Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7040
Gene name
LocationContig_39:42836..43845
Strand-
Gene length (bp)1009
Transcript length (bp)594
Coding sequence length (bp)594
Protein length (aa) 198

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00957 Synaptobrevin Synaptobrevin 2.5E-14 135 191
PF13774 Longin Regulated-SNARE-like domain 2.5E-12 44 119

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60073|YKT6_SCHPO Synaptobrevin homolog ykt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ykt6 PE=3 SV=1 1 196 2.0E-83
sp|Q757A4|YKT6_ASHGO Synaptobrevin homolog YKT6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YKT6 PE=3 SV=1 1 197 1.0E-79
sp|P36015|YKT6_YEAST Synaptobrevin homolog YKT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKT6 PE=1 SV=1 1 197 1.0E-77
sp|Q6C537|YKT6_YARLI Synaptobrevin homolog YKT6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YKT6 PE=3 SV=1 1 197 2.0E-77
sp|Q6FW27|YKT6_CANGA Synaptobrevin homolog YKT6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YKT6 PE=3 SV=1 1 197 5.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60073|YKT6_SCHPO Synaptobrevin homolog ykt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ykt6 PE=3 SV=1 1 196 2.0E-83
sp|Q757A4|YKT6_ASHGO Synaptobrevin homolog YKT6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YKT6 PE=3 SV=1 1 197 1.0E-79
sp|P36015|YKT6_YEAST Synaptobrevin homolog YKT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKT6 PE=1 SV=1 1 197 1.0E-77
sp|Q6C537|YKT6_YARLI Synaptobrevin homolog YKT6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YKT6 PE=3 SV=1 1 197 2.0E-77
sp|Q6FW27|YKT6_CANGA Synaptobrevin homolog YKT6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YKT6 PE=3 SV=1 1 197 5.0E-77
sp|Q6CSA2|YKT6_KLULA Synaptobrevin homolog YKT6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YKT6 PE=3 SV=1 1 197 1.0E-75
sp|Q6BSL0|YKT6_DEBHA Synaptobrevin homolog YKT6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YKT6 PE=3 SV=1 1 197 2.0E-74
sp|O15498|YKT6_HUMAN Synaptobrevin homolog YKT6 OS=Homo sapiens GN=YKT6 PE=1 SV=1 38 197 1.0E-53
sp|Q32N70|YKT6B_XENLA Synaptobrevin homolog YKT6-B OS=Xenopus laevis GN=ykt6-b PE=2 SV=1 1 197 1.0E-52
sp|Q9CQW1|YKT6_MOUSE Synaptobrevin homolog YKT6 OS=Mus musculus GN=Ykt6 PE=1 SV=1 1 197 2.0E-52
sp|Q3T000|YKT6_BOVIN Synaptobrevin homolog YKT6 OS=Bos taurus GN=YKT6 PE=2 SV=1 38 197 2.0E-51
sp|Q6DDU7|YKT6A_XENLA Synaptobrevin homolog YKT6-A OS=Xenopus laevis GN=ykt6-a PE=2 SV=1 1 197 2.0E-51
sp|Q5EGY4|YKT6_RAT Synaptobrevin homolog YKT6 OS=Rattus norvegicus GN=Ykt6 PE=1 SV=1 38 197 2.0E-51
sp|Q7ZUN8|YKT6_DANRE Synaptobrevin homolog YKT6 OS=Danio rerio GN=ykt6 PE=2 SV=1 1 197 6.0E-51
sp|Q6P816|YKT6_XENTR Synaptobrevin homolog YKT6 OS=Xenopus tropicalis GN=ykt6 PE=2 SV=1 38 197 1.0E-50
sp|Q9ZRD6|YKT61_ARATH VAMP-like protein YKT61 OS=Arabidopsis thaliana GN=YKT61 PE=2 SV=1 24 197 6.0E-50
sp|Q9LVM9|YKT62_ARATH VAMP-like protein YKT62 OS=Arabidopsis thaliana GN=YKT62 PE=2 SV=1 12 197 4.0E-49
sp|Q54ES8|YKT6_DICDI Putative synaptobrevin homolog YKT6 OS=Dictyostelium discoideum GN=ykt6 PE=1 SV=1 1 194 4.0E-38
sp|Q9Y7L0|SEC22_SCHPO Protein transport protein sec22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec22 PE=3 SV=2 44 191 6.0E-12
sp|Q6C880|SEC22_YARLI Protein transport protein SEC22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC22 PE=3 SV=1 56 191 7.0E-09
sp|Q4KM74|SC22B_RAT Vesicle-trafficking protein SEC22b OS=Rattus norvegicus GN=Sec22b PE=1 SV=3 56 191 7.0E-09
sp|Q5RAI9|SC22B_PONAB Vesicle-trafficking protein SEC22b OS=Pongo abelii GN=SEC22B PE=2 SV=3 56 191 7.0E-09
sp|O08547|SC22B_MOUSE Vesicle-trafficking protein SEC22b OS=Mus musculus GN=Sec22b PE=1 SV=3 56 191 7.0E-09
sp|O75396|SC22B_HUMAN Vesicle-trafficking protein SEC22b OS=Homo sapiens GN=SEC22B PE=1 SV=4 56 191 8.0E-09
sp|O08595|SC22B_CRIGR Vesicle-trafficking protein SEC22b OS=Cricetulus griseus GN=Sec22b PE=1 SV=3 65 191 9.0E-09
sp|Q5ZJW4|SC22B_CHICK Vesicle-trafficking protein SEC22b OS=Gallus gallus GN=SEC22B PE=2 SV=1 56 191 1.0E-08
sp|Q94AU2|SEC22_ARATH 25.3 kDa vesicle transport protein OS=Arabidopsis thaliana GN=SEC22 PE=2 SV=1 45 196 2.0E-08
sp|Q7SXP0|S22BB_DANRE Vesicle-trafficking protein SEC22b-B OS=Danio rerio GN=sec22bb PE=2 SV=1 56 192 3.0E-08
sp|Q6P7L4|SC22B_XENTR Vesicle-trafficking protein SEC22b OS=Xenopus tropicalis GN=sec22b PE=2 SV=1 56 191 3.0E-08
sp|Q9SIQ9|VA712_ARATH Vesicle-associated membrane protein 712 OS=Arabidopsis thaliana GN=VAMP712 PE=2 SV=1 64 192 1.0E-06
sp|Q7ZV15|S22BA_DANRE Vesicle-trafficking protein SEC22b-A OS=Danio rerio GN=sec22ba PE=2 SV=1 56 192 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016192 vesicle-mediated transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7040
MKLHYIGIIRNETKPAHEICAEKELSAYSRFTRNNYAEFMTLFAKTVAERTKPGQRQDVEEQDYTFHAYGRTEGI
CGIIISDHPYPALVAHQLLSKCVDEFLAKHPRSSWATGQPQVAMPELAEYLTKYQDPQQADSIMKIQKELDETKI
VLHKTIESVLQRGEKIDDLVAKSDGLSSQSKMFYQQAKKQNSCCVLM*
Coding >Hirsu2|7040
ATGAAGTTGCACTACATCGGCATCATCCGCAACGAGACCAAGCCCGCCCACGAAATCTGCGCCGAAAAGGAGCTC
AGCGCCTACTCGCGCTTCACCCGCAACAACTATGCCGAGTTCATGACGCTGTTCGCCAAGACGGTCGCTGAGCGC
ACCAAGCCCGGCCAGCGGCAAGACGTGGAGGAACAAGACTACACGTTCCACGCGTACGGGCGCACCGAGGGCATC
TGCGGCATCATCATCTCGGACCACCCGTACCCCGCCCTCGTCGCCCACCAGCTGCTCAGCAAGTGCGTCGACGAG
TTCCTGGCCAAGCACCCGCGCTCCTCGTGGGCCACCGGCCAGCCGCAGGTGGCCATGCCCGAGCTGGCCGAGTAC
CTCACCAAGTACCAGGACCCCCAGCAGGCCGACAGCATCATGAAGATCCAGAAGGAGCTCGACGAGACCAAGATC
GTGCTGCACAAGACCATCGAGAGCGTCCTGCAGCGCGGCGAGAAGATTGACGACCTTGTGGCCAAGAGCGACGGC
CTCAGCTCCCAGAGCAAAATGTTTTATCAGCAAGCCAAGAAGCAAAACTCGTGCTGCGTCTTGATGTAG
Transcript >Hirsu2|7040
ATGAAGTTGCACTACATCGGCATCATCCGCAACGAGACCAAGCCCGCCCACGAAATCTGCGCCGAAAAGGAGCTC
AGCGCCTACTCGCGCTTCACCCGCAACAACTATGCCGAGTTCATGACGCTGTTCGCCAAGACGGTCGCTGAGCGC
ACCAAGCCCGGCCAGCGGCAAGACGTGGAGGAACAAGACTACACGTTCCACGCGTACGGGCGCACCGAGGGCATC
TGCGGCATCATCATCTCGGACCACCCGTACCCCGCCCTCGTCGCCCACCAGCTGCTCAGCAAGTGCGTCGACGAG
TTCCTGGCCAAGCACCCGCGCTCCTCGTGGGCCACCGGCCAGCCGCAGGTGGCCATGCCCGAGCTGGCCGAGTAC
CTCACCAAGTACCAGGACCCCCAGCAGGCCGACAGCATCATGAAGATCCAGAAGGAGCTCGACGAGACCAAGATC
GTGCTGCACAAGACCATCGAGAGCGTCCTGCAGCGCGGCGAGAAGATTGACGACCTTGTGGCCAAGAGCGACGGC
CTCAGCTCCCAGAGCAAAATGTTTTATCAGCAAGCCAAGAAGCAAAACTCGTGCTGCGTCTTGATGTAG
Gene >Hirsu2|7040
ATGAAGTTGCACTACATCGGCGTCAGTTTCGGCCCCCCCCCCTCTCCTCCCCCTTGCCCCGACCGTTCGAGGACG
AGTGGCGCTCACAGCGAGAGGGGAAACCAAAAAAACAGATCATCCGCAACGAGACCAAGCCCGCCCACGAAATCT
GCGCCGAAAAGGAGCTCAGCGCCTACTCGCGCTTCACCCGCAACAAGTCCGTCGCCGCCGGTCCCGGCCCCCTCC
GCCTCCGGCCCCGGCCGCGCTGCGTTTGCTGACGGGCCGGGGACGCAGCTATGCCGAGTTCATGACGCTGTTCGC
CAAGACGGTCGCTGAGCGCACCAAGCCCGGCCAGCGGCAAGACGTGGAGGAACAAGGTGCGAAATTAAAAAAAAG
ACCGTCCGCCTCTTGGCCCCCTTTTTCCGTCCCGGGCCGCAGGGGTGGCCCGTCTCGACTCTTGGTCGGGGGAGC
GGCGCAAGGAGACTGACGGCTACGTCGGGCAGACTACACGTTCCACGCGTACGGGCGCACCGAGGGCATCTGCGG
CATCATCATCTCGGACCACCCGTACCCCGCCCTCGTCGCCCACCAGCTGCTCAGCAAGTGCGTCGACGAGTTCCT
GGCCAAGCACCCGCGCTCCTCGTGGGCCACCGGCCAGCCGCAGGTGGCCATGCCCGAGCTGGCCGAGTACCTCAC
CAAGTACCAGGACCCCCAGCAGGCCGACAGCATCATGAAGATCCAGAAGGAGCTCGACGAGACCAAGATCGTGCT
GCACAAGACCATCGAGAGCGTCCTGCAGCGCGGCGAGAAGATTGACGACCTTGTGGCCAAGAGCGACGGCCTCAG
CTCCCAGAGCAAAATGTTTTATCGTGCGTCCTCCCGCCCCCATCCTCTCCCTCCGGACACGTGAGCGGAAATAGA
AAGAAAAAGAAAAAAGAAGGTCACCGTGGATCGTCGCCCCGTGCACCCGGCTGACAAAAGAATCACAGAGCAAGC
CAAGAAGCAAAACTCGTGCTGCGTCTTGATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail