Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7032
Gene name
LocationContig_39:22294..22970
Strand+
Gene length (bp)676
Transcript length (bp)522
Coding sequence length (bp)522
Protein length (aa) 174

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19287 DUF5910 Family of unknown function (DUF5910) 4.8E-29 16 152

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6733 0.529 0.0953 0.0532 0.1553 0.0086 0.2052 0.1417 0.1367 0.1576

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup663
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5812
Ophiocordyceps australis 1348a (Ghana) OphauG2|5813
Ophiocordyceps australis map64 (Brazil) OphauB2|2829
Ophiocordyceps australis map64 (Brazil) OphauB2|7152
Ophiocordyceps subramaniannii Hirsu2|10815
Ophiocordyceps subramaniannii Hirsu2|7032 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7032
MEANTVTSDENRSEMQIGRGVYTTPNLGGWDEDYGWHCAVFADAQQFEYVDKAYVPRGLFQRSREDVTPAIWDYI
SRNFPGVNPAKTLLISYIEEGPRMQMLIPFDLLNANGGGLQITVECEDSEEKLRDKIKDEVGEGAEVDYGSWRSL
SGEFSDVESDPGSEEDLRLANAE*
Coding >Hirsu2|7032
ATGGAAGCAAACACCGTCACCTCTGACGAGAACCGCTCTGAGATGCAGATAGGCAGAGGCGTCTACACCACGCCG
AACCTCGGTGGATGGGACGAGGACTACGGTTGGCACTGTGCCGTCTTCGCCGACGCACAACAGTTCGAATATGTC
GACAAGGCCTACGTTCCCCGAGGGCTGTTTCAGAGGTCGCGAGAGGACGTCACGCCGGCTATCTGGGACTACATC
TCGCGCAACTTCCCTGGCGTGAACCCCGCCAAGACTCTTCTGATTTCCTACATTGAAGAAGGCCCCAGGATGCAG
ATGCTCATCCCGTTCGACCTGCTGAACGCCAACGGCGGCGGCCTCCAAATCACCGTCGAGTGCGAAGACTCCGAG
GAGAAGCTGAGAGACAAGATCAAGGATGAAGTTGGAGAGGGCGCCGAGGTCGACTATGGTTCTTGGAGGAGCTTG
AGCGGCGAATTCAGCGATGTAGAATCGGACCCAGGGTCGGAAGAGGATTTGCGATTGGCTAATGCGGAGTGA
Transcript >Hirsu2|7032
ATGGAAGCAAACACCGTCACCTCTGACGAGAACCGCTCTGAGATGCAGATAGGCAGAGGCGTCTACACCACGCCG
AACCTCGGTGGATGGGACGAGGACTACGGTTGGCACTGTGCCGTCTTCGCCGACGCACAACAGTTCGAATATGTC
GACAAGGCCTACGTTCCCCGAGGGCTGTTTCAGAGGTCGCGAGAGGACGTCACGCCGGCTATCTGGGACTACATC
TCGCGCAACTTCCCTGGCGTGAACCCCGCCAAGACTCTTCTGATTTCCTACATTGAAGAAGGCCCCAGGATGCAG
ATGCTCATCCCGTTCGACCTGCTGAACGCCAACGGCGGCGGCCTCCAAATCACCGTCGAGTGCGAAGACTCCGAG
GAGAAGCTGAGAGACAAGATCAAGGATGAAGTTGGAGAGGGCGCCGAGGTCGACTATGGTTCTTGGAGGAGCTTG
AGCGGCGAATTCAGCGATGTAGAATCGGACCCAGGGTCGGAAGAGGATTTGCGATTGGCTAATGCGGAGTGA
Gene >Hirsu2|7032
ATGGAAGCAAACACCGTCACCTCTGACGAGAACCGCTCTGAGATGCAGATAGGCAGAGGCGTCTACACCACGCCG
AACCTCGGTGGATGGGACGAGGACTACGGTTGGTACGCGGATGGCGTCAGCTGCGGACTCCAGGACACGTACGCA
GACTGACCTTCAACAGGCACTGTGCCGTCTTCGCCGACGCACAACAGTTCGAATATGTCGACAAGGCCTACGTTC
CCCGAGGGCTGTTTCAGAGGTCGCGAGAGGACGTCACGCCGGCTATCTGGGACTACATCTCGCGCAACTTCCCTG
GCGTGAACCCCGCCAAGACTCTTCTGATTTCCTACATTGAAGAAGGCCCCAGGATGCAGATGCTCATCCCGTTCG
ACCTGCTGAACGCCAACGGCGGCGGCCTCCAAATCACCGTCGAGTGCGAAGACTCCGAGGAGAAGCTGAGAGACA
AGATCAAGGATGAAGTTGGAGAGGGCGCCGAGGTCGACTATGGTTCTTGGAGGAGCTTGAGCGGCGAATTCAGCG
ATGTAGAATCGGACCCAGGGTCGGAAGAGGAGTCGGGGGAAGAGGCGGCGGGCTGTTCCACGAATCAAAGCGAAC
GAAGCTGTAAGGGGCCGCATCTTGTAGTCCCAGTCCCCCCCCCCGTGGCAGTTTGCGATTGGCTAATGCGGAGTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail