guaB PE=3 SV=1 45 505 1.0E-81
sp|P42851|IMDH_PYRFU Inosine-5'-monophosphate dehydrogenase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=guaB PE=3 SV=1 44 507 1.0E-81
sp|O58045|IMDH_PYRHO Inosine-5'-monophosphate dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=guaB PE=1 SV=1 44 507 8.0E-81
sp|Q9UY49|IMDH_PYRAB Inosine-5'-monophosphate dehydrogenase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=guaB PE=3 SV=1 44 507 1.0E-80
sp|E9BDA8|GMPR_LEIDB GMP reductase OS=Leishmania donovani (strain BPK282A1) GN=GMPR PE=1 SV=1 44 506 4.0E-80
sp|Q4QEB3|GMPR_LEIMA GMP reductase OS=Leishmania major GN=GMPR PE=1 SV=2 44 506 4.0E-80
sp|P0ADG9|IMDH_SHIFL Inosine-5'-monophosphate dehydrogenase OS=Shigella flexneri GN=guaB PE=3 SV=1 45 505 3.0E-76
sp|P0ADG7|IMDH_ECOLI Inosine-5'-monophosphate dehydrogenase OS=Escherichia coli (strain K12) GN=guaB PE=1 SV=1 45 505 3.0E-76
sp|P0ADG8|IMDH_ECO57 Inosine-5'-monophosphate dehydrogenase OS=Escherichia coli O157:H7 GN=guaB PE=3 SV=1 45 505 3.0E-76
sp|B1L5U5|IMDH_KORCO Inosine-5'-monophosphate dehydrogenase OS=Korarchaeum cryptofilum (strain OPF8) GN=guaB PE=3 SV=1 45 504 3.0E-72
sp|Q9HQU4|IMDH_HALSA Inosine-5'-monophosphate dehydrogenase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=guaB PE=3 SV=2 45 501 6.0E-59
sp|O42831|YA075_YEAST Putative inosine-5'-monophosphate dehydrogenase-like protein YAR075W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAR075W PE=5 SV=1 380 538 2.0E-55
sp|P50097|IMDH_TRIFO Inosine-5'-monophosphate dehydrogenase OS=Tritrichomonas foetus GN=IMPDH PE=1 SV=1 46 526 8.0E-52
sp|Q8T6T2|IMDH_CRYPV Inosine-5'-monophosphate dehydrogenase OS=Cryptosporidium parvum GN=56k.02 PE=1 SV=1 176 509 3.0E-49
sp|P49058|IMDH_BORBU Inosine-5'-monophosphate dehydrogenase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=guaB PE=1 SV=1 233 504 1.0E-44
sp|P65173|Y1874_MYCBO Uncharacterized oxidoreductase Mb1874c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1874c PE=3 SV=1 45 511 2.0E-37
sp|P9WKI3|Y1843_MYCTU Uncharacterized oxidoreductase Rv1843c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=guaB1 PE=1 SV=1 45 511 2.0E-37
sp|P9WKI2|Y1843_MYCTO Uncharacterized oxidoreductase MT1891 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=guaB1 PE=3 SV=1 45 511 2.0E-37
sp|O32912|Y2066_MYCLE Uncharacterized oxidoreductase ML2066 OS=Mycobacterium leprae (strain TN) GN=ML2066 PE=3 SV=1 45 511 4.0E-34
sp|Q9NJD8|GMPR_ONCVO GMP reductase OS=Onchocerca volvulus GN=gmr-1 PE=2 SV=1 241 506 1.0E-29
sp|Q9P2T1|GMPR2_HUMAN GMP reductase 2 OS=Homo sapiens GN=GMPR2 PE=1 SV=1 238 460 6.0E-28
sp|Q99L27|GMPR2_MOUSE GMP reductase 2 OS=Mus musculus GN=Gmpr2 PE=1 SV=2 241 508 2.0E-27
sp|Q32L93|GMPR2_BOVIN GMP reductase 2 OS=Bos taurus GN=GMPR2 PE=2 SV=1 246 460 2.0E-27
sp|P59075|GMPR_PHYIN GMP reductase OS=Phytophthora infestans PE=2 SV=1 246 508 1.0E-26
sp|Q04CB0|GUAC_LACDB GMP reductase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=guaC PE=3 SV=1 235 429 2.0E-26
sp|Q9DCZ1|GMPR1_MOUSE GMP reductase 1 OS=Mus musculus GN=Gmpr PE=1 SV=1 246 460 2.0E-26
sp|Q1GBV3|GUAC_LACDA GMP reductase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=guaC PE=3 SV=1 235 429 2.0E-26
sp|P27442|GMPR_ASCSU GMP reductase OS=Ascaris suum PE=2 SV=1 255 506 3.0E-26
sp|B9DP67|GUAC_STACT GMP reductase OS=Staphylococcus carnosus (strain TM300) GN=guaC PE=3 SV=1 216 506 6.0E-26
sp|P36959|GMPR1_HUMAN GMP reductase 1 OS=Homo sapiens GN=GMPR PE=1 SV=1 246 506 1.0E-25
sp|Q9Z244|GMPR1_RAT GMP reductase 1 OS=Rattus norvegicus GN=Gmpr PE=2 SV=1 219 460 1.0E-25
sp|B0TQE1|GUAC_SHEHH GMP reductase OS=Shewanella halifaxensis (strain HAW-EB4) GN=guaC PE=3 SV=1 202 508 2.0E-25
sp|O16294|GMPR_CAEEL GMP reductase OS=Caenorhabditis elegans GN=F32D1.5 PE=3 SV=1 226 506 2.0E-25
sp|Q5FHY3|GUAC_LACAC GMP reductase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=guaC PE=3 SV=1 219 429 3.0E-25
sp|A8HAF6|GUAC_SHEPA GMP reductase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=guaC PE=3 SV=1 178 508 6.0E-25
sp|B7VS90|GUAC_VIBTL GMP reductase OS=Vibrio tasmaniensis (strain LGP32) GN=guaC PE=3 SV=1 248 508 6.0E-25
sp|C4LAB3|GUAC_TOLAT GMP reductase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=guaC PE=3 SV=1 258 508 2.0E-24
sp|Q97DK4|GUAC_CLOAB GMP reductase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=guaC PE=3 SV=1 253 429 2.0E-24
sp|Q8ERJ2|GUAC_OCEIH GMP reductase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=guaC PE=3 SV=1 182 443 2.0E-24
sp|Q03TT0|GUAC_LACBA GMP reductase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=guaC PE=3 SV=1 253 429 3.0E-24
sp|B8D7A8|GUAC_BUCAT GMP reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=guaC PE=3 SV=1 253 508 3.0E-24
sp|Q04GD9|GUAC_OENOB GMP reductase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=guaC PE=3 SV=1 219 429 4.0E-24
sp|Q5WD10|GUAC_BACSK GMP reductase OS=Bacillus clausii (strain KSM-K16) GN=guaC PE=3 SV=1 219 443 4.0E-24
sp|Q1WT04|GUAC_LACS1 GMP reductase OS=Lactobacillus salivarius (strain UCC118) GN=guaC PE=3 SV=1 204 429 5.0E-24
sp|Q814I1|GUAC_BACCR GMP reductase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=guaC PE=3 SV=1 217 443 6.0E-24
sp|B6ERC3|GUAC_ALISL GMP reductase OS=Aliivibrio salmonicida (strain LFI1238) GN=guaC PE=3 SV=1 261 508 7.0E-24
sp|O05269|GUAC_BACSU GMP reductase OS=Bacillus subtilis (strain 168) GN=guaC PE=2 SV=2 219 443 7.0E-24
sp|Q5DZN1|GUAC_VIBF1 GMP reductase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=guaC PE=3 SV=1 261 508 7.0E-24
sp|Q6LGK4|GUAC_PHOPR GMP reductase OS=Photobacterium profundum GN=guaC PE=3 SV=1 261 506 8.0E-24
sp|B5EUG3|GUAC_VIBFM GMP reductase OS=Vibrio fischeri (strain MJ11) GN=guaC PE=3 SV=1 261 508 1.0E-23
sp|P0DB91|GUAC_STRPQ GMP reductase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=guaC PE=3 SV=1 182 429 2.0E-23
sp|Q1JGV8|GUAC_STRPD GMP reductase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=guaC PE=3 SV=2 182 429 2.0E-23
sp|P0DB90|GUAC_STRP3 GMP reductase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=guaC PE=3 SV=1 182 429 2.0E-23
sp|P57300|GUAC_BUCAI GMP reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=guaC PE=3 SV=1 253 508 2.0E-23
sp|B8D903|GUAC_BUCA5 GMP reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=guaC PE=3 SV=1 253 508 2.0E-23
sp|A7Z8C3|GUAC_BACMF GMP reductase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=guaC PE=3 SV=1 219 443 2.0E-23
sp|B5XLI1|GUAC_STRPZ GMP reductase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=guaC PE=3 SV=1 182 429 2.0E-23
sp|Q8P129|GUAC_STRP8 GMP reductase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=guaC PE=3 SV=1 182 429 2.0E-23
sp|Q6HAI0|GUAC_BACHK GMP reductase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=guaC PE=3 SV=1 217 443 2.0E-23
sp|Q8DZL4|GUAC_STRA5 GMP reductase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=guaC PE=3 SV=1 238 429 2.0E-23
sp|Q630E8|GUAC_BACCZ GMP reductase OS=Bacillus cereus (strain ZK / E33L) GN=guaC PE=3 SV=1 217 443 2.0E-23
sp|Q72WY4|GUAC_BACC1 GMP reductase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=guaC PE=3 SV=1 217 443 2.0E-23
sp|Q99ZQ1|GUAC_STRP1 GMP reductase OS=Streptococcus pyogenes serotype M1 GN=guaC PE=3 SV=1 182 429 2.0E-23
sp|Q81JJ9|GUAC_BACAN GMP reductase OS=Bacillus anthracis GN=guaC PE=1 SV=1 217 443 2.0E-23
sp|Q1J6M7|GUAC_STRPF GMP reductase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=guaC PE=3 SV=2 182 429 2.0E-23
sp|Q1JLQ8|GUAC_STRPC GMP reductase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=guaC PE=3 SV=2 182 429 2.0E-23
sp|Q1JBS5|GUAC_STRPB GMP reductase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=guaC PE=3 SV=2 182 429 2.0E-23
sp|Q5XC75|GUAC_STRP6 GMP reductase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=guaC PE=3 SV=2 182 429 2.0E-23
sp|A0RLN5|GUAC_BACAH GMP reductase OS=Bacillus thuringiensis (strain Al Hakam) GN=guaC PE=3 SV=1 217 443 2.0E-23
sp|Q48TL6|GUAC_STRPM GMP reductase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=guaC PE=3 SV=2 182 429 3.0E-23
sp|Q65LF6|GUAC_BACLD GMP reductase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=guaC PE=3 SV=1 219 443 3.0E-23
sp|Q8K9U0|GUAC_BUCAP GMP reductase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=guaC PE=3 SV=1 253 509 5.0E-23
sp|Q87H06|GUAC_VIBPA GMP reductase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=guaC PE=3 SV=1 261 508 6.0E-23
sp|Q8E578|GUAC_STRA3 GMP reductase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=guaC PE=3 SV=1 238 429 6.0E-23
sp|B5Z7L6|GUAC_HELPG GMP reductase OS=Helicobacter pylori (strain G27) GN=guaC PE=3 SV=1 219 443 9.0E-23
sp|Q3K110|GUAC_STRA1 GMP reductase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=guaC PE=3 SV=1 245 429 9.0E-23
sp|A0KN65|GUAC_AERHH GMP reductase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=guaC PE=3 SV=1 261 514 1.0E-22
sp|Q03GJ0|GUAC_PEDPA GMP reductase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=guaC PE=3 SV=1 246 429 1.0E-22
sp|P60565|GUAC_LACJO GMP reductase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=guaC PE=3 SV=1 235 429 1.0E-22
sp|Q045S8|GUAC_LACGA GMP reductase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=guaC PE=3 SV=1 249 429 1.0E-22
sp|B1HNS5|GUAC_LYSSC GMP reductase OS=Lysinibacillus sphaericus (strain C3-41) GN=guaC PE=3 SV=1 219 429 1.0E-22
sp|A2REI5|GUAC_STRPG GMP reductase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=guaC PE=3 SV=1 182 429 2.0E-22
sp|P59443|GUAC_BUCBP GMP reductase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=guaC PE=3 SV=1 263 508 2.0E-22
sp|O25525|GUAC_HELPY GMP reductase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=guaC PE=3 SV=1 219 443 3.0E-22
sp|C0MF02|GUAC_STRS7 GMP reductase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=guaC PE=3 SV=1 219 429 3.0E-22
sp|C0MAM1|GUAC_STRE4 GMP reductase OS=Streptococcus equi subsp. equi (strain 4047) GN=guaC PE=3 SV=1 219 429 3.0E-22
sp|Q6GH69|GUAC_STAAR GMP reductase OS=Staphylococcus aureus (strain MRSA252) GN=guaC PE=3 SV=1 216 504 3.0E-22
sp|A6QGN9|GUAC_STAAE GMP reductase OS=Staphylococcus aureus (strain Newman) GN=guaC PE=3 SV=1 216 429 4.0E-22
sp|Q5HG83|GUAC_STAAC GMP reductase OS=Staphylococcus aureus (strain COL) GN=guaC PE=3 SV=1 216 429 4.0E-22
sp|Q2FYU4|GUAC_STAA8 GMP reductase OS=Staphylococcus aureus (strain NCTC 8325) GN=guaC PE=3 SV=1 216 429 4.0E-22
sp|Q2FH96|GUAC_STAA3 GMP reductase OS=Staphylococcus aureus (strain USA300) GN=guaC PE=3 SV=1 216 429 4.0E-22
sp|Q9ZKZ2|GUAC_HELPJ GMP reductase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=guaC PE=3 SV=1 219 443 4.0E-22
sp|P60564|GUAC_STAAW GMP reductase OS=Staphylococcus aureus (strain MW2) GN=guaC PE=3 SV=1 216 429 4.0E-22
sp|Q6G9M1|GUAC_STAAS GMP reductase OS=Staphylococcus aureus (strain MSSA476) GN=guaC PE=3 SV=1 216 429 4.0E-22
sp|P60563|GUAC_STAAN GMP reductase OS=Staphylococcus aureus (strain N315) GN=guaC PE=1 SV=1 216 429 4.0E-22
sp|P60562|GUAC_STAAM GMP reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=guaC PE=3 SV=1 216 429 4.0E-22
sp|A5ISL9|GUAC_STAA9 GMP reductase OS=Staphylococcus aureus (strain JH9) GN=guaC PE=3 SV=1 216 429 4.0E-22
sp|A6U1F7|GUAC_STAA2 GMP reductase OS=Staphylococcus aureus (strain JH1) GN=guaC PE=3 SV=1 216 429 4.0E-22
sp|A7X1Z1|GUAC_STAA1 GMP reductase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=guaC PE=3 SV=1 216 429 4.0E-22
sp|Q38YF0|GUAC_LACSS GMP reductase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=guaC PE=3 SV=1 215 429 5.0E-22
sp|A4SJY8|GUAC_AERS4 GMP reductase OS=Aeromonas salmonicida (strain A449) GN=guaC PE=3 SV=1 261 514 5.0E-22
sp|A4W6K6|GUAC_ENT38 GMP reductase OS=Enterobacter sp. (strain 638) GN=guaC PE=3 SV=1 261 508 5.0E-22
sp|Q2YXS9|GUAC_STAAB GMP reductase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=guaC PE=3 SV=1 216 429 8.0E-22
sp|A8AXD6|GUAC_STRGC GMP reductase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=guaC PE=3 SV=1 219 429 8.0E-22
sp|Q21U05|GUAC_RHOFT GMP reductase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=guaC PE=3 SV=1 253 429 1.0E-21
sp|B2USX4|GUAC_HELPS GMP reductase OS=Helicobacter pylori (strain Shi470) GN=guaC PE=3 SV=1 219 443 1.0E-21
sp|B1YH73|GUAC_EXIS2 GMP reductase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=guaC PE=3 SV=1 216 443 1.0E-21
sp|Q8Z9F9|GUAC_SALTI GMP reductase OS=Salmonella typhi GN=guaC PE=3 SV=1 280 508 1.0E-21
sp|A6T4P6|GUAC_KLEP7 GMP reductase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=guaC PE=3 SV=1 261 508 1.0E-21
sp|B1IC44|GUAC_STRPI GMP reductase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=guaC PE=3 SV=1 182 429 1.0E-21
sp|A7N204|GUAC_VIBCB GMP reductase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=guaC PE=3 SV=1 283 508 1.0E-21
sp|Q49XD2|GUAC_STAS1 GMP reductase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=guaC PE=3 SV=1 245 506 1.0E-21
sp|A8G9U1|GUAC_SERP5 GMP reductase OS=Serratia proteamaculans (strain 568) GN=guaC PE=3 SV=1 178 508 2.0E-21
sp|B4TXJ0|GUAC_SALSV GMP reductase OS=Salmonella schwarzengrund (strain CVM19633) GN=guaC PE=3 SV=1 276 508 2.0E-21
sp|A9MZN3|GUAC_SALPB GMP reductase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=guaC PE=3 SV=1 276 508 2.0E-21
sp|Q8ZRT5|GUAC_SALTY GMP reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=guaC PE=3 SV=1 280 508 2.0E-21
sp|B5BLD7|GUAC_SALPK GMP reductase OS=Salmonella paratyphi A (strain AKU_12601) GN=guaC PE=3 SV=1 280 508 2.0E-21
sp|Q5PDH8|GUAC_SALPA GMP reductase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=guaC PE=3 SV=1 280 508 2.0E-21
sp|B4SU63|GUAC_SALNS GMP reductase OS=Salmonella newport (strain SL254) GN=guaC PE=3 SV=1 280 508 2.0E-21
sp|B4TJA0|GUAC_SALHS GMP reductase OS=Salmonella heidelberg (strain SL476) GN=guaC PE=3 SV=1 280 508 2.0E-21
sp|B5R2N9|GUAC_SALEP GMP reductase OS=Salmonella enteritidis PT4 (strain P125109) GN=guaC PE=3 SV=1 280 508 2.0E-21
sp|B5FI86|GUAC_SALDC GMP reductase OS=Salmonella dublin (strain CT_02021853) GN=guaC PE=3 SV=1 280 508 2.0E-21
sp|B5F7X8|GUAC_SALA4 GMP reductase OS=Salmonella agona (strain SL483) GN=guaC PE=3 SV=1 280 508 2.0E-21
sp|A4VUJ2|GUAC_STRSY GMP reductase OS=Streptococcus suis (strain 05ZYH33) GN=guaC PE=3 SV=2 219 429 2.0E-21
sp|Q7MD57|GUAC_VIBVY GMP reductase OS=Vibrio vulnificus (strain YJ016) GN=guaC PE=3 SV=2 280 508 2.0E-21
sp|Q8D632|GUAC_VIBVU GMP reductase OS=Vibrio vulnificus (strain CMCP6) GN=guaC PE=3 SV=1 280 508 2.0E-21
sp|Q12CT8|GUAC_POLSJ GMP reductase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=guaC PE=3 SV=1 226 429 2.0E-21
sp|A4W0T4|GUAC_STRS2 GMP reductase OS=Streptococcus suis (strain 98HAH33) GN=guaC PE=3 SV=2 219 429 2.0E-21
sp|A9MQA3|GUAC_SALAR GMP reductase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=guaC PE=3 SV=1 280 508 2.0E-21
sp|B5RH79|GUAC_SALG2 GMP reductase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=guaC PE=3 SV=1 280 508 2.0E-21
sp|Q1CT17|GUAC_HELPH GMP reductase OS=Helicobacter pylori (strain HPAG1) GN=guaC PE=3 SV=1 245 443 2.0E-21
sp|B8ZJR9|GUAC_STRPJ GMP reductase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=guaC PE=3 SV=1 182 429 2.0E-21
sp|C1CKY8|GUAC_STRZP GMP reductase OS=Streptococcus pneumoniae (strain P1031) GN=guaC PE=3 SV=1 182 429 2.0E-21
sp|C0Q5K1|GUAC_SALPC GMP reductase OS=Salmonella paratyphi C (strain RKS4594) GN=guaC PE=3 SV=1 280 508 2.0E-21
sp|C1CR55|GUAC_STRZT GMP reductase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=guaC PE=3 SV=1 182 429 2.0E-21
sp|C3LUL9|GUAC_VIBCM GMP reductase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=guaC PE=3 SV=1 280 508 2.0E-21
sp|Q9KMW9|GUAC_VIBCH GMP reductase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=guaC PE=3 SV=1 280 508 2.0E-21
sp|A5EYL9|GUAC_VIBC3 GMP reductase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=guaC PE=3 SV=1 280 508 2.0E-21
sp|A1JJK8|GUAC_YERE8 GMP reductase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=guaC PE=3 SV=1 239 508 2.0E-21
sp|B9DS39|GUAC_STRU0 GMP reductase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=guaC PE=3 SV=1 219 429 2.0E-21
sp|B5Y1T3|GUAC_KLEP3 GMP reductase OS=Klebsiella pneumoniae (strain 342) GN=guaC PE=3 SV=1 261 508 2.0E-21
sp|C4L088|GUAC_EXISA GMP reductase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=guaC PE=3 SV=1 219 429 3.0E-21
sp|B5YZD9|GUAC_ECO5E GMP reductase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=guaC PE=3 SV=1 261 508 3.0E-21
sp|Q8X984|GUAC_ECO57 GMP reductase OS=Escherichia coli O157:H7 GN=guaC PE=3 SV=1 261 508 3.0E-21
sp|B7MNW1|GUAC_ECO81 GMP reductase OS=Escherichia coli O81 (strain ED1a) GN=guaC PE=3 SV=1 261 508 3.0E-21
sp|B1JK64|GUAC_YERPY GMP reductase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=guaC PE=3 SV=1 239 508 4.0E-21
sp|Q66EJ0|GUAC_YERPS GMP reductase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=guaC PE=3 SV=1 239 508 4.0E-21
sp|A4TPS6|GUAC_YERPP GMP reductase OS=Yersinia pestis (strain Pestoides F) GN=guaC PE=3 SV=1 239 508 4.0E-21
sp|Q1CLY8|GUAC_YERPN GMP reductase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=guaC PE=3 SV=1 239 508 4.0E-21
sp|A9R1J4|GUAC_YERPG GMP reductase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=guaC PE=3 SV=1 239 508 4.0E-21
sp|Q8ZBI2|GUAC_YERPE GMP reductase OS=Yersinia pestis GN=guaC PE=3 SV=1 239 508 4.0E-21
sp|B2K4G3|GUAC_YERPB GMP reductase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=guaC PE=3 SV=1 239 508 4.0E-21
sp|Q1C3T0|GUAC_YERPA GMP reductase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=guaC PE=3 SV=1 239 508 4.0E-21
sp|A7FM52|GUAC_YERP3 GMP reductase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=guaC PE=3 SV=1 239 508 4.0E-21
sp|B2U2A9|GUAC_SHIB3 GMP reductase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=guaC PE=3 SV=1 261 508 4.0E-21
sp|Q8DPJ7|GUAC_STRR6 GMP reductase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=guaC PE=3 SV=1 182 429 5.0E-21
sp|C1C7M7|GUAC_STRP7 GMP reductase OS=Streptococcus pneumoniae (strain 70585) GN=guaC PE=3 SV=1 182 429 5.0E-21
sp|Q04K71|GUAC_STRP2 GMP reductase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=guaC PE=3 SV=1 182 429 5.0E-21
sp|Q83SM9|GUAC_SHIFL GMP reductase OS=Shigella flexneri GN=guaC PE=3 SV=1 261 508 5.0E-21
sp|Q326D1|GUAC_SHIBS GMP reductase OS=Shigella boydii serotype 4 (strain Sb227) GN=guaC PE=3 SV=1 261 508 5.0E-21
sp|C1CEK5|GUAC_STRZJ GMP reductase OS=Streptococcus pneumoniae (strain JJA) GN=guaC PE=3 SV=1 182 429 5.0E-21
sp|B7N7X5|GUAC_ECOLU GMP reductase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=guaC PE=3 SV=1 261 508 5.0E-21
sp|B7NI65|GUAC_ECO7I GMP reductase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=guaC PE=3 SV=1 261 508 5.0E-21
sp|Q0T894|GUAC_SHIF8 GMP reductase OS=Shigella flexneri serotype 5b (strain 8401) GN=guaC PE=3 SV=1 261 508 5.0E-21
sp|Q3Z5Q5|GUAC_SHISS GMP reductase OS=Shigella sonnei (strain Ss046) GN=guaC PE=3 SV=1 261 508 6.0E-21
sp|Q32JY8|GUAC_SHIDS GMP reductase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=guaC PE=3 SV=1 261 508 6.0E-21
sp|Q1RG92|GUAC_ECOUT GMP reductase OS=Escherichia coli (strain UTI89 / UPEC) GN=guaC PE=3 SV=1 261 508 6.0E-21
sp|B6HZ81|GUAC_ECOSE GMP reductase OS=Escherichia coli (strain SE11) GN=guaC PE=3 SV=1 261 508 6.0E-21
sp|P60560|GUAC_ECOLI GMP reductase OS=Escherichia coli (strain K12) GN=guaC PE=1 SV=1 261 508 6.0E-21
sp|B1IQN5|GUAC_ECOLC GMP reductase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=guaC PE=3 SV=1 261 508 6.0E-21
sp|P60561|GUAC_ECOL6 GMP reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=guaC PE=3 SV=1 261 508 6.0E-21
sp|Q0TLN6|GUAC_ECOL5 GMP reductase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=guaC PE=3 SV=1 261 508 6.0E-21
sp|A1A7E7|GUAC_ECOK1 GMP reductase OS=Escherichia coli O1:K1 / APEC GN=guaC PE=3 SV=1 261 508 6.0E-21
sp|A7ZW55|GUAC_ECOHS GMP reductase OS=Escherichia coli O9:H4 (strain HS) GN=guaC PE=3 SV=1 261 508 6.0E-21
sp|B1XC80|GUAC_ECODH GMP reductase OS=Escherichia coli (strain K12 / DH10B) GN=guaC PE=3 SV=1 261 508 6.0E-21
sp|C4ZRJ8|GUAC_ECOBW GMP reductase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=guaC PE=3 SV=1 261 508 6.0E-21
sp|B7M145|GUAC_ECO8A GMP reductase OS=Escherichia coli O8 (strain IAI1) GN=guaC PE=3 SV=1 261 508 6.0E-21
sp|B7LFX2|GUAC_ECO55 GMP reductase OS=Escherichia coli (strain 55989 / EAEC) GN=guaC PE=3 SV=1 261 508 6.0E-21
sp|B7MAM6|GUAC_ECO45 GMP reductase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=guaC PE=3 SV=1 261 508 6.0E-21
sp|B7UIF3|GUAC_ECO27 GMP reductase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=guaC PE=3 SV=1 261 508 6.0E-21
sp|Q831S1|GUAC_ENTFA GMP reductase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=guaC PE=3 SV=1 219 443 6.0E-21
sp|A1VMA8|GUAC_POLNA GMP reductase OS=Polaromonas naphthalenivorans (strain CJ2) GN=guaC PE=3 SV=1 253 429 7.0E-21
sp|A7ZHJ5|GUAC_ECO24 GMP reductase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=guaC PE=3 SV=1 261 508 8.0E-21
sp|Q8CPC9|GUAC_STAES GMP reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=guaC PE=3 SV=1 219 429 8.0E-21
sp|Q5HPK5|GUAC_STAEQ GMP reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=guaC PE=3 SV=1 219 429 8.0E-21
sp|Q4L646|GUAC_STAHJ GMP reductase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=guaC PE=3 SV=1 216 429 8.0E-21
sp|B5E4Y3|GUAC_STRP4 GMP reductase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=guaC PE=3 SV=1 182 429 8.0E-21
sp|Q97QG5|GUAC_STRPN GMP reductase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=guaC PE=3 SV=1 182 429 8.0E-21
sp|Q7NTY1|GUAC_CHRVO GMP reductase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=guaC PE=3 SV=1 256 506 1.0E-20
sp|B7LWQ6|GUAC_ESCF3 GMP reductase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=guaC PE=3 SV=1 261 508 1.0E-20
sp|B2IPN4|GUAC_STRPS GMP reductase OS=Streptococcus pneumoniae (strain CGSP14) GN=guaC PE=3 SV=1 182 429 1.0E-20
sp|Q57TB5|GUAC_SALCH GMP reductase OS=Salmonella choleraesuis (strain SC-B67) GN=guaC PE=3 SV=1 280 508 1.0E-20
sp|C5B9H0|GUAC_EDWI9 GMP reductase OS=Edwardsiella ictaluri (strain 93-146) GN=guaC PE=3 SV=1 263 508 2.0E-20
sp|A1WB23|GUAC_ACISJ GMP reductase OS=Acidovorax sp. (strain JS42) GN=guaC PE=3 SV=1 215 429 4.0E-20
sp|B9ME75|GUAC_ACIET GMP reductase OS=Acidovorax ebreus (strain TPSY) GN=guaC PE=3 SV=1 216 429 4.0E-20
sp|Q03AR1|GUAC_LACC3 GMP reductase OS=Lactobacillus casei (strain ATCC 334) GN=guaC PE=3 SV=1 220 429 4.0E-20
sp|B1XWM8|GUAC_LEPCP GMP reductase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=guaC PE=3 SV=1 216 429 4.0E-20
sp|B1LG40|GUAC_ECOSM GMP reductase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=guaC PE=3 SV=1 261 508 5.0E-20
sp|Q02Z38|GUAC_LACLS GMP reductase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=guaC PE=3 SV=1 256 429 5.0E-20
sp|A8ALJ2|GUAC_CITK8 GMP reductase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=guaC PE=3 SV=1 261 508 7.0E-20
sp|Q9CGF1|GUAC_LACLA GMP reductase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=guaC PE=3 SV=1 256 429 8.0E-20
sp|C5CT60|GUAC_VARPS GMP reductase OS=Variovorax paradoxus (strain S110) GN=guaC PE=3 SV=1 253 429 8.0E-20
sp|B3WCK9|GUAC_LACCB GMP reductase OS=Lactobacillus casei (strain BL23) GN=guaC PE=3 SV=1 220 429 9.0E-20
sp|A2RL29|GUAC_LACLM GMP reductase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=guaC PE=3 SV=1 256 429 9.0E-20
sp|Q88SV5|GUAC_LACPL GMP reductase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=guaC PE=3 SV=1 216 429 2.0E-19
sp|A1TNF7|GUAC_ACIAC GMP reductase OS=Acidovorax citrulli (strain AAC00-1) GN=guaC PE=3 SV=1 219 429 5.0E-19
sp|A1WIJ3|GUAC_VEREI GMP reductase OS=Verminephrobacter eiseniae (strain EF01-2) GN=guaC PE=3 SV=1 258 429 1.0E-18
sp|A9BNR6|GUAC_DELAS GMP reductase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=guaC PE=3 SV=1 238 429 1.0E-18
sp|Q8T6T2|IMDH_CRYPV Inosine-5'-monophosphate dehydrogenase OS=Cryptosporidium parvum GN=56k.02 PE=1 SV=1 44 140 3.0E-18
sp|Q6MUI1|GUAC_MYCMS GMP reductase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=guaC PE=3 SV=1 219 444 2.0E-16
sp|Q6F1U6|GUAC_MESFL GMP reductase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=guaC PE=3 SV=1 254 444 3.0E-16
sp|P49058|IMDH_BORBU Inosine-5'-monophosphate dehydrogenase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=guaB PE=1 SV=1 44 126 8.0E-16
sp|P54606|YHCV_BACSU CBS domain-containing protein YhcV OS=Bacillus subtilis (strain 168) GN=yhcV PE=3 SV=1 139 242 3.0E-10
sp|Q57647|Y188_METJA Uncharacterized protein MJ0188 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0188 PE=3 SV=1 134 242 7.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7045
MAAAGVGSGAQLLDHRKALEVLDEYKTRDGLDIHQLMDTTKHGGLTYNDFLLLPGYIGFPASEVALDSPVTKRIT
LKTPFVSSPMDTVTEHEMAIHMALQGGLGVIHHNCSPEAQADMVRKVKRYENGFILDPVVIDRNLTVGAAKALKE
KWGFGGFPVTENGKLGSKLLGIVTNRDIQFEEDLDMPVSSVMVTALVTAPDGVTLIEANKILAQSKKGKLPIVDK
DHNLVSMISRSDLTKNQHFPLASKLPDSKQLLCAAAIGTRPEDKTRLKKLVEAGLDVVILDSSQGNSLYQIDMIK
WIKSEFPALDVIGGNVVTREQAASLIAAGADGLRIGMGSGSACITQEVMAVGRPQAAAVYSVSHFAARFGVPCIA
DGGVQNVGHIVKGLALGASTVMMGGLLAGTTESPGTSFVSREGKLVKAYRGMGSIDAMQDKKAGGGSKDSQRSNA
GTARYFSEGDSVLVAQGVSGAVAHRGSVGKFVPYLAAGLKHSMQDCGMKSLTELHKSTASGAVRFELRTSSAQVE
GNVNMEAYEKKLYA*
Coding >Hirsu2|7045
ATGGCCGCCGCCGGCGTCGGGTCCGGCGCTCAGCTCCTCGACCACCGCAAGGCGCTCGAGGTGCTCGACGAGTAC
AAGACGCGCGATGGGCTCGACATCCACCAGCTCATGGACACGACCAAGCACGGCGGGCTGACGTACAATGACTTC
CTGCTGCTGCCCGGCTACATTGGCTTCCCCGCGTCCGAGGTGGCGCTCGACTCGCCGGTGACGAAGCGCATCACG
CTCAAGACGCCCTTCGTCTCGTCGCCCATGGATACCGTCACCGAGCACGAGATGGCCATCCACATGGCCCTGCAG
GGTGGCCTGGGTGTCATCCATCACAACTGCTCCCCCGAGGCCCAGGCCGACATGGTTCGCAAGGTCAAGCGGTAC
GAGAACGGCTTCATCCTCGACCCCGTCGTCATCGACCGCAACCTCACCGTCGGCGCCGCCAAGGCCCTCAAGGAG
AAATGGGGCTTTGGCGGCTTTCCCGTCACTGAGAACGGCAAGCTCGGGTCCAAGCTGTTGGGCATCGTGACCAAC
CGCGATATCCAGTTTGAGGAGGACCTCGACATGCCCGTCTCGAGCGTCATGGTGACGGCCCTCGTCACGGCCCCC
GACGGCGTCACCCTCATTGAGGCCAACAAGATCCTGGCTCAGTCCAAGAAGGGCAAGCTGCCCATCGTCGACAAG
GACCACAACCTCGTCTCCATGATCTCCCGCTCCGACTTGACTAAGAACCAACACTTCCCCCTGGCCTCCAAGCTG
CCCGACAGCAAGCAGCTGCTGTGCGCTGCCGCCATCGGCACCCGGCCGGAGGACAAGACGCGCCTCAAGAAGCTC
GTCGAGGCGGGCCTCGACGTGGTCATCCTCGACAGCTCCCAAGGCAACAGCCTGTACCAGATCGACATGATCAAG
TGGATCAAATCGGAGTTCCCGGCCTTGGACGTCATCGGCGGCAACGTCGTGACGCGCGAGCAGGCGGCCTCGCTC
ATCGCCGCCGGCGCCGACGGGCTGCGGATCGGCATGGGAAGCGGCTCGGCATGCATCACGCAGGAGGTCATGGCC
GTCGGGCGTCCCCAGGCGGCGGCCGTCTACTCGGTCAGCCACTTCGCCGCGCGCTTCGGCGTGCCCTGCATCGCT
GACGGCGGCGTGCAAAACGTCGGGCATATCGTCAAGGGCCTCGCCCTCGGCGCCTCGACGGTCATGATGGGCGGC
CTCCTGGCCGGCACGACCGAGTCGCCCGGCACCTCGTTCGTGTCGCGCGAGGGCAAGCTGGTCAAGGCCTACCGC
GGCATGGGCAGCATCGACGCCATGCAGGACAAGAAGGCCGGCGGCGGCAGCAAGGACAGCCAGAGGAGCAACGCG
GGGACGGCGCGGTACTTCTCCGAGGGCGACAGCGTGCTGGTGGCGCAGGGCGTGTCGGGCGCCGTGGCGCACCGC
GGGTCCGTCGGCAAGTTCGTGCCGTACCTGGCGGCCGGGCTCAAGCACTCGATGCAGGACTGCGGCATGAAGAGC
CTGACGGAGCTGCACAAGAGCACGGCCAGCGGCGCGGTGCGCTTCGAGCTCCGCACCTCGAGCGCCCAGGTCGAG
GGCAACGTGAACATGGAGGCTTACGAGAAGAAGCTGTACGCCTGA
Transcript >Hirsu2|7045
ATGGCCGCCGCCGGCGTCGGGTCCGGCGCTCAGCTCCTCGACCACCGCAAGGCGCTCGAGGTGCTCGACGAGTAC
AAGACGCGCGATGGGCTCGACATCCACCAGCTCATGGACACGACCAAGCACGGCGGGCTGACGTACAATGACTTC
CTGCTGCTGCCCGGCTACATTGGCTTCCCCGCGTCCGAGGTGGCGCTCGACTCGCCGGTGACGAAGCGCATCACG
CTCAAGACGCCCTTCGTCTCGTCGCCCATGGATACCGTCACCGAGCACGAGATGGCCATCCACATGGCCCTGCAG
GGTGGCCTGGGTGTCATCCATCACAACTGCTCCCCCGAGGCCCAGGCCGACATGGTTCGCAAGGTCAAGCGGTAC
GAGAACGGCTTCATCCTCGACCCCGTCGTCATCGACCGCAACCTCACCGTCGGCGCCGCCAAGGCCCTCAAGGAG
AAATGGGGCTTTGGCGGCTTTCCCGTCACTGAGAACGGCAAGCTCGGGTCCAAGCTGTTGGGCATCGTGACCAAC
CGCGATATCCAGTTTGAGGAGGACCTCGACATGCCCGTCTCGAGCGTCATGGTGACGGCCCTCGTCACGGCCCCC
GACGGCGTCACCCTCATTGAGGCCAACAAGATCCTGGCTCAGTCCAAGAAGGGCAAGCTGCCCATCGTCGACAAG
GACCACAACCTCGTCTCCATGATCTCCCGCTCCGACTTGACTAAGAACCAACACTTCCCCCTGGCCTCCAAGCTG
CCCGACAGCAAGCAGCTGCTGTGCGCTGCCGCCATCGGCACCCGGCCGGAGGACAAGACGCGCCTCAAGAAGCTC
GTCGAGGCGGGCCTCGACGTGGTCATCCTCGACAGCTCCCAAGGCAACAGCCTGTACCAGATCGACATGATCAAG
TGGATCAAATCGGAGTTCCCGGCCTTGGACGTCATCGGCGGCAACGTCGTGACGCGCGAGCAGGCGGCCTCGCTC
ATCGCCGCCGGCGCCGACGGGCTGCGGATCGGCATGGGAAGCGGCTCGGCATGCATCACGCAGGAGGTCATGGCC
GTCGGGCGTCCCCAGGCGGCGGCCGTCTACTCGGTCAGCCACTTCGCCGCGCGCTTCGGCGTGCCCTGCATCGCT
GACGGCGGCGTGCAAAACGTCGGGCATATCGTCAAGGGCCTCGCCCTCGGCGCCTCGACGGTCATGATGGGCGGC
CTCCTGGCCGGCACGACCGAGTCGCCCGGCACCTCGTTCGTGTCGCGCGAGGGCAAGCTGGTCAAGGCCTACCGC
GGCATGGGCAGCATCGACGCCATGCAGGACAAGAAGGCCGGCGGCGGCAGCAAGGACAGCCAGAGGAGCAACGCG
GGGACGGCGCGGTACTTCTCCGAGGGCGACAGCGTGCTGGTGGCGCAGGGCGTGTCGGGCGCCGTGGCGCACCGC
GGGTCCGTCGGCAAGTTCGTGCCGTACCTGGCGGCCGGGCTCAAGCACTCGATGCAGGACTGCGGCATGAAGAGC
CTGACGGAGCTGCACAAGAGCACGGCCAGCGGCGCGGTGCGCTTCGAGCTCCGCACCTCGAGCGCCCAGGTCGAG
GGCAACGTGAACATGGAGGCTTACGAGAAGAAGCTGTACGCCTGA
Gene >Hirsu2|7045
ATGGCCGCCGCCGGCGTCGGGTCCGGCGCTCAGCTCCTCGACCACCGCAAGGCGCTCGAGGTGCTCGACGAGTAC
AAGACGCGCGATGGGCTCGACATCCACCAGCTCATGGACACGACCAAGCACGGCGGGCTGACGTACAATGACTTC
CTGCTGCTGCCCGGCTACATTGGCTTCCCCGCGTCCGAGGTGGCGCTCGACTCGCCGGTGACGAAGCGCATCACG
CTCAAGACGCCCTTCGTCTCGTCGCCCATGGATACCGTCACCGAGCACGAGATGGCCATCCACATGGCCCTGCAG
GGTGGCCTGGGTGTCATCCATCACAACTGCTCCCCCGAGGCCCAGGCCGACATGGTTCGCAAGGTCAAGCGGTAC
GAGAACGGCTTCATCCTCGACCCCGTCGTCATCGACCGCAACCTCACCGTCGGCGCCGCCAAGGCCCTCAAGGAG
AAATGGGGCTTTGGCGGCTTTCCCGTCACTGGTTAGTCCTCCCTTCCTCTTTTTTTCTTTCCCGCAAACGTGGCC
AATCTCCTCGGCATGATTATCACCCTTAAATATTATAACTTTCGTTCCGCCGCATCGAAGGGACTCCCTTTATGT
GGATACTCTATACTATGACGCTCTTCCACTTTACCCATTCCTATTCTTATACCCCCTTTCGTGCTCTGTGCATCT
GCTGACGGCATAGCTTGTGCAGAGAACGGCAAGCTCGGGTCCAAGCTGTTGGGCATCGTGACCAACCGCGATATC
CAGTTTGAGGAGGACCTCGACATGCCCGTCTCGAGCGTCATGGTGACGGCCCTCGTCACGGCCCCCGACGGCGTC
ACCCTCATTGAGGCCAACAAGATCCTGGCTCAGTCCAAGAAGGGCAAGCTGCCCATCGTCGACAAGGACCACAAC
CTCGTCTCCATGATCTCCCGCTCCGACTTGACTAAGAACCAACACTTCCCCCTGGCCTCCAAGCTGCCCGACAGC
AAGCAGCTGCTGTGCGCTGCCGCCATCGGCACCCGGCCGGAGGACAAGACGCGCCTCAAGAAGCTCGTCGAGGCG
GGCCTCGACGTGGTCATCCTCGACAGCTCCCAAGGCAACAGCCTGTACCAGATCGACATGATCAAGTGGATCAAA
TCGGAGTTCCCGGCCTTGGACGTCATCGGCGGCAACGTCGTGACGCGCGAGCAGGCGGCCTCGCTCATCGCCGCC
GGCGCCGACGGGCTGCGGATCGGCATGGGAAGCGGCTCGGCATGCATCACGCAGGAGGTCATGGCCGTCGGGCGT
CCCCAGGCGGCGGCCGTCTACTCGGTCAGCCACTTCGCCGCGCGCTTCGGCGTGCCCTGCATCGCTGACGGCGGC
GTGCAAAACGTCGGGCATATCGTCAAGGGCCTCGCCCTCGGCGCCTCGACGGTCATGATGGGCGGCCTCCTGGCC
GGCACGACCGAGTCGCCCGGCACCTCGTTCGTGTCGCGCGAGGGCAAGCTGGTCAAGGCCTACCGCGGCATGGGC
AGCATCGACGCCATGCAGGACAAGAAGGCCGGCGGCGGCAGCAAGGACAGCCAGAGGAGCAACGCGGGGACGGCG
CGGTACTTCTCCGAGGGCGACAGCGTGCTGGTGGCGCAGGGCGTGTCGGGCGCCGTGGCGCACCGCGGGTCCGTC
GGCAAGTTCGTGCCGTACCTGGCGGCCGGGCTCAAGCACTCGATGCAGGACTGCGGCATGAAGAGCCTGACGGAG
CTGCACAAGAGCACGGCCAGCGGCGCGGTGCGCTTCGAGCTCCGCACCTCGAGCGCCCAGGTCGAGGGCAACGTG
AACATGGAGGCTTACGAGAAGAAGCTGTACGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail