Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7037
Gene name
LocationContig_39:34993..35722
Strand+
Gene length (bp)729
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04178 Got1 Got1/Sft2-like family 3.3E-14 19 114

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03554|GOT1_YEAST Protein transport protein GOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GOT1 PE=1 SV=1 3 128 2.0E-31
sp|Q20263|GOT1_CAEEL Probable Golgi transport protein 1 OS=Caenorhabditis elegans GN=F41C3.4 PE=3 SV=2 1 138 2.0E-21
sp|Q54CL4|GOT1_DICDI Protein transport protein got1 homolog OS=Dictyostelium discoideum GN=golt1 PE=3 SV=1 6 137 4.0E-21
sp|Q9DCQ3|GOT1A_MOUSE Vesicle transport protein GOT1A OS=Mus musculus GN=Golt1a PE=2 SV=1 5 127 6.0E-21
sp|Q6ZVE7|GOT1A_HUMAN Vesicle transport protein GOT1A OS=Homo sapiens GN=GOLT1A PE=2 SV=1 5 127 7.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03554|GOT1_YEAST Protein transport protein GOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GOT1 PE=1 SV=1 3 128 2.0E-31
sp|Q20263|GOT1_CAEEL Probable Golgi transport protein 1 OS=Caenorhabditis elegans GN=F41C3.4 PE=3 SV=2 1 138 2.0E-21
sp|Q54CL4|GOT1_DICDI Protein transport protein got1 homolog OS=Dictyostelium discoideum GN=golt1 PE=3 SV=1 6 137 4.0E-21
sp|Q9DCQ3|GOT1A_MOUSE Vesicle transport protein GOT1A OS=Mus musculus GN=Golt1a PE=2 SV=1 5 127 6.0E-21
sp|Q6ZVE7|GOT1A_HUMAN Vesicle transport protein GOT1A OS=Homo sapiens GN=GOLT1A PE=2 SV=1 5 127 7.0E-21
sp|Q2NKV8|GOT1A_BOVIN Vesicle transport protein GOT1A OS=Bos taurus GN=GOLT1A PE=2 SV=1 5 127 3.0E-20
sp|Q9USJ2|GOT1_SCHPO Protein transport protein got1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=got1 PE=3 SV=1 3 134 8.0E-20
sp|Q9Y3E0|GOT1B_HUMAN Vesicle transport protein GOT1B OS=Homo sapiens GN=GOLT1B PE=1 SV=1 5 128 1.0E-17
sp|Q2YDE3|GOT1B_BOVIN Vesicle transport protein GOT1B OS=Bos taurus GN=GOLT1B PE=2 SV=1 5 128 1.0E-17
sp|Q9CR60|GOT1B_MOUSE Vesicle transport protein GOT1B OS=Mus musculus GN=Golt1b PE=1 SV=1 5 128 2.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 12 31 19
2 36 58 22
3 70 92 22
4 102 124 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7037
MSMWLSDSQKIGVVFCSGGGLFLIGGVMLFFDRAMLAMGNILFLIGLTIIIGPQKTLLFFARKQKAKGTAAFFVG
LVLILLRWTFVGFVVEAYGIAVLFGDFLGTIAGFARGIPVIGPYIGLLVDRLGLGRRNAELPV*
Coding >Hirsu2|7037
ATGTCGATGTGGCTCTCCGACTCGCAAAAGATCGGCGTCGTCTTCTGTTCCGGCGGGGGCCTGTTCCTCATCGGC
GGAGTGATGCTGTTCTTTGATCGCGCTATGCTCGCGATGGGAAACATCCTCTTCCTCATCGGCCTGACCATCATC
ATCGGCCCGCAAAAGACGCTGCTGTTCTTCGCGCGCAAGCAAAAGGCCAAGGGCACGGCCGCCTTCTTCGTCGGC
CTGGTCCTCATCCTCCTGCGCTGGACCTTTGTCGGCTTCGTCGTCGAGGCCTACGGCATCGCCGTCCTGTTCGGG
GACTTCCTCGGCACCATCGCAGGCTTCGCCCGCGGTATACCGGTCATCGGTCCCTACATCGGCCTCTTGGTCGAC
AGGCTCGGGCTCGGACGCAGAAACGCCGAGCTGCCCGTATGA
Transcript >Hirsu2|7037
ATGTCGATGTGGCTCTCCGACTCGCAAAAGATCGGCGTCGTCTTCTGTTCCGGCGGGGGCCTGTTCCTCATCGGC
GGAGTGATGCTGTTCTTTGATCGCGCTATGCTCGCGATGGGAAACATCCTCTTCCTCATCGGCCTGACCATCATC
ATCGGCCCGCAAAAGACGCTGCTGTTCTTCGCGCGCAAGCAAAAGGCCAAGGGCACGGCCGCCTTCTTCGTCGGC
CTGGTCCTCATCCTCCTGCGCTGGACCTTTGTCGGCTTCGTCGTCGAGGCCTACGGCATCGCCGTCCTGTTCGGG
GACTTCCTCGGCACCATCGCAGGCTTCGCCCGCGGTATACCGGTCATCGGTCCCTACATCGGCCTCTTGGTCGAC
AGGCTCGGGCTCGGACGCAGAAACGCCGAGCTGCCCGTATGA
Gene >Hirsu2|7037
ATGTCGATGTGGCTCTCCGACTCGCAAAGTACGGTCCTGCGAACCGGGGGGAGTTGCCGCGACTTTTCGCTGACG
CCTTGTTGGTAGAGATCGGCGTCGTCTTCTGTTCCGGCGGTGGGTAGGCGCCCTGCCGCGAGCCGTTGCGCGTCG
CTACGAGCCTCGCTGACCCGTGCTCTCTCCCTCTCCGCAGGGGGCCTGTTCCTCATCGGCGGAGTGATGCTGTTC
TTTGATCGCGCTATGTAGCTCTCTCTCGTCCCCCTCCCCCTTTTTCAGAGGACGCGCGCAGCTGACCTAGGCAAC
CTCCCGCAGGCTCGCGATGGGAAACGTACGGACGCAAGAGCCCGCCCCCCTGATCCCCTTCGAAAAATCACCGCC
GGCCGCGAGGCGCGCGCACCGCTGACGAGTAGCGCCGTCGCCCTCCCCCCCTCGCAGATCCTCTTCCTCATCGGC
CTGACCATCATCATCGGCCCGCAAAAGACGCTGCTGTTCTTCGCGCGCAAGCAAAAGGCCAAGGGCACGGCCGCC
TTCTTCGTCGGCCTGGTCCTCATCCTCCTGCGCTGGACCTTTGTCGGCTTCGTCGTCGAGGCCTACGGCATCGCC
GTCCTGTTCGGGGACTTCCTCGGCACCATCGCAGGCTTCGCCCGCGGTATACCGGTCATCGGTCCCTACATCGGC
CTCTTGGTCGACAGGCTCGGGCTCGGACGCAGAAACGCCGAGCTGCCCGTATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail