Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7044
Gene name
LocationContig_390:51..681
Strand+
Gene length (bp)630
Transcript length (bp)480
Coding sequence length (bp)480
Protein length (aa) 160

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04749 PLAC8 PLAC8 family 1.8E-19 12 112

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6MW50|YB290_NEUCR Uncharacterized protein NCU10291 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B4B2.090 PE=4 SV=1 10 130 1.0E-10
sp|D9HP27|CNR11_MAIZE Cell number regulator 11 OS=Zea mays GN=CNR11 PE=2 SV=1 6 142 4.0E-08
sp|D9HP26|CNR10_MAIZE Cell number regulator 10 OS=Zea mays GN=CNR10 PE=2 SV=1 8 116 4.0E-08
sp|Q9LQU4|PCR2_ARATH Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis thaliana GN=PCR2 PE=1 SV=1 8 145 4.0E-07
sp|Q9LS43|PCR7_ARATH Protein PLANT CADMIUM RESISTANCE 7 OS=Arabidopsis thaliana GN=PCR7 PE=2 SV=1 11 116 9.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6MW50|YB290_NEUCR Uncharacterized protein NCU10291 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B4B2.090 PE=4 SV=1 10 130 1.0E-10
sp|D9HP27|CNR11_MAIZE Cell number regulator 11 OS=Zea mays GN=CNR11 PE=2 SV=1 6 142 4.0E-08
sp|D9HP26|CNR10_MAIZE Cell number regulator 10 OS=Zea mays GN=CNR10 PE=2 SV=1 8 116 4.0E-08
sp|Q9LQU4|PCR2_ARATH Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis thaliana GN=PCR2 PE=1 SV=1 8 145 4.0E-07
sp|Q9LS43|PCR7_ARATH Protein PLANT CADMIUM RESISTANCE 7 OS=Arabidopsis thaliana GN=PCR7 PE=2 SV=1 11 116 9.0E-07
sp|P0CW97|PCR3_ARATH Protein PLANT CADMIUM RESISTANCE 3 OS=Arabidopsis thaliana GN=PCR3 PE=3 SV=1 8 145 1.0E-06
sp|Q9LQU2|PCR1_ARATH Protein PLANT CADMIUM RESISTANCE 1 OS=Arabidopsis thaliana GN=PCR1 PE=1 SV=1 8 145 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 52 74 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7044
MEQQQQPAHGEWRTGLFSGDGGDCLHACCSPCTLLGRSTSRMRDPSMQSYSLFNGDCAIFGALCIFTGCGWIFNV
AKRNELREHYGIDGSFGGDCCASYWCLCCAMAQQSTEVKRRTAGLPQPDTQGYQPEKHGMAMPPPPPPPGPVPQE
PLKHPPPQE*
Coding >Hirsu2|7044
ATGGAGCAACAGCAGCAGCCCGCCCACGGCGAGTGGCGCACCGGCCTGTTCAGCGGCGATGGCGGCGACTGTCTG
CACGCCTGCTGCTCCCCCTGCACCCTCCTCGGCCGGTCGACGAGCCGGATGCGCGACCCGTCGATGCAGAGCTAC
AGCCTGTTCAACGGCGACTGCGCCATCTTTGGCGCGCTGTGCATCTTCACCGGCTGTGGCTGGATCTTCAACGTG
GCCAAGCGCAACGAGCTCCGCGAGCACTACGGCATCGACGGCAGCTTCGGCGGCGACTGCTGCGCCAGCTACTGG
TGTCTCTGCTGCGCCATGGCCCAGCAGAGCACCGAGGTCAAGCGCCGCACCGCCGGCCTGCCCCAGCCCGACACG
CAGGGCTACCAGCCGGAGAAGCACGGCATGGCCATGCCGCCTCCGCCCCCGCCCCCGGGCCCCGTCCCGCAGGAG
CCGCTGAAGCATCCTCCCCCCCAGGAGTAG
Transcript >Hirsu2|7044
ATGGAGCAACAGCAGCAGCCCGCCCACGGCGAGTGGCGCACCGGCCTGTTCAGCGGCGATGGCGGCGACTGTCTG
CACGCCTGCTGCTCCCCCTGCACCCTCCTCGGCCGGTCGACGAGCCGGATGCGCGACCCGTCGATGCAGAGCTAC
AGCCTGTTCAACGGCGACTGCGCCATCTTTGGCGCGCTGTGCATCTTCACCGGCTGTGGCTGGATCTTCAACGTG
GCCAAGCGCAACGAGCTCCGCGAGCACTACGGCATCGACGGCAGCTTCGGCGGCGACTGCTGCGCCAGCTACTGG
TGTCTCTGCTGCGCCATGGCCCAGCAGAGCACCGAGGTCAAGCGCCGCACCGCCGGCCTGCCCCAGCCCGACACG
CAGGGCTACCAGCCGGAGAAGCACGGCATGGCCATGCCGCCTCCGCCCCCGCCCCCGGGCCCCGTCCCGCAGGAG
CCGCTGAAGCATCCTCCCCCCCAGGAGTAG
Gene >Hirsu2|7044
ATGGAGCAACAGCAGCAGCCCGCCCACGGCGAGTGGCGCACCGGCCTGTTCAGCGGCGATGGCGGCGACTGTCTG
CACGCCTGCTGCTCCCCCTGCACCCGTACGTCGTCGTCGCGCCTCTCCCCCTCGGCAAGATTGCGTCCGTGTTTT
TTTTTTTCTTCTTGCGACTGACGCGCTCTTCGCCCAGTCCTCGGCCGGTCGACGAGCCGGATGCGCGACCCGTCG
ATGCAGAGCTACAGCCTGTTCAACGGCGACTGCGCCATCTTTGGCGCGCTGTGCATCTTCACCGGCTGTGGCTGG
ATGTACGTTTCTCTTCTCCCTCCCCTCTCCCTCTCCCCGGTTCCGGCGGCTGACGTCGCGCCCAGCTTCAACGTG
GCCAAGCGCAACGAGCTCCGCGAGCACTACGGCATCGACGGCAGCTTCGGCGGCGACTGCTGCGCCAGCTACTGG
TGTCTCTGCTGCGCCATGGCCCAGCAGAGCACCGAGGTCAAGCGCCGCACCGCCGGCCTGCCCCAGCCCGACACG
CAGGGCTACCAGCCGGAGAAGCACGGCATGGCCATGCCGCCTCCGCCCCCGCCCCCGGGCCCCGTCCCGCAGGAG
CCGCTGAAGCATCCTCCCCCCCAGGAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail