Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7035
Gene name
LocationContig_39:27214..29416
Strand+
Gene length (bp)2202
Transcript length (bp)2202
Coding sequence length (bp)2202
Protein length (aa) 734

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 1.9E-09 96 281

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0009405 pathogenesis Yes
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0008150 biological_process No
GO:0044421 extracellular region part No
GO:0051704 multi-organism process No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0044419 interspecies interaction between organisms No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 622 644 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7035
MLLSKEDSRMRICQLLLVVFVLFLGLSQGLDAASDSQSIARRQSRGKKSSISPDREIDLDALPDQDFPDLDDYVW
RGEKPYSSLNGGEPNPIKRAQAAKGIWARGTDPSSTPDELGELYKAKSLWWHVRGDTSSITRYVSTSASLKAAMR
FASYTSFRDGQSRRYFDAKDAIVFKIRKTSRLIDTHESLTPKYLPDPSYAEQKEYSALDGIPLRDIRGWVKAEDL
RKNPKLRQKLANGEEPVKYFKKNPIYSEEAHAGARTSGIHHELAGFPDKQRDPNDRFKTTQFEAWQVEPWKGLRG
EDGFEAVQKKLIEAWDTLSKEISGAETQRDAEQPQADRGAAQLPGGSASAADGAGLKEEAKRRAKENVDRITVAV
KQARDVARSSTTIRRLIQGQETLRTMGKSIVEARAAAKSLVQIAEMMPNLKSKGFEKALEQIAAVREAASMAKTN
LLQSRITLIAKLVKRTAKEAGQRQAAGDESGLISAVRRAERLLAVLHTAHVQTQASLKKNAEELKELEDALRQGA
DEAAAKALADRLGLIQIPGQEGNKALEREAQSLKRVAKAMRPLLSTKQTKKAVKYLEQAQKAYVDSKGTSLQAAE
RQKHETTRAARAKAESPGLSPWAITGLVLGGLLLVGFTGGLAVAAEGALVGAGALAAIGAGEAVADTGLLVLSEA
EIEAQAEALIAEIEAEIEAEAATAGAGAGGAGAVPVPAKRQLPAHARRARARRWRRRI*
Coding >Hirsu2|7035
ATGCTCCTTTCGAAAGAAGACTCCCGAATGAGGATATGCCAGCTGCTTCTAGTCGTATTCGTACTGTTTCTAGGT
CTTAGTCAAGGCCTGGACGCAGCTAGTGACAGTCAAAGTATCGCCAGACGCCAATCTCGGGGCAAGAAATCCTCC
ATCAGCCCGGACCGAGAGATCGATCTCGATGCCCTGCCCGACCAAGACTTCCCAGATCTCGACGACTACGTCTGG
CGCGGCGAAAAACCGTATAGTTCTCTCAACGGCGGCGAGCCCAATCCCATCAAGCGGGCTCAGGCGGCCAAGGGC
ATTTGGGCCAGAGGAACAGACCCCTCGTCCACTCCGGACGAGCTCGGCGAACTGTACAAAGCCAAGAGCCTGTGG
TGGCACGTCAGAGGTGACACGAGTTCCATTACACGATATGTTTCGACGAGTGCGAGCCTGAAGGCGGCCATGAGG
TTTGCCTCCTACACCAGCTTCCGAGACGGCCAGTCGAGACGTTACTTCGATGCCAAAGACGCCATCGTCTTCAAA
ATCCGCAAGACGTCGAGGCTGATCGACACGCACGAGAGCCTGACCCCGAAATACCTCCCGGATCCATCATACGCC
GAGCAGAAAGAATATTCTGCTCTGGACGGAATCCCGCTCCGAGATATCAGGGGCTGGGTCAAGGCAGAGGATCTC
CGGAAGAATCCAAAGCTCCGGCAAAAACTCGCAAACGGCGAGGAACCGGTCAAGTACTTCAAGAAGAACCCGATC
TACAGTGAAGAGGCGCATGCCGGGGCGCGAACCAGCGGCATCCATCACGAGCTCGCCGGCTTCCCCGACAAGCAG
AGAGACCCCAACGACCGGTTCAAGACCACGCAGTTTGAGGCCTGGCAAGTGGAACCGTGGAAAGGGCTCAGGGGC
GAGGATGGCTTCGAGGCCGTGCAGAAGAAGCTGATAGAGGCCTGGGATACGCTGAGCAAGGAGATCTCGGGCGCG
GAAACGCAGCGCGACGCTGAGCAGCCACAAGCCGACCGGGGCGCCGCCCAGCTGCCCGGCGGCTCGGCATCTGCC
GCCGACGGGGCCGGCCTGAAGGAGGAGGCGAAGAGAAGGGCAAAGGAGAACGTAGACAGGATAACCGTCGCCGTC
AAGCAGGCCCGTGACGTGGCTCGCTCGTCCACCACGATCCGACGGCTGATCCAAGGGCAGGAAACACTGCGGACA
ATGGGAAAGTCGATCGTGGAGGCGAGGGCGGCGGCCAAGTCGTTGGTCCAGATTGCGGAGATGATGCCCAATCTC
AAGTCGAAGGGGTTCGAGAAGGCTCTGGAGCAAATCGCGGCCGTCCGAGAAGCGGCCTCGATGGCCAAGACGAAC
CTCCTGCAGTCCCGAATCACGCTCATCGCCAAGCTCGTGAAACGAACAGCGAAAGAGGCAGGGCAGCGCCAAGCA
GCAGGCGACGAAAGCGGCCTGATCAGCGCGGTGAGACGAGCGGAGCGGCTCCTCGCCGTCCTCCACACAGCACAC
GTCCAAACGCAAGCCAGCCTGAAGAAGAACGCGGAAGAGCTGAAGGAGCTGGAAGACGCGCTCAGGCAGGGCGCC
GACGAGGCGGCCGCCAAGGCTCTGGCGGACAGGCTCGGTCTCATCCAGATACCGGGCCAGGAGGGCAACAAGGCG
CTGGAGCGAGAGGCGCAGTCGCTCAAGCGGGTCGCCAAGGCGATGCGGCCCCTGCTGAGCACCAAGCAGACCAAG
AAGGCCGTCAAGTATCTGGAGCAGGCCCAGAAGGCGTACGTCGACTCCAAGGGCACGAGCCTGCAGGCGGCCGAG
CGGCAGAAGCACGAGACGACCAGGGCGGCCCGCGCCAAGGCCGAGAGCCCGGGCCTGTCGCCCTGGGCCATCACG
GGGCTCGTGCTGGGCGGCCTCCTGCTGGTCGGCTTCACCGGCGGCCTCGCCGTCGCGGCCGAGGGCGCGCTGGTC
GGCGCGGGCGCGCTGGCGGCCATCGGCGCGGGCGAGGCCGTCGCGGACACGGGGCTGCTGGTGCTGAGCGAAGCC
GAGATCGAGGCCCAGGCGGAGGCTCTGATCGCCGAGATCGAGGCCGAGATCGAGGCCGAGGCGGCGACGGCGGGG
GCCGGCGCGGGAGGCGCCGGAGCGGTCCCCGTCCCGGCCAAACGGCAGCTACCAGCCCATGCGCGGCGTGCGAGG
GCTCGGAGGTGGCGGCGGCGGATTTGA
Transcript >Hirsu2|7035
ATGCTCCTTTCGAAAGAAGACTCCCGAATGAGGATATGCCAGCTGCTTCTAGTCGTATTCGTACTGTTTCTAGGT
CTTAGTCAAGGCCTGGACGCAGCTAGTGACAGTCAAAGTATCGCCAGACGCCAATCTCGGGGCAAGAAATCCTCC
ATCAGCCCGGACCGAGAGATCGATCTCGATGCCCTGCCCGACCAAGACTTCCCAGATCTCGACGACTACGTCTGG
CGCGGCGAAAAACCGTATAGTTCTCTCAACGGCGGCGAGCCCAATCCCATCAAGCGGGCTCAGGCGGCCAAGGGC
ATTTGGGCCAGAGGAACAGACCCCTCGTCCACTCCGGACGAGCTCGGCGAACTGTACAAAGCCAAGAGCCTGTGG
TGGCACGTCAGAGGTGACACGAGTTCCATTACACGATATGTTTCGACGAGTGCGAGCCTGAAGGCGGCCATGAGG
TTTGCCTCCTACACCAGCTTCCGAGACGGCCAGTCGAGACGTTACTTCGATGCCAAAGACGCCATCGTCTTCAAA
ATCCGCAAGACGTCGAGGCTGATCGACACGCACGAGAGCCTGACCCCGAAATACCTCCCGGATCCATCATACGCC
GAGCAGAAAGAATATTCTGCTCTGGACGGAATCCCGCTCCGAGATATCAGGGGCTGGGTCAAGGCAGAGGATCTC
CGGAAGAATCCAAAGCTCCGGCAAAAACTCGCAAACGGCGAGGAACCGGTCAAGTACTTCAAGAAGAACCCGATC
TACAGTGAAGAGGCGCATGCCGGGGCGCGAACCAGCGGCATCCATCACGAGCTCGCCGGCTTCCCCGACAAGCAG
AGAGACCCCAACGACCGGTTCAAGACCACGCAGTTTGAGGCCTGGCAAGTGGAACCGTGGAAAGGGCTCAGGGGC
GAGGATGGCTTCGAGGCCGTGCAGAAGAAGCTGATAGAGGCCTGGGATACGCTGAGCAAGGAGATCTCGGGCGCG
GAAACGCAGCGCGACGCTGAGCAGCCACAAGCCGACCGGGGCGCCGCCCAGCTGCCCGGCGGCTCGGCATCTGCC
GCCGACGGGGCCGGCCTGAAGGAGGAGGCGAAGAGAAGGGCAAAGGAGAACGTAGACAGGATAACCGTCGCCGTC
AAGCAGGCCCGTGACGTGGCTCGCTCGTCCACCACGATCCGACGGCTGATCCAAGGGCAGGAAACACTGCGGACA
ATGGGAAAGTCGATCGTGGAGGCGAGGGCGGCGGCCAAGTCGTTGGTCCAGATTGCGGAGATGATGCCCAATCTC
AAGTCGAAGGGGTTCGAGAAGGCTCTGGAGCAAATCGCGGCCGTCCGAGAAGCGGCCTCGATGGCCAAGACGAAC
CTCCTGCAGTCCCGAATCACGCTCATCGCCAAGCTCGTGAAACGAACAGCGAAAGAGGCAGGGCAGCGCCAAGCA
GCAGGCGACGAAAGCGGCCTGATCAGCGCGGTGAGACGAGCGGAGCGGCTCCTCGCCGTCCTCCACACAGCACAC
GTCCAAACGCAAGCCAGCCTGAAGAAGAACGCGGAAGAGCTGAAGGAGCTGGAAGACGCGCTCAGGCAGGGCGCC
GACGAGGCGGCCGCCAAGGCTCTGGCGGACAGGCTCGGTCTCATCCAGATACCGGGCCAGGAGGGCAACAAGGCG
CTGGAGCGAGAGGCGCAGTCGCTCAAGCGGGTCGCCAAGGCGATGCGGCCCCTGCTGAGCACCAAGCAGACCAAG
AAGGCCGTCAAGTATCTGGAGCAGGCCCAGAAGGCGTACGTCGACTCCAAGGGCACGAGCCTGCAGGCGGCCGAG
CGGCAGAAGCACGAGACGACCAGGGCGGCCCGCGCCAAGGCCGAGAGCCCGGGCCTGTCGCCCTGGGCCATCACG
GGGCTCGTGCTGGGCGGCCTCCTGCTGGTCGGCTTCACCGGCGGCCTCGCCGTCGCGGCCGAGGGCGCGCTGGTC
GGCGCGGGCGCGCTGGCGGCCATCGGCGCGGGCGAGGCCGTCGCGGACACGGGGCTGCTGGTGCTGAGCGAAGCC
GAGATCGAGGCCCAGGCGGAGGCTCTGATCGCCGAGATCGAGGCCGAGATCGAGGCCGAGGCGGCGACGGCGGGG
GCCGGCGCGGGAGGCGCCGGAGCGGTCCCCGTCCCGGCCAAACGGCAGCTACCAGCCCATGCGCGGCGTGCGAGG
GCTCGGAGGTGGCGGCGGCGGATTTGA
Gene >Hirsu2|7035
ATGCTCCTTTCGAAAGAAGACTCCCGAATGAGGATATGCCAGCTGCTTCTAGTCGTATTCGTACTGTTTCTAGGT
CTTAGTCAAGGCCTGGACGCAGCTAGTGACAGTCAAAGTATCGCCAGACGCCAATCTCGGGGCAAGAAATCCTCC
ATCAGCCCGGACCGAGAGATCGATCTCGATGCCCTGCCCGACCAAGACTTCCCAGATCTCGACGACTACGTCTGG
CGCGGCGAAAAACCGTATAGTTCTCTCAACGGCGGCGAGCCCAATCCCATCAAGCGGGCTCAGGCGGCCAAGGGC
ATTTGGGCCAGAGGAACAGACCCCTCGTCCACTCCGGACGAGCTCGGCGAACTGTACAAAGCCAAGAGCCTGTGG
TGGCACGTCAGAGGTGACACGAGTTCCATTACACGATATGTTTCGACGAGTGCGAGCCTGAAGGCGGCCATGAGG
TTTGCCTCCTACACCAGCTTCCGAGACGGCCAGTCGAGACGTTACTTCGATGCCAAAGACGCCATCGTCTTCAAA
ATCCGCAAGACGTCGAGGCTGATCGACACGCACGAGAGCCTGACCCCGAAATACCTCCCGGATCCATCATACGCC
GAGCAGAAAGAATATTCTGCTCTGGACGGAATCCCGCTCCGAGATATCAGGGGCTGGGTCAAGGCAGAGGATCTC
CGGAAGAATCCAAAGCTCCGGCAAAAACTCGCAAACGGCGAGGAACCGGTCAAGTACTTCAAGAAGAACCCGATC
TACAGTGAAGAGGCGCATGCCGGGGCGCGAACCAGCGGCATCCATCACGAGCTCGCCGGCTTCCCCGACAAGCAG
AGAGACCCCAACGACCGGTTCAAGACCACGCAGTTTGAGGCCTGGCAAGTGGAACCGTGGAAAGGGCTCAGGGGC
GAGGATGGCTTCGAGGCCGTGCAGAAGAAGCTGATAGAGGCCTGGGATACGCTGAGCAAGGAGATCTCGGGCGCG
GAAACGCAGCGCGACGCTGAGCAGCCACAAGCCGACCGGGGCGCCGCCCAGCTGCCCGGCGGCTCGGCATCTGCC
GCCGACGGGGCCGGCCTGAAGGAGGAGGCGAAGAGAAGGGCAAAGGAGAACGTAGACAGGATAACCGTCGCCGTC
AAGCAGGCCCGTGACGTGGCTCGCTCGTCCACCACGATCCGACGGCTGATCCAAGGGCAGGAAACACTGCGGACA
ATGGGAAAGTCGATCGTGGAGGCGAGGGCGGCGGCCAAGTCGTTGGTCCAGATTGCGGAGATGATGCCCAATCTC
AAGTCGAAGGGGTTCGAGAAGGCTCTGGAGCAAATCGCGGCCGTCCGAGAAGCGGCCTCGATGGCCAAGACGAAC
CTCCTGCAGTCCCGAATCACGCTCATCGCCAAGCTCGTGAAACGAACAGCGAAAGAGGCAGGGCAGCGCCAAGCA
GCAGGCGACGAAAGCGGCCTGATCAGCGCGGTGAGACGAGCGGAGCGGCTCCTCGCCGTCCTCCACACAGCACAC
GTCCAAACGCAAGCCAGCCTGAAGAAGAACGCGGAAGAGCTGAAGGAGCTGGAAGACGCGCTCAGGCAGGGCGCC
GACGAGGCGGCCGCCAAGGCTCTGGCGGACAGGCTCGGTCTCATCCAGATACCGGGCCAGGAGGGCAACAAGGCG
CTGGAGCGAGAGGCGCAGTCGCTCAAGCGGGTCGCCAAGGCGATGCGGCCCCTGCTGAGCACCAAGCAGACCAAG
AAGGCCGTCAAGTATCTGGAGCAGGCCCAGAAGGCGTACGTCGACTCCAAGGGCACGAGCCTGCAGGCGGCCGAG
CGGCAGAAGCACGAGACGACCAGGGCGGCCCGCGCCAAGGCCGAGAGCCCGGGCCTGTCGCCCTGGGCCATCACG
GGGCTCGTGCTGGGCGGCCTCCTGCTGGTCGGCTTCACCGGCGGCCTCGCCGTCGCGGCCGAGGGCGCGCTGGTC
GGCGCGGGCGCGCTGGCGGCCATCGGCGCGGGCGAGGCCGTCGCGGACACGGGGCTGCTGGTGCTGAGCGAAGCC
GAGATCGAGGCCCAGGCGGAGGCTCTGATCGCCGAGATCGAGGCCGAGATCGAGGCCGAGGCGGCGACGGCGGGG
GCCGGCGCGGGAGGCGCCGGAGCGGTCCCCGTCCCGGCCAAACGGCAGCTACCAGCCCATGCGCGGCGTGCGAGG
GCTCGGAGGTGGCGGCGGCGGATTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail