Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7041
Gene name
LocationContig_39:44854..46738
Strand-
Gene length (bp)1884
Transcript length (bp)1446
Coding sequence length (bp)1446
Protein length (aa) 482

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00199 Catalase Catalase 7.2E-170 4 387
PF06628 Catalase-rel Catalase-related immune-responsive 2.4E-07 418 479

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13289|CATA_CANAL Peroxisomal catalase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CTA1 PE=2 SV=4 3 477 4.0E-157
sp|P07820|CATA_CANTR Peroxisomal catalase OS=Candida tropicalis GN=POX9 PE=1 SV=4 3 479 7.0E-156
sp|Q96VB8|CATA_CANBO Peroxisomal catalase OS=Candida boidinii GN=CTA1 PE=3 SV=1 27 481 5.0E-152
sp|P30263|CATA_PICAN Peroxisomal catalase OS=Pichia angusta GN=PXP9 PE=1 SV=1 3 481 2.0E-150
sp|P55306|CATA_SCHPO Catalase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta1 PE=1 SV=1 3 478 4.0E-146
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13289|CATA_CANAL Peroxisomal catalase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CTA1 PE=2 SV=4 3 477 4.0E-157
sp|P07820|CATA_CANTR Peroxisomal catalase OS=Candida tropicalis GN=POX9 PE=1 SV=4 3 479 7.0E-156
sp|Q96VB8|CATA_CANBO Peroxisomal catalase OS=Candida boidinii GN=CTA1 PE=3 SV=1 27 481 5.0E-152
sp|P30263|CATA_PICAN Peroxisomal catalase OS=Pichia angusta GN=PXP9 PE=1 SV=1 3 481 2.0E-150
sp|P55306|CATA_SCHPO Catalase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta1 PE=1 SV=1 3 478 4.0E-146
sp|P15202|CATA_YEAST Peroxisomal catalase A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTA1 PE=1 SV=1 1 477 7.0E-146
sp|P04040|CATA_HUMAN Catalase OS=Homo sapiens GN=CAT PE=1 SV=3 27 481 1.0E-132
sp|Q59714|CATA_PSEPU Catalase OS=Pseudomonas putida GN=katA PE=3 SV=1 27 480 3.0E-132
sp|P04762|CATA_RAT Catalase OS=Rattus norvegicus GN=Cat PE=1 SV=3 27 467 5.0E-132
sp|P00432|CATA_BOVIN Catalase OS=Bos taurus GN=CAT PE=1 SV=3 27 481 6.0E-132
sp|P24270|CATA_MOUSE Catalase OS=Mus musculus GN=Cat PE=1 SV=4 27 481 1.0E-131
sp|P55304|CATA_BOTFU Catalase A OS=Botryotinia fuckeliana GN=catA PE=2 SV=1 3 452 2.0E-131
sp|Q64405|CATA_CAVPO Catalase OS=Cavia porcellus GN=CAT PE=2 SV=4 27 481 3.0E-131
sp|Q5RF10|CATA_PONAB Catalase OS=Pongo abelii GN=CAT PE=2 SV=3 27 481 7.0E-131
sp|O97492|CATA_CANLF Catalase OS=Canis lupus familiaris GN=CAT PE=1 SV=3 27 481 2.0E-130
sp|Q2I6W4|CATA_CALJA Catalase OS=Callithrix jacchus GN=CAT PE=2 SV=3 27 481 2.0E-130
sp|O93662|CATA_METBF Catalase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=kat PE=3 SV=1 23 479 5.0E-130
sp|Q9XZD5|CATA_TOXGO Peroxisomal catalase OS=Toxoplasma gondii PE=2 SV=1 27 480 2.0E-129
sp|O62839|CATA_PIG Catalase OS=Sus scrofa GN=CAT PE=1 SV=4 27 481 2.0E-129
sp|Q27487|CATA1_CAEEL Peroxisomal catalase 1 OS=Caenorhabditis elegans GN=ctl-2 PE=2 SV=3 1 477 2.0E-127
sp|P26901|CATA_BACSU Vegetative catalase OS=Bacillus subtilis (strain 168) GN=katA PE=1 SV=5 27 480 1.0E-125
sp|Q9PWF7|CATA_RUGRU Catalase OS=Rugosa rugosa GN=cat PE=2 SV=3 27 481 1.0E-125
sp|Q27710|CATA_ONCVE Catalase OS=Onchocerca volvulus endobacterium GN=cat PE=2 SV=1 27 480 3.0E-125
sp|P90682|CATA_ASCSU Catalase OS=Ascaris suum GN=CAT PE=2 SV=2 27 481 1.0E-124
sp|P17336|CATA_DROME Catalase OS=Drosophila melanogaster GN=Cat PE=1 SV=2 3 479 5.0E-124
sp|O77229|CATA_DICDI Catalase-A OS=Dictyostelium discoideum GN=catA PE=2 SV=2 27 480 2.0E-122
sp|P33569|BCA_STRVP Bromoperoxidase-catalase OS=Streptomyces venezuelae (strain ATCC 10712 / CBS 650.69 / DSM 40230 / JCM 4526 / NBRC 13096 / PD 04745) GN=bca PE=1 SV=1 26 479 3.0E-122
sp|Q9PT92|CATA_DANRE Catalase OS=Danio rerio GN=cat PE=2 SV=1 27 383 5.0E-121
sp|O61235|CATA2_CAEEL Catalase-2 OS=Caenorhabditis elegans GN=ctl-1 PE=2 SV=3 1 481 8.0E-121
sp|P44390|CATA_HAEIN Catalase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=katA PE=2 SV=1 27 457 9.0E-120
sp|P0A323|CATA_BORPE Catalase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=katA PE=1 SV=1 27 480 6.0E-118
sp|P0A325|CATA_BORPA Catalase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=katA PE=3 SV=1 27 480 6.0E-118
sp|P0A324|CATA_BORBR Catalase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=katA PE=3 SV=1 27 480 6.0E-118
sp|Q9Z598|CATA_STRCO Catalase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=katA PE=3 SV=1 26 476 1.0E-117
sp|P42321|CATA_PROMI Catalase OS=Proteus mirabilis GN=katA PE=1 SV=1 27 467 1.0E-115
sp|P77872|CATA_HELPY Catalase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=katA PE=1 SV=2 27 481 1.0E-113
sp|Q9ZKX5|CATA_HELPJ Catalase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=katA PE=3 SV=1 27 481 2.0E-113
sp|P45737|CATA_BACFR Catalase OS=Bacteroides fragilis (strain YCH46) GN=katA PE=1 SV=1 3 480 3.0E-113
sp|A6ZV70|CATT_YEAS7 Catalase T OS=Saccharomyces cerevisiae (strain YJM789) GN=CTT1 PE=3 SV=2 3 480 5.0E-112
sp|Q9ZN99|CATA_DESVM Catalase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=katA PE=3 SV=2 4 468 9.0E-112
sp|Q6GH72|CATA_STAAR Catalase OS=Staphylococcus aureus (strain MRSA252) GN=katA PE=3 SV=1 27 480 9.0E-112
sp|P30265|CATA_LACSK Catalase OS=Lactobacillus sakei GN=katA PE=3 SV=2 27 464 1.0E-111
sp|Q8NWV5|CATA_STAAW Catalase OS=Staphylococcus aureus (strain MW2) GN=katA PE=3 SV=1 27 480 1.0E-111
sp|Q6G9M4|CATA_STAAS Catalase OS=Staphylococcus aureus (strain MSSA476) GN=katA PE=3 SV=1 27 480 1.0E-111
sp|Q7A5T2|CATA_STAAN Catalase OS=Staphylococcus aureus (strain N315) GN=katA PE=1 SV=2 27 480 1.0E-111
sp|Q99UE2|CATA_STAAM Catalase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=katA PE=3 SV=2 27 480 1.0E-111
sp|Q5HG86|CATA_STAAC Catalase OS=Staphylococcus aureus (strain COL) GN=katA PE=3 SV=2 27 480 1.0E-111
sp|Q2YXT2|CATA_STAAB Catalase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=katA PE=3 SV=2 27 480 1.0E-111
sp|Q2FYU7|CATA_STAA8 Catalase OS=Staphylococcus aureus (strain NCTC 8325) GN=katA PE=2 SV=2 27 480 1.0E-111
sp|Q2FH99|CATA_STAA3 Catalase OS=Staphylococcus aureus (strain USA300) GN=katA PE=3 SV=1 27 480 1.0E-111
sp|O68146|CATA_VIBF1 Catalase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=katA PE=2 SV=1 27 468 4.0E-111
sp|Q9L4S1|CATA_STAAU Catalase OS=Staphylococcus aureus GN=katA PE=3 SV=1 27 480 5.0E-111
sp|O52762|CATA_PSEAE Catalase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=katA PE=1 SV=1 27 468 6.0E-111
sp|P06115|CATT_YEAST Catalase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTT1 PE=1 SV=3 3 480 6.0E-111
sp|Q9KW19|CATA_STAWA Catalase OS=Staphylococcus warneri GN=katA PE=3 SV=1 27 468 8.0E-111
sp|P95631|CATA_RHIME Catalase A OS=Rhizobium meliloti (strain 1021) GN=katA PE=3 SV=2 3 479 3.0E-110
sp|P29422|CATA_MICLU Catalase OS=Micrococcus luteus GN=katA PE=1 SV=2 2 481 3.0E-108
sp|Q4L643|CATA_STAHJ Catalase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=katA PE=3 SV=1 27 468 6.0E-108
sp|Q9L4S2|CATB_STAAA Catalase-like protein OS=Staphylococcus aureus subsp. anaerobius GN=katB PE=3 SV=1 27 369 8.0E-108
sp|Q8CPD0|CATA_STAES Catalase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=katA PE=3 SV=1 27 468 2.0E-107
sp|Q5HPK8|CATA_STAEQ Catalase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=katA PE=3 SV=1 27 468 2.0E-107
sp|Q2PUJ9|CATA_STAEP Catalase OS=Staphylococcus epidermidis GN=katA PE=3 SV=1 27 468 2.0E-107
sp|Q9EV50|CATA_STAXY Catalase A OS=Staphylococcus xylosus GN=katA PE=3 SV=1 27 480 2.0E-106
sp|P0A326|CATA_BRUME Catalase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=katA PE=3 SV=2 10 479 7.0E-106
sp|P0A327|CATA_BRUAB Catalase OS=Brucella abortus biovar 1 (strain 9-941) GN=katA PE=1 SV=2 10 479 7.0E-106
sp|Q8FWU0|CATA_BRUSU Catalase OS=Brucella suis biovar 1 (strain 1330) GN=katA PE=3 SV=3 10 479 1.0E-105
sp|Q59296|CATA_CAMJE Catalase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=katA PE=3 SV=1 4 467 2.0E-104
sp|P25890|CATA_PEA Catalase OS=Pisum sativum PE=2 SV=1 27 479 7.0E-104
sp|Q66V81|CATB_STAXY Catalase B OS=Staphylococcus xylosus GN=katB PE=3 SV=2 27 438 3.0E-103
sp|Q49XC1|CATA_STAS1 Catalase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=katA PE=3 SV=1 27 438 3.0E-103
sp|P49315|CATA1_NICPL Catalase isozyme 1 (Fragment) OS=Nicotiana plumbaginifolia GN=CAT1 PE=2 SV=1 27 479 3.0E-103
sp|O48560|CATA3_SOYBN Catalase-3 OS=Glycine max GN=CAT3 PE=2 SV=1 27 479 6.0E-103
sp|P30567|CATA2_GOSHI Catalase isozyme 2 OS=Gossypium hirsutum GN=CAT2 PE=2 SV=1 27 479 8.0E-103
sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 27 479 9.0E-103
sp|P29756|CATA1_SOYBN Catalase-1/2 OS=Glycine max GN=CAT1 PE=2 SV=1 27 479 7.0E-102
sp|Q43206|CATA1_WHEAT Catalase-1 OS=Triticum aestivum GN=CAT1 PE=2 SV=1 27 480 1.0E-101
sp|O48561|CATA4_SOYBN Catalase-4 OS=Glycine max GN=CAT4 PE=2 SV=1 27 480 5.0E-101
sp|Q01297|CATA1_RICCO Catalase isozyme 1 OS=Ricinus communis GN=CAT1 PE=2 SV=2 27 479 7.0E-101
sp|Q59602|CATA_NEIGO Catalase OS=Neisseria gonorrhoeae GN=katA PE=3 SV=1 3 468 3.0E-100
sp|P30264|CATA1_SOLLC Catalase isozyme 1 OS=Solanum lycopersicum GN=CAT1 PE=2 SV=1 27 480 5.0E-100
sp|P12365|CATA2_MAIZE Catalase isozyme 2 OS=Zea mays GN=CAT2 PE=2 SV=3 27 480 7.0E-100
sp|Q96528|CATA1_ARATH Catalase-1 OS=Arabidopsis thaliana GN=CAT1 PE=2 SV=3 27 479 7.0E-100
sp|P32290|CATA_VIGRR Catalase OS=Vigna radiata var. radiata PE=2 SV=1 27 479 1.0E-99
sp|A2YH64|CATA2_ORYSI Catalase isozyme B OS=Oryza sativa subsp. indica GN=CATB PE=2 SV=2 3 479 1.0E-99
sp|Q0E4K1|CATA1_ORYSJ Catalase isozyme A OS=Oryza sativa subsp. japonica GN=CATA PE=2 SV=1 27 471 1.0E-99
sp|P0C549|CATA1_ORYSI Catalase isozyme A OS=Oryza sativa subsp. indica PE=2 SV=1 27 471 1.0E-99
sp|Q0D9C4|CATA2_ORYSJ Catalase isozyme B OS=Oryza sativa subsp. japonica GN=CATB PE=2 SV=1 3 479 1.0E-99
sp|P45739|CATA_HELAN Catalase OS=Helianthus annuus PE=2 SV=1 27 479 2.0E-99
sp|P55311|CATA_SOLME Catalase OS=Solanum melongena PE=2 SV=1 27 479 3.0E-99
sp|Q9XHH3|CATA2_SOLLC Catalase isozyme 2 OS=Solanum lycopersicum GN=CAT2 PE=2 SV=1 27 479 3.0E-99
sp|P49318|CATA2_RICCO Catalase isozyme 2 OS=Ricinus communis GN=CAT2 PE=2 SV=1 27 479 2.0E-98
sp|P55307|CATA1_HORVU Catalase isozyme 1 OS=Hordeum vulgare GN=CAT1 PE=2 SV=1 27 479 2.0E-98
sp|P55312|CATA2_SOLTU Catalase isozyme 2 OS=Solanum tuberosum GN=CAT2 PE=3 SV=1 27 480 2.0E-98
sp|P17598|CATA1_GOSHI Catalase isozyme 1 OS=Gossypium hirsutum GN=CAT1 PE=2 SV=2 27 479 2.0E-98
sp|P25819|CATA2_ARATH Catalase-2 OS=Arabidopsis thaliana GN=CAT2 PE=2 SV=3 27 479 3.0E-98
sp|Q9M5L6|CATA_CAPAN Catalase OS=Capsicum annuum GN=CAT PE=2 SV=1 27 480 5.0E-98
sp|P18123|CATA3_MAIZE Catalase isozyme 3 OS=Zea mays GN=CAT3 PE=2 SV=2 27 471 6.0E-98
sp|P49317|CATA3_NICPL Catalase isozyme 3 OS=Nicotiana plumbaginifolia GN=CAT3 PE=2 SV=1 27 479 1.0E-97
sp|P30266|CATE_BACPE Catalase OS=Bacillus pseudofirmus (strain OF4) GN=katE PE=3 SV=3 27 480 2.0E-97
sp|P55313|CATA2_WHEAT Catalase OS=Triticum aestivum GN=CATA PE=2 SV=1 27 479 3.0E-97
sp|P55308|CATA2_HORVU Catalase isozyme 2 OS=Hordeum vulgare GN=CAT2 PE=2 SV=1 27 471 1.0E-96
sp|Q9AXH0|CATA_AVIMR Catalase OS=Avicennia marina PE=2 SV=1 2 479 1.0E-96
sp|Q87JE8|CATA_VIBPA Catalase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VPA0305 PE=3 SV=2 3 469 2.0E-96
sp|P49319|CATA1_TOBAC Catalase isozyme 1 OS=Nicotiana tabacum GN=CAT-1 PE=1 SV=2 27 480 7.0E-96
sp|Q9KRQ1|CATA_VIBCH Catalase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_1585 PE=3 SV=2 3 469 1.0E-95
sp|P24168|CATA_LISSE Catalase OS=Listeria seeligeri GN=kat PE=3 SV=1 27 478 1.0E-95
sp|P18122|CATA1_MAIZE Catalase isozyme 1 OS=Zea mays GN=CAT1 PE=2 SV=1 3 479 1.0E-95
sp|Q9C168|CAT1_NEUCR Catalase-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cat-1 PE=1 SV=2 27 369 4.0E-95
sp|Q9I1W8|CATE_PSEAE Catalase HPII OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=katE PE=3 SV=1 27 378 5.0E-95
sp|P48350|CATA1_CUCPE Catalase isozyme 1 OS=Cucurbita pepo GN=CAT1 PE=2 SV=1 27 479 1.0E-94
sp|Q8Y3P9|CATA_LISMO Catalase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=kat PE=3 SV=1 27 478 1.0E-94
sp|P49316|CATA2_NICPL Catalase isozyme 2 OS=Nicotiana plumbaginifolia GN=CAT2 PE=2 SV=1 27 480 1.0E-94
sp|Q42547|CATA3_ARATH Catalase-3 OS=Arabidopsis thaliana GN=CAT3 PE=1 SV=3 27 479 2.0E-94
sp|Q8D452|CATA_VIBVU Catalase OS=Vibrio vulnificus (strain CMCP6) GN=VV2_1473 PE=3 SV=2 3 469 3.0E-94
sp|Q926X0|CATA_LISIN Catalase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kat PE=3 SV=1 27 369 3.0E-94
sp|Q7MFM6|CATA_VIBVY Catalase OS=Vibrio vulnificus (strain YJ016) GN=VVA0294 PE=3 SV=1 3 469 1.0E-93
sp|P49284|CATA1_SOLTU Catalase isozyme 1 OS=Solanum tuberosum GN=CAT1 PE=2 SV=1 27 480 1.0E-93
sp|P42234|CATE_BACSU Catalase-2 OS=Bacillus subtilis (strain 168) GN=katE PE=3 SV=2 27 480 1.0E-93
sp|P50979|CATE_MYCAV Catalase HPII OS=Mycobacterium avium GN=katE PE=3 SV=1 15 361 2.0E-93
sp|Q59635|CATB_PSEAE Catalase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=katB PE=3 SV=1 2 468 8.0E-93
sp|P48352|CATA3_CUCPE Catalase isozyme 3 OS=Cucurbita pepo GN=CAT3 PE=2 SV=1 27 479 9.0E-93
sp|P07145|CATA_IPOBA Catalase OS=Ipomoea batatas PE=2 SV=1 10 479 1.0E-92
sp|P48351|CATA2_CUCPE Catalase isozyme 2 OS=Cucurbita pepo GN=CAT2 PE=2 SV=1 27 475 5.0E-92
sp|P55305|CATA_EMENI Catalase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=catA PE=2 SV=2 24 465 2.0E-90
sp|P55310|CATA_SECCE Catalase OS=Secale cereale PE=2 SV=1 27 429 9.0E-90
sp|P94377|CATX_BACSU Catalase X OS=Bacillus subtilis (strain 168) GN=katX PE=3 SV=1 3 481 2.0E-89
sp|Q59337|CATA_DEIRA Catalase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=katA PE=1 SV=2 2 479 3.0E-89
sp|P95539|CATE_PSEPU Catalase HPII OS=Pseudomonas putida GN=katE PE=3 SV=1 27 358 2.0E-88
sp|Q9C169|CAT3_NEUCR Catalase-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cat-3 PE=1 SV=1 27 371 4.0E-88
sp|P78574|CATA_ASPFU Catalase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=catA PE=3 SV=2 27 369 2.0E-87
sp|P21179|CATE_ECOLI Catalase HPII OS=Escherichia coli (strain K12) GN=katE PE=1 SV=1 18 369 7.0E-87
sp|Q8X1P0|CATA_BLUGH Catalase OS=Blumeria graminis f. sp. hordei GN=CAT1 PE=3 SV=1 27 373 7.0E-87
sp|Q55DH8|CATB_DICDI Catalase-B OS=Dictyostelium discoideum GN=catB PE=1 SV=1 27 452 7.0E-86
sp|P78619|CATB_EMENI Catalase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=catB PE=2 SV=2 17 479 1.0E-85
sp|P46206|CATB_PSESY Catalase OS=Pseudomonas syringae pv. syringae GN=katB PE=1 SV=2 27 469 2.0E-85
sp|Q877A8|CATB_ASPOR Catalase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=catB PE=2 SV=1 27 373 1.0E-82
sp|Q92405|CATB_ASPFU Catalase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=catB PE=1 SV=1 27 373 2.0E-80
sp|Q9Y7C2|CATB_AJECA Catalase B OS=Ajellomyces capsulatus GN=CATB PE=2 SV=1 23 373 4.0E-80
sp|Q9X576|CATE_RHIME Catalase C OS=Rhizobium meliloti (strain 1021) GN=katE PE=2 SV=2 3 378 1.0E-79
sp|P55303|CATR_ASPNG Catalase R OS=Aspergillus niger GN=catR PE=3 SV=1 27 371 4.0E-73
sp|P81138|CAT1_PENJA Catalase OS=Penicillium janthinellum PE=1 SV=1 22 373 2.0E-49
sp|P11934|CATA_PENJA Catalase OS=Penicillium janthinellum PE=1 SV=1 83 368 1.0E-18
sp|Q55025|SRPA_SYNE7 Catalase-related peroxidase OS=Synechococcus elongatus (strain PCC 7942) GN=srpA PE=1 SV=2 48 345 4.0E-13
sp|Q73WB6|CRPE_MYCPA Catalase-related peroxidase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_2744c PE=1 SV=1 51 354 6.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0004096 catalase activity Yes
GO:0020037 heme binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0016209 antioxidant activity No
GO:0004601 peroxidase activity No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7041
MATLANGQPSPSPGSAQAVRYGSSNGGLVVLSDVQTVEVLAHFARERIPERSVHAKAAGAFGEFEVLEDVSDLTD
AKFLTGVGKKTKILTRISTVGGEKGSSDTVRDVRGWATKFYTEEGVQDFVFNDLPVFFIRDPIKFPSMNRSHKRH
PQTNVPDNSMFWDFHLNNPEGMHALMHLFGQRGIPASLRHINGFSVHTYTLNKADGSYVYVKWHFKPDDGIKTMD
ADTALRLAGSEPDYHVKDLFKAIEKGDYPSWSVYLQVMKPEEVQSAPIDIFDDTYTWPHEKYPLRLVGRLTLNKN
PNNYFQDIEQACFSPSNMVPGIGPSADPVLQARMFSYPDAHRYRVGPNYFQLPPNRPTNKVYAPYVRDGPGTMNG
NYGSDPDYVFSELRPVAESKRIQMPTHELWSGRVTTFATALSDNDFVQPRQLWQIICSEPKGKEQFLHNILPTLG
DIPDKMKQEVLEYFGRVDQSLKQLLQQGLAK*
Coding >Hirsu2|7041
ATGGCGACGCTAGCCAACGGCCAGCCAAGTCCGAGTCCCGGCTCGGCCCAGGCGGTTCGCTACGGCAGCAGCAAT
GGCGGCCTGGTCGTGCTCAGCGATGTGCAGACGGTCGAGGTCCTGGCCCATTTCGCGCGTGAACGCATTCCTGAG
CGGAGCGTCCACGCAAAGGCCGCGGGCGCGTTTGGCGAATTCGAAGTCCTGGAAGATGTCTCCGACCTCACCGAC
GCCAAGTTCCTGACTGGTGTCGGCAAGAAGACCAAGATCCTGACGCGCATCTCGACCGTCGGCGGCGAGAAGGGA
TCGAGCGACACGGTCCGCGATGTCCGCGGCTGGGCGACCAAGTTCTACACGGAGGAGGGCGTCCAGGACTTCGTC
TTCAACGACCTGCCCGTCTTCTTCATCCGCGATCCCATCAAGTTCCCGTCCATGAACCGCAGCCACAAGCGGCAC
CCGCAGACGAACGTGCCGGACAACTCCATGTTCTGGGACTTCCACCTGAACAATCCCGAGGGGATGCACGCCCTA
ATGCACCTCTTCGGACAGCGCGGCATTCCCGCCTCCCTGAGACACATCAACGGCTTCAGCGTCCACACGTACACG
TTGAACAAGGCGGACGGGAGTTATGTCTATGTCAAGTGGCACTTCAAGCCCGACGACGGCATCAAGACCATGGAC
GCAGACACGGCGCTCCGCCTGGCGGGATCGGAACCGGACTACCACGTCAAGGACCTCTTCAAGGCCATCGAAAAG
GGCGACTACCCGAGCTGGTCCGTGTACCTGCAGGTCATGAAGCCCGAAGAGGTCCAGTCGGCCCCGATCGACATC
TTCGACGACACGTACACATGGCCGCATGAGAAGTATCCCCTGCGTCTCGTCGGCCGGCTGACGCTCAACAAGAAC
CCAAACAACTACTTCCAGGACATAGAGCAGGCCTGCTTCTCGCCCTCCAACATGGTTCCGGGCATCGGGCCCTCC
GCCGATCCCGTTCTCCAAGCCAGGATGTTCAGCTACCCGGACGCCCACCGCTACCGCGTCGGCCCCAACTACTTC
CAGCTGCCGCCCAACAGGCCGACGAACAAGGTGTACGCGCCGTATGTGCGCGACGGCCCCGGCACGATGAACGGG
AACTACGGCAGCGATCCCGATTACGTCTTCTCGGAGCTGCGCCCCGTGGCGGAGAGCAAGCGGATCCAGATGCCG
ACGCACGAGCTCTGGTCCGGACGCGTGACGACCTTCGCAACGGCCCTCTCCGACAACGACTTTGTGCAGCCTCGG
CAGCTGTGGCAGATTATCTGCAGCGAGCCCAAGGGCAAAGAGCAGTTCCTCCACAACATCCTGCCGACGCTGGGA
GACATCCCGGACAAGATGAAGCAAGAAGTCTTGGAGTACTTTGGACGCGTGGACCAGAGCCTGAAGCAGCTTCTC
CAGCAAGGGCTTGCCAAGTGA
Transcript >Hirsu2|7041
ATGGCGACGCTAGCCAACGGCCAGCCAAGTCCGAGTCCCGGCTCGGCCCAGGCGGTTCGCTACGGCAGCAGCAAT
GGCGGCCTGGTCGTGCTCAGCGATGTGCAGACGGTCGAGGTCCTGGCCCATTTCGCGCGTGAACGCATTCCTGAG
CGGAGCGTCCACGCAAAGGCCGCGGGCGCGTTTGGCGAATTCGAAGTCCTGGAAGATGTCTCCGACCTCACCGAC
GCCAAGTTCCTGACTGGTGTCGGCAAGAAGACCAAGATCCTGACGCGCATCTCGACCGTCGGCGGCGAGAAGGGA
TCGAGCGACACGGTCCGCGATGTCCGCGGCTGGGCGACCAAGTTCTACACGGAGGAGGGCGTCCAGGACTTCGTC
TTCAACGACCTGCCCGTCTTCTTCATCCGCGATCCCATCAAGTTCCCGTCCATGAACCGCAGCCACAAGCGGCAC
CCGCAGACGAACGTGCCGGACAACTCCATGTTCTGGGACTTCCACCTGAACAATCCCGAGGGGATGCACGCCCTA
ATGCACCTCTTCGGACAGCGCGGCATTCCCGCCTCCCTGAGACACATCAACGGCTTCAGCGTCCACACGTACACG
TTGAACAAGGCGGACGGGAGTTATGTCTATGTCAAGTGGCACTTCAAGCCCGACGACGGCATCAAGACCATGGAC
GCAGACACGGCGCTCCGCCTGGCGGGATCGGAACCGGACTACCACGTCAAGGACCTCTTCAAGGCCATCGAAAAG
GGCGACTACCCGAGCTGGTCCGTGTACCTGCAGGTCATGAAGCCCGAAGAGGTCCAGTCGGCCCCGATCGACATC
TTCGACGACACGTACACATGGCCGCATGAGAAGTATCCCCTGCGTCTCGTCGGCCGGCTGACGCTCAACAAGAAC
CCAAACAACTACTTCCAGGACATAGAGCAGGCCTGCTTCTCGCCCTCCAACATGGTTCCGGGCATCGGGCCCTCC
GCCGATCCCGTTCTCCAAGCCAGGATGTTCAGCTACCCGGACGCCCACCGCTACCGCGTCGGCCCCAACTACTTC
CAGCTGCCGCCCAACAGGCCGACGAACAAGGTGTACGCGCCGTATGTGCGCGACGGCCCCGGCACGATGAACGGG
AACTACGGCAGCGATCCCGATTACGTCTTCTCGGAGCTGCGCCCCGTGGCGGAGAGCAAGCGGATCCAGATGCCG
ACGCACGAGCTCTGGTCCGGACGCGTGACGACCTTCGCAACGGCCCTCTCCGACAACGACTTTGTGCAGCCTCGG
CAGCTGTGGCAGATTATCTGCAGCGAGCCCAAGGGCAAAGAGCAGTTCCTCCACAACATCCTGCCGACGCTGGGA
GACATCCCGGACAAGATGAAGCAAGAAGTCTTGGAGTACTTTGGACGCGTGGACCAGAGCCTGAAGCAGCTTCTC
CAGCAAGGGCTTGCCAAGTGA
Gene >Hirsu2|7041
ATGGCGACGCTAGCCAACGGTAAGGAGCTTCTCGTCCTCCGTCTCGACCCAATAATACCCCATCTGACTGTCATC
CTTCCAGGCCAGCCAAGTCCGAGTCCCGGCTCGGCCCAGGCGGTTCGCTACGGCAGCAGCAATGGCGGCCTGGTC
GTGCTCAGCGATGTGCAGACGGTCGAGGTCCTGGCCCATTTCGCGCGTGAACGCATTCCTGAGCGGTACGGCACG
ATCCCGGCGGAACGCTTGTTTCGTCGACCCGCGACATGGACGTGTCTGAGGCTGACCCTGCAATTGTAGGAGCGT
CCACGCAAAGGCCGCGGGCGCGTTTGGCGAATTCGAAGTCCTGGAAGATGTCTCCGACCTCACCGACGCCAAGTT
CCTGACTGGTGTCGGCAAGAAGACCAAGATCCTGACGCGCATCTCGACCGTCGGCGGCGAGAAGGGATCGAGCGA
CACGGTCCGCGATGTCCGCGGCTGGGCGACCAAGTTCTACACGGAGGAGGGCGTCCAGGACTTCGTCTTCAACGA
CCTGCCCGTCTTCTTCATCCGCGATCCCATCAAGTTCCCGTCCATGAACCGCAGCCACAAGCGGCACCCGCAGAC
GAACGTGCCGGACAACTCCATGTTCTGGGACTTCCACCTGAACAATCCCGAGGGGATGCACGCCCTAATGCACCT
CTTCGGACAGCGCGGCATTCCCGCCTCCCTGAGACACATCAACGGCTTCAGCGTCCACACGTACACGTTGAACAA
GGCGGTGGGTGCCCAGCCGCCTTCCCCTGGCAGCATGCGTACATGTCGCCTCGATGCAGGTGGCGTGTGCCGGAG
GCTGGAGGCTGACGAGCACCCTCGTCTAGGACGGGAGTTATGTCTATGTCAAGTGGCACTTCAAGCCCGACGACG
GCATCAAGACCATGGACGCAGACACGGCGCTCCGCCTGGCGGGATCGGAACCGGACTACCACGTCAAGGACCTCT
TCAAGGCCATCGAAAAGGGCGACTACCCGAGCTGGTCCGTGTACCTGCAGGTCATGAAGCCCGAAGAGGTCCAGT
CGGCCCCGATCGACATCTTCGACGACACGTACACATGGCCGCATGAGAAGTATCCCCTGCGTCTCGTCGGCCGGC
TGACGCTCAACAAGAACGTGCGTTTCCACACCGAGTCCATCCTGCGTCGTGGTTCCGTGGCTAACGAGGAGCGGT
GAGCAGCCAAACAACTACTTCCAGGACATAGAGCAGGCCTGCTTCTCGCCCTCCAACATGGTTCCGGGCATCGGG
CCCTCCGCCGATCCCGGTTGGTGAAGCCGATGAGTTGTTGAAAAGTCAAGGCGGCAGCGGCTGACGGAATCGCGA
TGCAGTTCTCCAAGCCAGGATGTTCAGCTACCCGGACGCCCACCGCTACCGCGTCGGCCCCAACTACTTCCAGCT
GCCGCCCAACAGGCCGACGAACAAGGTGTACGCGCCGTATGTGCGCGACGGCCCCGGCACGATGAACGGGAACTA
CGGCAGCGATCCCGATTACGTCTTCTCGGAGCTGCGCCCCGTGGCGGAGAGCAAGCGGATCCAGATGCCGACGCA
CGAGCTCTGGTCCGGACGCGTGACGACCTTCGCAACGGCCCTCTCCGACAACGACTTTGTGCAGCCTCGGCAGCT
GTGGCAGATTATCTGCAGCGAGCCCAAGGGCAAAGAGCAGTTCCTCCACAACATCCTGCCGACGCTGGGAGACAT
CCCGGACAAGATGAAGCAAGAAGTCTTGGGTGCGTCCTCGTCTGCCGCTGGCCGCGGCCCTTTTGGGGTCTGGTG
CCTTGTGCTAACTGCCGTGAAGAGTACTTTGGACGCGTGGACCAGAGCCTGAAGCAGCTTCTCCAGCAAGGGCTT
GCCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail