Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7022
Gene name
LocationContig_389:17337..18171
Strand+
Gene length (bp)834
Transcript length (bp)768
Coding sequence length (bp)768
Protein length (aa) 256

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 3.8E-04 189 211
PF00096 zf-C2H2 Zinc finger, C2H2 type 7.1E-04 217 242

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTA1|YL8J_SCHPO Zinc finger protein C25B8.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.19c PE=3 SV=2 188 239 2.0E-18
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 183 242 9.0E-11
sp|Q8VDL9|GLIS2_MOUSE Zinc finger protein GLIS2 OS=Mus musculus GN=Glis2 PE=1 SV=1 185 239 1.0E-10
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 168 239 2.0E-10
sp|Q99M85|SCRT1_MOUSE Transcriptional repressor scratch 1 OS=Mus musculus GN=Scrt1 PE=1 SV=1 188 237 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTA1|YL8J_SCHPO Zinc finger protein C25B8.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.19c PE=3 SV=2 188 239 2.0E-18
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 183 242 9.0E-11
sp|Q8VDL9|GLIS2_MOUSE Zinc finger protein GLIS2 OS=Mus musculus GN=Glis2 PE=1 SV=1 185 239 1.0E-10
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 168 239 2.0E-10
sp|Q99M85|SCRT1_MOUSE Transcriptional repressor scratch 1 OS=Mus musculus GN=Scrt1 PE=1 SV=1 188 237 2.0E-10
sp|Q293Q2|SQZ_DROPS Zinc finger protein squeeze OS=Drosophila pseudoobscura pseudoobscura GN=sqz PE=3 SV=2 189 242 2.0E-10
sp|Q9VDZ3|SQZ_DROME Zinc finger protein squeeze OS=Drosophila melanogaster GN=sqz PE=1 SV=2 189 245 2.0E-10
sp|O95863|SNAI1_HUMAN Zinc finger protein SNAI1 OS=Homo sapiens GN=SNAI1 PE=1 SV=2 190 237 3.0E-10
sp|Q12145|YP013_YEAST Zinc finger protein YPR013C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR013C PE=1 SV=1 188 239 3.0E-10
sp|Q9BWW7|SCRT1_HUMAN Transcriptional repressor scratch 1 OS=Homo sapiens GN=SCRT1 PE=1 SV=1 188 237 3.0E-10
sp|Q91690|GLI1_XENLA Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis GN=gli1 PE=2 SV=2 194 245 3.0E-10
sp|Q98T94|GLIS2_XENLA Zinc finger protein GLIS2 OS=Xenopus laevis GN=glis2 PE=2 SV=1 185 239 3.0E-10
sp|Q12531|YP015_YEAST Zinc finger protein YPR015C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR015C PE=3 SV=1 188 239 4.0E-10
sp|Q96BR6|ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens GN=ZNF669 PE=2 SV=2 189 253 4.0E-10
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 189 239 4.0E-10
sp|Q8BTH6|SCRT2_MOUSE Transcriptional repressor scratch 2 OS=Mus musculus GN=Scrt2 PE=2 SV=2 188 237 5.0E-10
sp|Q03172|ZEP1_MOUSE Zinc finger protein 40 OS=Mus musculus GN=Hivep1 PE=1 SV=1 183 247 6.0E-10
sp|Q9BZE0|GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens GN=GLIS2 PE=1 SV=2 185 239 6.0E-10
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=ZNF77 PE=2 SV=2 189 239 6.0E-10
sp|P15822|ZEP1_HUMAN Zinc finger protein 40 OS=Homo sapiens GN=HIVEP1 PE=1 SV=3 183 247 7.0E-10
sp|O15391|TYY2_HUMAN Transcription factor YY2 OS=Homo sapiens GN=YY2 PE=2 SV=1 189 239 8.0E-10
sp|Q91660|GLI3_XENLA Zinc finger protein GLI3 OS=Xenopus laevis GN=gli3 PE=2 SV=1 194 245 9.0E-10
sp|Q8NAP3|ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens GN=ZBTB38 PE=1 SV=2 189 239 9.0E-10
sp|Q9NQ03|SCRT2_HUMAN Transcriptional repressor scratch 2 OS=Homo sapiens GN=SCRT2 PE=2 SV=3 188 237 9.0E-10
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 172 239 1.0E-09
sp|P55878|GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus GN=GLI1 PE=2 SV=1 192 245 1.0E-09
sp|Q61602|GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus GN=Gli3 PE=1 SV=2 194 245 1.0E-09
sp|Q9IA31|GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus GN=GLI3 PE=1 SV=1 194 245 1.0E-09
sp|Q91924|SNAI2_XENLA Zinc finger protein SNAI2 OS=Xenopus laevis GN=snai2 PE=1 SV=1 190 237 1.0E-09
sp|Q9QYE0|PLAG1_MOUSE Zinc finger protein PLAG1 OS=Mus musculus GN=Plag1 PE=2 SV=2 191 237 1.0E-09
sp|O43623|SNAI2_HUMAN Zinc finger protein SNAI2 OS=Homo sapiens GN=SNAI2 PE=1 SV=1 190 237 1.0E-09
sp|Q5U2T6|PLAG1_RAT Zinc finger protein PLAG1 OS=Rattus norvegicus GN=Plag1 PE=2 SV=1 191 237 1.0E-09
sp|Q8N8L2|ZN491_HUMAN Zinc finger protein 491 OS=Homo sapiens GN=ZNF491 PE=2 SV=1 186 239 1.0E-09
sp|P97469|SNAI2_MOUSE Zinc finger protein SNAI2 OS=Mus musculus GN=Snai2 PE=1 SV=1 190 237 1.0E-09
sp|O08954|SNAI2_RAT Zinc finger protein SNAI2 OS=Rattus norvegicus GN=Snai2 PE=2 SV=2 190 237 1.0E-09
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 192 245 1.0E-09
sp|Q5EXX3|ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus GN=Zbtb38 PE=2 SV=1 189 239 1.0E-09
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 192 245 1.0E-09
sp|P25490|TYY1_HUMAN Transcriptional repressor protein YY1 OS=Homo sapiens GN=YY1 PE=1 SV=2 189 239 1.0E-09
sp|P10071|GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens GN=GLI3 PE=1 SV=6 192 245 2.0E-09
sp|Q00899|TYY1_MOUSE Transcriptional repressor protein YY1 OS=Mus musculus GN=Yy1 PE=1 SV=1 189 239 2.0E-09
sp|Q6XP49|GLIS3_MOUSE Zinc finger protein GLIS3 OS=Mus musculus GN=Glis3 PE=1 SV=2 192 239 2.0E-09
sp|Q5IS56|GLI3_PANTR Transcriptional activator GLI3 OS=Pan troglodytes GN=GLI3 PE=2 SV=1 192 245 2.0E-09
sp|Q5T0B9|ZN362_HUMAN Zinc finger protein 362 OS=Homo sapiens GN=ZNF362 PE=1 SV=1 189 239 2.0E-09
sp|P17842|TF3A_XENBO Transcription factor IIIA OS=Xenopus borealis GN=gtf3a PE=2 SV=1 189 239 2.0E-09
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 186 239 2.0E-09
sp|P22227|ZFP42_MOUSE Zinc finger protein 42 OS=Mus musculus GN=Zfp42 PE=1 SV=1 188 239 2.0E-09
sp|Q02085|SNAI1_MOUSE Zinc finger protein SNAI1 OS=Mus musculus GN=Snai1 PE=1 SV=1 190 237 2.0E-09
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 192 239 2.0E-09
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 189 239 2.0E-09
sp|Q9VI93|RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster GN=rn PE=1 SV=2 189 245 2.0E-09
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 189 239 2.0E-09
sp|Q8NEA6|GLIS3_HUMAN Zinc finger protein GLIS3 OS=Homo sapiens GN=GLIS3 PE=2 SV=5 192 239 2.0E-09
sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 184 245 2.0E-09
sp|Q8K1M4|GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus GN=Glis1 PE=2 SV=2 187 239 2.0E-09
sp|Q8NBF1|GLIS1_HUMAN Zinc finger protein GLIS1 OS=Homo sapiens GN=GLIS1 PE=2 SV=2 187 239 2.0E-09
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 189 239 2.0E-09
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 189 245 2.0E-09
sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 194 245 2.0E-09
sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 184 245 2.0E-09
sp|Q8BKX7|ZN410_MOUSE Zinc finger protein 410 OS=Mus musculus GN=Znf410 PE=2 SV=2 145 239 2.0E-09
sp|Q8I7Z8|HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster GN=ham PE=2 SV=1 184 245 2.0E-09
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 189 245 2.0E-09
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 145 239 3.0E-09
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 189 239 3.0E-09
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 189 239 3.0E-09
sp|Q86VK4|ZN410_HUMAN Zinc finger protein 410 OS=Homo sapiens GN=ZNF410 PE=1 SV=2 145 239 3.0E-09
sp|Q8ST83|PHO_DROME Polycomb protein PHO OS=Drosophila melanogaster GN=pho PE=1 SV=2 189 239 3.0E-09
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 189 239 3.0E-09
sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 OS=Homo sapiens GN=MECOM PE=1 SV=2 184 245 3.0E-09
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 189 239 3.0E-09
sp|P14404|EVI1_MOUSE MDS1 and EVI1 complex locus protein EVI1 OS=Mus musculus GN=Mecom PE=1 SV=1 184 245 3.0E-09
sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis GN=gli4 PE=2 SV=1 194 245 3.0E-09
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 191 239 3.0E-09
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 191 255 3.0E-09
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 186 239 3.0E-09
sp|Q9ULD5|ZN777_HUMAN Zinc finger protein 777 OS=Homo sapiens GN=ZNF777 PE=1 SV=2 189 245 3.0E-09
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 191 239 3.0E-09
sp|B7ZRU9|EVI1A_XENLA MDS1 and EVI1 complex locus protein EVI1-A OS=Xenopus laevis GN=mecom-a PE=1 SV=1 184 245 4.0E-09
sp|Q9ER74|SALL1_MOUSE Sal-like protein 1 OS=Mus musculus GN=Sall1 PE=1 SV=1 188 250 4.0E-09
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 179 239 4.0E-09
sp|Q9NSC2|SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens GN=SALL1 PE=1 SV=2 188 250 4.0E-09
sp|Q6DJT9|PLAG1_HUMAN Zinc finger protein PLAG1 OS=Homo sapiens GN=PLAG1 PE=1 SV=1 191 237 5.0E-09
sp|Q8TBZ8|ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens GN=ZNF564 PE=1 SV=1 189 239 5.0E-09
sp|B7ZRM8|EVI1B_XENLA MDS1 and EVI1 complex locus protein EVI1-B OS=Xenopus laevis GN=mecom-b PE=2 SV=1 186 245 5.0E-09
sp|Q62255|SALL3_MOUSE Sal-like protein 3 OS=Mus musculus GN=Sall3 PE=1 SV=2 191 250 5.0E-09
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 194 239 5.0E-09
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 185 239 5.0E-09
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 189 239 5.0E-09
sp|Q9BXA9|SALL3_HUMAN Sal-like protein 3 OS=Homo sapiens GN=SALL3 PE=1 SV=2 191 250 5.0E-09
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 183 239 6.0E-09
sp|Q8TBZ8|ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens GN=ZNF564 PE=1 SV=1 189 239 6.0E-09
sp|Q96MM3|ZFP42_HUMAN Zinc finger protein 42 homolog OS=Homo sapiens GN=ZFP42 PE=1 SV=2 189 239 6.0E-09
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 189 240 6.0E-09
sp|Q7K0S9|GLIS2_DROME Zinc finger protein GLIS2 homolog OS=Drosophila melanogaster GN=sug PE=2 SV=1 191 245 6.0E-09
sp|P19382|SNAI1_XENLA Protein snail homolog Sna OS=Xenopus laevis GN=snai1 PE=1 SV=1 190 237 7.0E-09
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 189 239 7.0E-09
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 189 239 7.0E-09
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 189 239 7.0E-09
sp|P03001|TF3A_XENLA Transcription factor IIIA OS=Xenopus laevis GN=gtf3a PE=1 SV=2 189 239 7.0E-09
sp|Q58NQ5|PLAG1_CHICK Zinc finger protein PLAG1 OS=Gallus gallus GN=PLAG1 PE=2 SV=1 191 237 7.0E-09
sp|A8MWA4|Z705E_HUMAN Putative zinc finger protein 705E OS=Homo sapiens GN=ZNF705E PE=3 SV=1 189 239 8.0E-09
sp|Q5VV52|ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens GN=ZNF691 PE=1 SV=1 189 239 8.0E-09
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 189 239 8.0E-09
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 189 239 8.0E-09
sp|A2A884|ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus GN=Hivep3 PE=1 SV=1 183 253 8.0E-09
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 189 239 8.0E-09
sp|Q2FAY8|TYY2_RATRT Transcription factor YY2 OS=Rattus rattus GN=Yy2 PE=3 SV=1 189 239 9.0E-09
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 189 239 9.0E-09
sp|Q5T1R4|ZEP3_HUMAN Transcription factor HIVEP3 OS=Homo sapiens GN=HIVEP3 PE=2 SV=1 183 247 9.0E-09
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 189 239 9.0E-09
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 179 239 9.0E-09
sp|P0C6P6|TYY2_RAT Transcription factor YY2 OS=Rattus norvegicus GN=Yy2 PE=3 SV=1 189 239 9.0E-09
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 176 237 9.0E-09
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 189 239 1.0E-08
sp|Q9UJQ4|SALL4_HUMAN Sal-like protein 4 OS=Homo sapiens GN=SALL4 PE=1 SV=1 146 237 1.0E-08
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 189 239 1.0E-08
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 189 239 1.0E-08
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 189 239 1.0E-08
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 184 239 1.0E-08
sp|Q3TTC2|TYY2_MOUSE Transcription factor YY2 OS=Mus musculus GN=Yy2 PE=2 SV=1 189 239 1.0E-08
sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 177 239 1.0E-08
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 145 239 1.0E-08
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 179 239 1.0E-08
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 189 239 1.0E-08
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 189 239 1.0E-08
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 189 237 1.0E-08
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 186 239 1.0E-08
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 189 239 1.0E-08
sp|A6NP11|ZN716_HUMAN Zinc finger protein 716 OS=Homo sapiens GN=ZNF716 PE=2 SV=4 189 238 1.0E-08
sp|A8MVS1|Z705F_HUMAN Zinc finger protein 705F OS=Homo sapiens GN=ZNF705F PE=3 SV=1 189 239 1.0E-08
sp|P0CH99|Z705D_HUMAN Zinc finger protein 705D OS=Homo sapiens GN=ZNF705D PE=2 SV=1 189 239 1.0E-08
sp|P0CI00|Z705B_HUMAN Putative zinc finger protein 705B OS=Homo sapiens GN=ZNF705B PE=5 SV=1 189 239 1.0E-08
sp|Q6ZN79|Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens GN=ZNF705A PE=2 SV=1 189 239 1.0E-08
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 189 239 1.0E-08
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 189 239 1.0E-08
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 189 239 1.0E-08
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 189 243 1.0E-08
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 189 239 1.0E-08
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 184 239 1.0E-08
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 173 239 1.0E-08
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 192 245 1.0E-08
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 189 238 1.0E-08
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 189 239 1.0E-08
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 189 239 2.0E-08
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 189 239 2.0E-08
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 189 239 2.0E-08
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 189 239 2.0E-08
sp|A6NP11|ZN716_HUMAN Zinc finger protein 716 OS=Homo sapiens GN=ZNF716 PE=2 SV=4 189 238 2.0E-08
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 189 241 2.0E-08
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 185 239 2.0E-08
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 186 239 2.0E-08
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 186 239 2.0E-08
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 189 239 2.0E-08
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 189 239 2.0E-08
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 189 243 2.0E-08
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 189 239 2.0E-08
sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 194 237 2.0E-08
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 189 239 2.0E-08
sp|Q3MHQ4|SNAI2_BOVIN Zinc finger protein SNAI2 OS=Bos taurus GN=SNAI2 PE=2 SV=1 190 237 2.0E-08
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 189 239 2.0E-08
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 189 237 2.0E-08
sp|Q96N95|ZN396_HUMAN Zinc finger protein 396 OS=Homo sapiens GN=ZNF396 PE=1 SV=2 189 239 2.0E-08
sp|Q2VY69|ZN284_HUMAN Zinc finger protein 284 OS=Homo sapiens GN=ZNF284 PE=2 SV=1 186 237 2.0E-08
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 189 239 2.0E-08
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 189 239 2.0E-08
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 189 237 2.0E-08
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 186 239 2.0E-08
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 189 249 2.0E-08
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 186 239 2.0E-08
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 189 239 2.0E-08
sp|Q0VDT2|ZN367_MOUSE Zinc finger protein 367 OS=Mus musculus GN=Znf367 PE=1 SV=2 188 239 2.0E-08
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 186 239 2.0E-08
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 186 239 2.0E-08
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 189 238 2.0E-08
sp|Q9EQJ4|ZN384_RAT Zinc finger protein 384 OS=Rattus norvegicus GN=Znf384 PE=1 SV=1 189 239 2.0E-08
sp|Q8TF68|ZN384_HUMAN Zinc finger protein 384 OS=Homo sapiens GN=ZNF384 PE=1 SV=2 189 239 2.0E-08
sp|Q5U2Z0|ZN367_RAT Zinc finger protein 367 OS=Rattus norvegicus GN=Znf367 PE=2 SV=1 188 239 2.0E-08
sp|Q9QY31|SNAI3_MOUSE Zinc finger protein SNAI3 OS=Mus musculus GN=Snai3 PE=2 SV=1 190 237 2.0E-08
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 189 240 3.0E-08
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 189 239 3.0E-08
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 189 239 3.0E-08
sp|Q8NDQ6|ZN540_HUMAN Zinc finger protein 540 OS=Homo sapiens GN=ZNF540 PE=1 SV=1 189 239 3.0E-08
sp|Q5R5S6|ZN540_PONAB Zinc finger protein 540 OS=Pongo abelii GN=ZNF540 PE=2 SV=1 189 239 3.0E-08
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 189 239 3.0E-08
sp|Q2VY69|ZN284_HUMAN Zinc finger protein 284 OS=Homo sapiens GN=ZNF284 PE=2 SV=1 189 237 3.0E-08
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 189 238 3.0E-08
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 189 255 3.0E-08
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 186 239 3.0E-08
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 194 239 3.0E-08
sp|Q5JPB2|ZN831_HUMAN Zinc finger protein 831 OS=Homo sapiens GN=ZNF831 PE=2 SV=4 174 239 3.0E-08
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 189 239 3.0E-08
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 194 239 3.0E-08
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 189 255 3.0E-08
sp|Q567C6|ZN367_DANRE Zinc finger protein 367 OS=Danio rerio GN=znf367 PE=2 SV=1 188 239 3.0E-08
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 189 239 3.0E-08
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 189 239 3.0E-08
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 189 239 3.0E-08
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 189 239 3.0E-08
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 189 239 3.0E-08
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 189 239 3.0E-08
sp|P17031|ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens GN=ZNF26 PE=1 SV=3 189 239 3.0E-08
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 189 239 3.0E-08
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 189 239 3.0E-08
sp|Q8N883|ZN614_HUMAN Zinc finger protein 614 OS=Homo sapiens GN=ZNF614 PE=1 SV=2 189 243 3.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 239 3.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 239 3.0E-08
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 189 238 3.0E-08
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 189 239 4.0E-08
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 191 239 4.0E-08
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 189 239 4.0E-08
sp|Q95K49|ZN614_MACFA Zinc finger protein 614 OS=Macaca fascicularis GN=ZNF614 PE=2 SV=1 189 243 4.0E-08
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 189 239 4.0E-08
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 189 239 4.0E-08
sp|P16415|ZN823_HUMAN Zinc finger protein 823 OS=Homo sapiens GN=ZNF823 PE=2 SV=2 189 239 4.0E-08
sp|Q9Y467|SALL2_HUMAN Sal-like protein 2 OS=Homo sapiens GN=SALL2 PE=1 SV=4 156 237 4.0E-08
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 189 239 4.0E-08
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 189 238 4.0E-08
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 189 239 4.0E-08
sp|P19538|CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster GN=ci PE=1 SV=2 194 245 4.0E-08
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 189 238 4.0E-08
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 173 239 4.0E-08
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 189 239 4.0E-08
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 191 239 4.0E-08
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 189 239 5.0E-08
sp|Q9BYN7|ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens GN=ZNF341 PE=1 SV=2 180 237 5.0E-08
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 189 239 5.0E-08
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 189 239 5.0E-08
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 189 239 5.0E-08
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 189 239 5.0E-08
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 189 239 5.0E-08
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 182 237 5.0E-08
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 186 245 5.0E-08
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 189 239 5.0E-08
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 189 239 5.0E-08
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 189 239 5.0E-08
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 189 239 5.0E-08
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 189 239 5.0E-08
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 189 239 5.0E-08
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 189 239 5.0E-08
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 189 239 5.0E-08
sp|Q7RTV3|ZN367_HUMAN Zinc finger protein 367 OS=Homo sapiens GN=ZNF367 PE=1 SV=1 188 239 5.0E-08
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 189 238 5.0E-08
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 189 239 5.0E-08
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 189 239 5.0E-08
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 189 239 5.0E-08
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 189 239 5.0E-08
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 1 239 5.0E-08
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 189 239 6.0E-08
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 189 239 6.0E-08
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 186 237 6.0E-08
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 189 239 6.0E-08
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 189 239 6.0E-08
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 189 239 6.0E-08
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 189 239 6.0E-08
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 189 239 6.0E-08
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 189 239 6.0E-08
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 189 255 6.0E-08
sp|Q0VDQ9|FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus GN=Fezf1 PE=2 SV=1 186 255 6.0E-08
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 189 239 6.0E-08
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 189 239 6.0E-08
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 189 239 6.0E-08
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 186 239 6.0E-08
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 189 243 6.0E-08
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 189 239 6.0E-08
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 189 239 6.0E-08
sp|Q8IYI8|ZN440_HUMAN Zinc finger protein 440 OS=Homo sapiens GN=ZNF440 PE=1 SV=1 189 239 6.0E-08
sp|Q03938|ZNF90_HUMAN Zinc finger protein 90 OS=Homo sapiens GN=ZNF90 PE=2 SV=3 189 239 6.0E-08
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 189 239 6.0E-08
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 189 239 6.0E-08
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 189 239 6.0E-08
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 189 239 6.0E-08
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 189 239 6.0E-08
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 186 239 6.0E-08
sp|P59923|ZN445_HUMAN Zinc finger protein 445 OS=Homo sapiens GN=ZNF445 PE=1 SV=1 189 239 6.0E-08
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 181 243 6.0E-08
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN=ZNF197 PE=2 SV=1 189 245 6.0E-08
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 189 239 7.0E-08
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 186 238 7.0E-08
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 191 238 7.0E-08
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 194 243 7.0E-08
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 186 239 7.0E-08
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 189 239 7.0E-08
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 189 239 7.0E-08
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 189 237 7.0E-08
sp|O77027|CI_DROYA Protein cubitus interruptus (Fragment) OS=Drosophila yakuba GN=ci PE=3 SV=1 194 245 7.0E-08
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 186 238 7.0E-08
sp|Q5A4K7|TRY5_CANAL Transcriptional regulator of yeast form adherence 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY5 PE=3 SV=1 186 242 7.0E-08
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 189 239 7.0E-08
sp|Q8BX22|SALL4_MOUSE Sal-like protein 4 OS=Mus musculus GN=Sall4 PE=1 SV=2 188 237 7.0E-08
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 189 239 7.0E-08
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 189 239 7.0E-08
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 173 239 7.0E-08
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 189 239 7.0E-08
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 186 251 7.0E-08
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 189 239 8.0E-08
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 186 238 8.0E-08
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 189 239 8.0E-08
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 189 239 8.0E-08
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 189 239 8.0E-08
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 189 239 8.0E-08
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 189 237 8.0E-08
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 186 239 8.0E-08
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 189 239 8.0E-08
sp|Q5A4H5|CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ1 PE=1 SV=1 189 245 8.0E-08
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 189 239 8.0E-08
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 186 239 8.0E-08
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 189 239 8.0E-08
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 189 239 8.0E-08
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 189 239 8.0E-08
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 189 239 8.0E-08
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 189 239 8.0E-08
sp|Q8N7K0|ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens GN=ZNF433 PE=1 SV=1 189 239 8.0E-08
sp|Q6ZQV5|ZN788_HUMAN Zinc finger protein 788 OS=Homo sapiens GN=ZNF788 PE=2 SV=2 187 239 8.0E-08
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 189 238 8.0E-08
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 189 240 8.0E-08
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 189 239 9.0E-08
sp|Q8N883|ZN614_HUMAN Zinc finger protein 614 OS=Homo sapiens GN=ZNF614 PE=1 SV=2 189 239 9.0E-08
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 173 239 9.0E-08
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 185 239 9.0E-08
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 173 239 9.0E-08
sp|Q8N7K0|ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens GN=ZNF433 PE=1 SV=1 189 239 9.0E-08
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 189 238 9.0E-08
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 189 239 9.0E-08
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 189 239 9.0E-08
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 189 239 9.0E-08
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 189 239 9.0E-08
sp|Q8BZ89|ZN322_MOUSE Zinc finger protein 322 OS=Mus musculus GN=Znf322 PE=2 SV=1 189 239 9.0E-08
sp|Q9H7R0|ZN442_HUMAN Zinc finger protein 442 OS=Homo sapiens GN=ZNF442 PE=2 SV=1 189 239 9.0E-08
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 189 239 9.0E-08
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 189 239 1.0E-07
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 189 239 1.0E-07
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 189 239 1.0E-07
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 189 239 1.0E-07
sp|Q8TBZ8|ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens GN=ZNF564 PE=1 SV=1 189 237 1.0E-07
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 189 239 1.0E-07
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 189 239 1.0E-07
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 189 239 1.0E-07
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 189 239 1.0E-07
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 189 239 1.0E-07
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 189 239 1.0E-07
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 179 239 1.0E-07
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 189 239 1.0E-07
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 189 239 1.0E-07
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 191 238 1.0E-07
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 189 255 1.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 239 1.0E-07
sp|Q95K49|ZN614_MACFA Zinc finger protein 614 OS=Macaca fascicularis GN=ZNF614 PE=2 SV=1 189 239 1.0E-07
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 189 239 1.0E-07
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 189 238 1.0E-07
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 189 238 1.0E-07
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 189 239 1.0E-07
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 164 239 1.0E-07
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 189 239 1.0E-07
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 189 239 1.0E-07
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 189 240 1.0E-07
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 186 239 1.0E-07
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 189 240 1.0E-07
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 186 239 1.0E-07
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 189 239 1.0E-07
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 189 237 1.0E-07
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 189 240 1.0E-07
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 189 239 1.0E-07
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 189 239 1.0E-07
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 189 237 1.0E-07
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 189 239 1.0E-07
sp|Q5RCJ2|ZN614_PONAB Zinc finger protein 614 OS=Pongo abelii GN=ZNF614 PE=2 SV=1 189 239 1.0E-07
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 186 239 1.0E-07
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 189 239 1.0E-07
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 189 239 1.0E-07
sp|Q91VN1|ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus GN=Znf24 PE=1 SV=1 189 239 1.0E-07
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 189 239 1.0E-07
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 189 239 1.0E-07
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 189 237 1.0E-07
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 189 239 1.0E-07
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 192 245 1.0E-07
sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 194 237 1.0E-07
sp|P46974|RSF2_YEAST Respiration factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSF2 PE=1 SV=1 189 249 1.0E-07
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 191 240 1.0E-07
sp|Q92010|ZBT14_CHICK Zinc finger and BTB domain-containing protein 14 OS=Gallus gallus GN=ZBTB14 PE=2 SV=1 189 243 1.0E-07
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 189 239 1.0E-07
sp|Q7TNK3|ZNF24_RAT Zinc finger protein 24 OS=Rattus norvegicus GN=Znf24 PE=2 SV=1 189 239 1.0E-07
sp|A1YGJ4|ZNF24_PANPA Zinc finger protein 24 OS=Pan paniscus GN=ZNF24 PE=3 SV=1 189 239 1.0E-07
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 191 239 1.0E-07
sp|Q9H4T2|ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens GN=ZSCAN16 PE=1 SV=2 159 239 1.0E-07
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 189 239 1.0E-07
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 189 239 1.0E-07
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 191 239 1.0E-07
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 191 239 1.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 173 239 1.0E-07
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 191 239 1.0E-07
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 189 239 1.0E-07
sp|Q810A1|ZNF18_MOUSE Zinc finger protein 18 OS=Mus musculus GN=Znf18 PE=2 SV=1 191 239 1.0E-07
sp|A2T7D7|ZNF24_PANTR Zinc finger protein 24 OS=Pan troglodytes GN=ZNF24 PE=3 SV=1 189 239 1.0E-07
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 189 239 1.0E-07
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 194 237 1.0E-07
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 189 239 1.0E-07
sp|Q5RAE6|ZNF24_PONAB Zinc finger protein 24 OS=Pongo abelii GN=ZNF24 PE=2 SV=1 189 239 1.0E-07
sp|O43829|ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens GN=ZBTB14 PE=1 SV=2 189 243 1.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 189 238 1.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 189 238 1.0E-07
sp|P17028|ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens GN=ZNF24 PE=1 SV=4 189 239 1.0E-07
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 186 238 1.0E-07
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 189 253 1.0E-07
sp|Q9IB89|ZIC5_XENLA Zinc finger protein ZIC 5 OS=Xenopus laevis GN=zic5 PE=2 SV=1 194 237 1.0E-07
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 189 239 1.0E-07
sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 194 237 1.0E-07
sp|Q8N141|ZFP82_HUMAN Zinc finger protein 82 homolog OS=Homo sapiens GN=ZFP82 PE=2 SV=1 187 239 1.0E-07
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 189 239 1.0E-07
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 191 239 1.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 189 239 1.0E-07
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 186 239 1.0E-07
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 189 239 1.0E-07
sp|Q642B9|ZNF18_RAT Zinc finger protein 18 OS=Rattus norvegicus GN=Znf18 PE=2 SV=1 191 239 1.0E-07
sp|P53035|MIG2_YEAST Regulatory protein MIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG2 PE=1 SV=1 176 239 1.0E-07
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 194 237 1.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 191 240 1.0E-07
sp|P25932|ESCA_DROME Protein escargot OS=Drosophila melanogaster GN=esg PE=1 SV=2 191 237 1.0E-07
sp|Q5RE50|ZN215_PONAB Zinc finger protein 215 OS=Pongo abelii GN=ZNF215 PE=2 SV=1 189 239 1.0E-07
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 189 239 1.0E-07
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 189 239 1.0E-07
sp|Q4R7X8|ZN322_MACFA Zinc finger protein 322 OS=Macaca fascicularis GN=ZNF322 PE=2 SV=1 189 239 1.0E-07
sp|A6QPT6|ZN274_BOVIN Neurotrophin receptor-interacting factor homolog OS=Bos taurus GN=ZNF274 PE=2 SV=1 189 239 1.0E-07
sp|P0CG00|ZSA5D_HUMAN Putative zinc finger and SCAN domain-containing protein 5D OS=Homo sapiens GN=ZSCAN5D PE=5 SV=1 189 238 1.0E-07
sp|P15621|ZNF44_HUMAN Zinc finger protein 44 OS=Homo sapiens GN=ZNF44 PE=2 SV=3 189 239 1.0E-07
sp|Q9UK13|ZN221_HUMAN Zinc finger protein 221 OS=Homo sapiens GN=ZNF221 PE=2 SV=3 189 237 1.0E-07
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 189 239 1.0E-07
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 194 239 1.0E-07
sp|Q08376|ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus GN=Zbtb14 PE=2 SV=1 189 243 1.0E-07
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 189 239 1.0E-07
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 189 239 1.0E-07
sp|Q3KNW1|SNAI3_HUMAN Zinc finger protein SNAI3 OS=Homo sapiens GN=SNAI3 PE=2 SV=1 191 237 1.0E-07
sp|Q96I27|ZN625_HUMAN Zinc finger protein 625 OS=Homo sapiens GN=ZNF625 PE=1 SV=1 189 239 1.0E-07
sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 194 237 1.0E-07
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 189 240 1.0E-07
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 194 239 1.0E-07
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 191 238 1.0E-07
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 177 239 1.0E-07
sp|Q6U7Q0|ZN322_HUMAN Zinc finger protein 322 OS=Homo sapiens GN=ZNF322 PE=1 SV=2 189 239 1.0E-07
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 189 239 2.0E-07
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=ZNF77 PE=2 SV=2 189 239 2.0E-07
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 189 239 2.0E-07
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 189 239 2.0E-07
sp|Q9ER74|SALL1_MOUSE Sal-like protein 1 OS=Mus musculus GN=Sall1 PE=1 SV=1 188 237 2.0E-07
sp|Q8TBZ8|ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens GN=ZNF564 PE=1 SV=1 189 239 2.0E-07
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 189 239 2.0E-07
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 189 239 2.0E-07
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 189 239 2.0E-07
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 189 238 2.0E-07
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 189 239 2.0E-07
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 189 239 2.0E-07
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 189 239 2.0E-07
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 189 239 2.0E-07
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 189 239 2.0E-07
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 189 239 2.0E-07
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 186 239 2.0E-07
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 189 239 2.0E-07
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 189 239 2.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 189 239 2.0E-07
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 189 239 2.0E-07
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 189 239 2.0E-07
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 189 239 2.0E-07
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 188 239 2.0E-07
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 189 238 2.0E-07
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 189 239 2.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 189 245 2.0E-07
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 189 239 2.0E-07
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 189 239 2.0E-07
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 189 245 2.0E-07
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 138 239 2.0E-07
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 189 239 2.0E-07
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 189 239 2.0E-07
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 188 239 2.0E-07
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 189 239 2.0E-07
sp|Q8N7K0|ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens GN=ZNF433 PE=1 SV=1 189 239 2.0E-07
sp|Q8N7K0|ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens GN=ZNF433 PE=1 SV=1 191 239 2.0E-07
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 183 255 2.0E-07
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 173 239 2.0E-07
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 189 239 2.0E-07
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 189 239 2.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 189 239 2.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 189 253 2.0E-07
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 189 239 2.0E-07
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 161 239 2.0E-07
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 191 239 2.0E-07
sp|Q8NDP4|ZN439_HUMAN Zinc finger protein 439 OS=Homo sapiens GN=ZNF439 PE=1 SV=1 189 239 2.0E-07
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 189 238 2.0E-07
sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 194 237 2.0E-07
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 186 239 2.0E-07
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 189 239 2.0E-07
sp|Q5AMH6|CAS5_CANAL Cell wall integrity transcriptional regulator CAS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAS5 PE=3 SV=1 188 247 2.0E-07
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 189 239 2.0E-07
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 189 239 2.0E-07
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 189 237 2.0E-07
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 189 243 2.0E-07
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 194 237 2.0E-07
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 194 237 2.0E-07
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 189 239 2.0E-07
sp|Q9UL58|ZN215_HUMAN Zinc finger protein 215 OS=Homo sapiens GN=ZNF215 PE=2 SV=2 189 239 2.0E-07
sp|Q9UL58|ZN215_HUMAN Zinc finger protein 215 OS=Homo sapiens GN=ZNF215 PE=2 SV=2 189 239 2.0E-07
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 189 239 2.0E-07
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 189 239 2.0E-07
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 189 239 2.0E-07
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 189 239 2.0E-07
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 189 239 2.0E-07
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 186 239 2.0E-07
sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 190 239 2.0E-07
sp|Q8TAF7|ZN461_HUMAN Zinc finger protein 461 OS=Homo sapiens GN=ZNF461 PE=2 SV=2 186 239 2.0E-07
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 189 239 2.0E-07
sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 190 239 2.0E-07
sp|P08044|SNAI_DROME Protein snail OS=Drosophila melanogaster GN=sna PE=1 SV=2 191 239 2.0E-07
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 189 239 2.0E-07
sp|O60765|Z354A_HUMAN Zinc finger protein 354A OS=Homo sapiens GN=ZNF354A PE=2 SV=2 189 239 2.0E-07
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 189 239 2.0E-07
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 189 238 2.0E-07
sp|Q8TF39|ZN483_HUMAN Zinc finger protein 483 OS=Homo sapiens GN=ZNF483 PE=1 SV=3 189 239 2.0E-07
sp|Q8TA94|ZN563_HUMAN Zinc finger protein 563 OS=Homo sapiens GN=ZNF563 PE=2 SV=1 189 239 2.0E-07
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 189 239 2.0E-07
sp|Q96LW1|Z354B_HUMAN Zinc finger protein 354B OS=Homo sapiens GN=ZNF354B PE=2 SV=1 186 239 2.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 173 239 2.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 189 239 2.0E-07
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 189 239 2.0E-07
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 186 239 2.0E-07
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 177 239 2.0E-07
sp|Q9QX96|SALL2_MOUSE Sal-like protein 2 OS=Mus musculus GN=Sall2 PE=1 SV=2 188 237 2.0E-07
sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis GN=zic4 PE=2 SV=1 194 237 2.0E-07
sp|Q68EA5|ZNF57_HUMAN Zinc finger protein 57 OS=Homo sapiens GN=ZNF57 PE=2 SV=3 186 239 2.0E-07
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 189 245 2.0E-07
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 189 239 2.0E-07
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 189 239 2.0E-07
sp|O57311|ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis GN=zic3 PE=2 SV=3 194 237 2.0E-07
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 189 239 2.0E-07
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 191 238 2.0E-07
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 177 239 2.0E-07
sp|Q6DJQ6|ZIC3_XENTR Zinc finger protein ZIC 3 OS=Xenopus tropicalis GN=zic3 PE=2 SV=1 194 237 2.0E-07
sp|Q4V8R6|E4F1_DANRE Transcription factor E4F1 OS=Danio rerio GN=e4f1 PE=2 SV=1 166 241 2.0E-07
sp|Q17308|TRA1_CAEBR Sex-determining transformer protein 1 OS=Caenorhabditis briggsae GN=tra-1 PE=1 SV=1 194 243 2.0E-07
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 189 239 3.0E-07
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 189 240 3.0E-07
sp|Q9NSC2|SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens GN=SALL1 PE=1 SV=2 188 237 3.0E-07
sp|Q62255|SALL3_MOUSE Sal-like protein 3 OS=Mus musculus GN=Sall3 PE=1 SV=2 188 237 3.0E-07
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 189 239 3.0E-07
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 194 246 3.0E-07
sp|Q9BXA9|SALL3_HUMAN Sal-like protein 3 OS=Homo sapiens GN=SALL3 PE=1 SV=2 188 237 3.0E-07
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 189 239 3.0E-07
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 188 239 3.0E-07
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 189 239 3.0E-07
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 189 239 3.0E-07
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 189 239 3.0E-07
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 189 239 3.0E-07
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 189 239 3.0E-07
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 189 240 3.0E-07
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 189 239 3.0E-07
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 189 239 3.0E-07
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 189 239 3.0E-07
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 189 239 3.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 238 3.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 189 238 3.0E-07
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 189 239 3.0E-07
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 189 239 3.0E-07
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 189 239 3.0E-07
sp|Q8BX22|SALL4_MOUSE Sal-like protein 4 OS=Mus musculus GN=Sall4 PE=1 SV=2 160 237 3.0E-07
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 189 239 3.0E-07
sp|Q95K52|ZN283_MACFA Zinc finger protein 283 OS=Macaca fascicularis GN=ZNF283 PE=2 SV=1 189 239 3.0E-07
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 189 239 3.0E-07
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 189 239 3.0E-07
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 189 239 3.0E-07
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 191 239 3.0E-07
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 189 239 3.0E-07
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 189 239 3.0E-07
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 189 239 3.0E-07
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 189 239 3.0E-07
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 189 239 3.0E-07
sp|Q91VN1|ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus GN=Znf24 PE=1 SV=1 189 239 3.0E-07
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 189 238 3.0E-07
sp|Q7TNK3|ZNF24_RAT Zinc finger protein 24 OS=Rattus norvegicus GN=Znf24 PE=2 SV=1 189 239 3.0E-07
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 189 239 3.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 189 239 3.0E-07
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 189 239 3.0E-07
sp|Q5RAE6|ZNF24_PONAB Zinc finger protein 24 OS=Pongo abelii GN=ZNF24 PE=2 SV=1 189 239 3.0E-07
sp|P17028|ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens GN=ZNF24 PE=1 SV=4 189 239 3.0E-07
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 189 239 3.0E-07
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 173 239 3.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 189 239 3.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 186 239 3.0E-07
sp|Q5RE50|ZN215_PONAB Zinc finger protein 215 OS=Pongo abelii GN=ZNF215 PE=2 SV=1 189 239 3.0E-07
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 189 239 3.0E-07
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 189 239 3.0E-07
sp|P15621|ZNF44_HUMAN Zinc finger protein 44 OS=Homo sapiens GN=ZNF44 PE=2 SV=3 189 239 3.0E-07
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 189 239 3.0E-07
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 189 240 3.0E-07
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 189 239 3.0E-07
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 189 239 3.0E-07
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 189 239 3.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 189 239 3.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 189 238 3.0E-07
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 189 239 3.0E-07
sp|Q9UIE0|ZN230_HUMAN Zinc finger protein 230 OS=Homo sapiens GN=ZNF230 PE=1 SV=3 189 237 3.0E-07
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 189 239 3.0E-07
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 189 239 3.0E-07
sp|Q25C93|FEZF1_DANRE Fez family zinc finger protein 1 OS=Danio rerio GN=fezf1 PE=2 SV=1 186 247 3.0E-07
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 185 239 3.0E-07
sp|Q9VH70|TOPI_DROME Testis-specific zinc finger protein topi OS=Drosophila melanogaster GN=topi PE=1 SV=1 175 245 3.0E-07
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 189 239 3.0E-07
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 189 239 3.0E-07
sp|P98182|ZN200_HUMAN Zinc finger protein 200 OS=Homo sapiens GN=ZNF200 PE=2 SV=2 189 239 3.0E-07
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 177 239 3.0E-07
sp|P39770|SALM_DROME Homeotic protein spalt-major OS=Drosophila melanogaster GN=salm PE=1 SV=3 101 237 3.0E-07
sp|O43361|ZN749_HUMAN Zinc finger protein 749 OS=Homo sapiens GN=ZNF749 PE=1 SV=2 173 239 3.0E-07
sp|Q8NAM6|ZSCA4_HUMAN Zinc finger and SCAN domain-containing protein 4 OS=Homo sapiens GN=ZSCAN4 PE=2 SV=1 184 239 3.0E-07
sp|P53968|CRZ1_YEAST Transcriptional regulator CRZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRZ1 PE=1 SV=1 189 238 3.0E-07
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 189 238 3.0E-07
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 189 238 3.0E-07
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 189 253 3.0E-07
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 189 238 3.0E-07
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 186 239 3.0E-07
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 189 238 3.0E-07
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 189 239 3.0E-07
sp|Q00900|ZEP2_RAT Human immunodeficiency virus type I enhancer-binding protein 2 homolog OS=Rattus norvegicus GN=Hivep2 PE=1 SV=2 189 247 3.0E-07
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 189 239 3.0E-07
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 189 239 3.0E-07
sp|Q3UHF7|ZEP2_MOUSE Transcription factor HIVEP2 OS=Mus musculus GN=Hivep2 PE=1 SV=1 189 247 3.0E-07
sp|A1YFX5|ZSCA4_PANPA Zinc finger and SCAN domain-containing protein 4 OS=Pan paniscus GN=ZSCAN4 PE=3 SV=1 184 239 3.0E-07
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 189 239 3.0E-07
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 189 239 3.0E-07
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 189 240 3.0E-07
sp|Q96GE5|ZN799_HUMAN Zinc finger protein 799 OS=Homo sapiens GN=ZNF799 PE=2 SV=4 189 239 3.0E-07
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 189 239 3.0E-07
sp|Q59U10|BCR1_CANAL Biofilm and cell wall regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BCR1 PE=1 SV=1 194 246 3.0E-07
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 189 255 3.0E-07
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 189 239 3.0E-07
sp|P17024|ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens GN=ZNF20 PE=1 SV=2 189 239 3.0E-07
sp|Q9Y2A4|ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens GN=ZNF443 PE=2 SV=2 189 238 3.0E-07
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 189 239 3.0E-07
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 189 237 3.0E-07
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 189 239 3.0E-07
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 165 239 3.0E-07
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 186 239 3.0E-07
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 186 239 3.0E-07
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 189 239 3.0E-07
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 189 239 4.0E-07
sp|Q8TBZ8|ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens GN=ZNF564 PE=1 SV=1 136 237 4.0E-07
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 189 239 4.0E-07
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 188 239 4.0E-07
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 189 239 4.0E-07
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 189 239 4.0E-07
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 189 239 4.0E-07
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 189 239 4.0E-07
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 189 239 4.0E-07
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 189 239 4.0E-07
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 189 239 4.0E-07
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 189 239 4.0E-07
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 189 239 4.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 189 239 4.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 189 239 4.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 239 4.0E-07
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 186 239 4.0E-07
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 189 238 4.0E-07
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 189 239 4.0E-07
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 189 247 4.0E-07
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 189 239 4.0E-07
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 189 239 4.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 189 239 4.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 189 239 4.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 189 239 4.0E-07
sp|Q9H7R0|ZN442_HUMAN Zinc finger protein 442 OS=Homo sapiens GN=ZNF442 PE=2 SV=1 189 239 4.0E-07
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 189 239 4.0E-07
sp|Q5RCJ2|ZN614_PONAB Zinc finger protein 614 OS=Pongo abelii GN=ZNF614 PE=2 SV=1 189 243 4.0E-07
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 189 239 4.0E-07
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 189 239 4.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 189 237 4.0E-07
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 189 239 4.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 173 239 4.0E-07
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 189 239 4.0E-07
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 189 239 4.0E-07
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 189 239 4.0E-07
sp|P31629|ZEP2_HUMAN Transcription factor HIVEP2 OS=Homo sapiens GN=HIVEP2 PE=1 SV=2 189 247 4.0E-07
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 189 239 4.0E-07
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 189 239 4.0E-07
sp|Q9YIB7|ZIC2B_XENLA Zinc finger protein ZIC 2-B OS=Xenopus laevis GN=zic2-b PE=2 SV=1 194 237 4.0E-07
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 189 239 4.0E-07
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 189 239 4.0E-07
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 189 239 4.0E-07
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 189 239 4.0E-07
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 188 239 4.0E-07
sp|B4DX44|ZN736_HUMAN Zinc finger protein 736 OS=Homo sapiens GN=ZNF736 PE=2 SV=2 189 240 4.0E-07
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 186 239 4.0E-07
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 189 239 4.0E-07
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 188 239 4.0E-07
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 189 239 4.0E-07
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 188 239 4.0E-07
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 189 239 4.0E-07
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 189 238 4.0E-07
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 189 239 4.0E-07
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 189 239 4.0E-07
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 185 239 4.0E-07
sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 194 237 4.0E-07
sp|Q1H9T6|ZBT48_MOUSE Zinc finger and BTB domain-containing protein 48 OS=Mus musculus GN=Zbtb48 PE=1 SV=1 184 239 4.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 189 239 4.0E-07
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 178 245 4.0E-07
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 183 238 4.0E-07
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 189 238 4.0E-07
sp|A2T7G6|ZSCA4_PONPY Zinc finger and SCAN domain-containing protein 4 OS=Pongo pygmaeus GN=ZSCAN4 PE=3 SV=1 184 239 4.0E-07
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 189 239 4.0E-07
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 186 239 4.0E-07
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 189 239 4.0E-07
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 173 239 4.0E-07
sp|Q6INV8|Z652B_XENLA Zinc finger protein 652-B OS=Xenopus laevis GN=znf652-b PE=2 SV=1 188 239 4.0E-07
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 189 239 4.0E-07
sp|Q6GNP2|Z652A_XENLA Zinc finger protein 652-A OS=Xenopus laevis GN=znf652-a PE=2 SV=1 188 239 4.0E-07
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 189 239 4.0E-07
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 189 239 4.0E-07
sp|P39806|SALM_DROVI Homeotic protein spalt-major OS=Drosophila virilis GN=salm PE=2 SV=1 177 237 4.0E-07
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 189 239 4.0E-07
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 189 238 4.0E-07
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 189 239 4.0E-07
sp|P36508|ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens GN=ZNF76 PE=2 SV=2 187 239 4.0E-07
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 189 240 4.0E-07
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 191 239 4.0E-07
sp|Q8IVC4|ZN584_HUMAN Zinc finger protein 584 OS=Homo sapiens GN=ZNF584 PE=2 SV=1 189 239 4.0E-07
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 189 239 4.0E-07
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 189 239 4.0E-07
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 189 239 4.0E-07
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 189 239 4.0E-07
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 189 239 5.0E-07
sp|Q8BI67|ZN473_MOUSE Zinc finger protein 473 homolog OS=Mus musculus GN=Znf473 PE=2 SV=1 189 239 5.0E-07
sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 189 238 5.0E-07
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 189 238 5.0E-07
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 189 239 5.0E-07
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 189 239 5.0E-07
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 189 239 5.0E-07
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 189 239 5.0E-07
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 189 239 5.0E-07
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 189 239 5.0E-07
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 189 242 5.0E-07
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 189 239 5.0E-07
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 189 239 5.0E-07
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 189 239 5.0E-07
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 189 239 5.0E-07
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 189 239 5.0E-07
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 189 239 5.0E-07
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 191 239 5.0E-07
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 189 239 5.0E-07
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 189 239 5.0E-07
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 189 239 5.0E-07
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 189 239 5.0E-07
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 176 239 5.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 191 239 5.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 127 239 5.0E-07
sp|Q1LYE3|ZN143_DANRE Zinc finger protein 143 OS=Danio rerio GN=znf143 PE=2 SV=2 194 239 5.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 184 239 5.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 189 239 5.0E-07
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 189 239 5.0E-07
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 189 239 5.0E-07
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 189 239 5.0E-07
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 189 239 5.0E-07
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 189 239 5.0E-07
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 189 239 5.0E-07
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 189 239 5.0E-07
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 189 239 5.0E-07
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 189 239 5.0E-07
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 187 239 5.0E-07
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 187 239 5.0E-07
sp|Q9Y2G7|ZFP30_HUMAN Zinc finger protein 30 homolog OS=Homo sapiens GN=ZFP30 PE=2 SV=1 189 239 5.0E-07
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 186 243 5.0E-07
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 189 239 5.0E-07
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 189 239 5.0E-07
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 174 239 5.0E-07
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 191 239 5.0E-07
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 189 239 5.0E-07
sp|Q6P9Y7|ZFP82_MOUSE Zinc finger protein 82 OS=Mus musculus GN=Zfp82 PE=2 SV=1 187 239 5.0E-07
sp|Q9IAJ2|FEZF1_XENLA Fez family zinc finger protein 1 OS=Xenopus laevis GN=fezf1 PE=2 SV=1 186 254 5.0E-07
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 184 239 5.0E-07
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 189 239 5.0E-07
sp|Q62520|ZIC2_MOUSE Zinc finger protein ZIC 2 OS=Mus musculus GN=Zic2 PE=1 SV=2 194 237 5.0E-07
sp|Q8N8L2|ZN491_HUMAN Zinc finger protein 491 OS=Homo sapiens GN=ZNF491 PE=2 SV=1 189 239 6.0E-07
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 189 238 6.0E-07
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 189 239 6.0E-07
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 188 239 6.0E-07
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 187 239 6.0E-07
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 189 239 6.0E-07
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 189 239 6.0E-07
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 189 239 6.0E-07
sp|A1YEV9|ZSC21_GORGO Zinc finger and SCAN domain-containing protein 21 OS=Gorilla gorilla gorilla GN=ZSCAN21 PE=3 SV=1 7 239 6.0E-07
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 191 239 6.0E-07
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 191 239 6.0E-07
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 189 239 6.0E-07
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 189 239 6.0E-07
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 183 239 6.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 189 239 6.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 189 240 6.0E-07
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 189 239 6.0E-07
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 189 238 6.0E-07
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 189 239 6.0E-07
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 189 239 6.0E-07
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 189 239 6.0E-07
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 189 239 6.0E-07
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 191 239 6.0E-07
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 189 239 6.0E-07
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 189 239 6.0E-07
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 191 239 6.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 189 238 6.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 189 238 6.0E-07
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 189 239 6.0E-07
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 189 239 6.0E-07
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 189 239 6.0E-07
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 189 239 6.0E-07
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 189 239 6.0E-07
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 189 253 6.0E-07
sp|Q9Y2A4|ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens GN=ZNF443 PE=2 SV=2 189 239 6.0E-07
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 189 239 6.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 189 239 6.0E-07
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 189 239 6.0E-07
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 189 239 6.0E-07
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 189 239 6.0E-07
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 189 239 7.0E-07
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 189 239 7.0E-07
sp|Q9UJQ4|SALL4_HUMAN Sal-like protein 4 OS=Homo sapiens GN=SALL4 PE=1 SV=1 188 237 7.0E-07
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 189 239 7.0E-07
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 189 239 7.0E-07
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 189 239 7.0E-07
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 194 239 7.0E-07
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 189 238 7.0E-07
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 189 239 7.0E-07
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 189 239 7.0E-07
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 189 239 7.0E-07
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 189 239 7.0E-07
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 189 239 7.0E-07
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 189 239 7.0E-07
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 189 239 7.0E-07
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 191 239 7.0E-07
sp|P15621|ZNF44_HUMAN Zinc finger protein 44 OS=Homo sapiens GN=ZNF44 PE=2 SV=3 189 239 7.0E-07
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 191 239 7.0E-07
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 189 239 7.0E-07
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 189 239 7.0E-07
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 189 239 7.0E-07
sp|Q96GE5|ZN799_HUMAN Zinc finger protein 799 OS=Homo sapiens GN=ZNF799 PE=2 SV=4 189 239 7.0E-07
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 189 239 7.0E-07
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 189 239 7.0E-07
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 189 239 8.0E-07
sp|Q9BXA9|SALL3_HUMAN Sal-like protein 3 OS=Homo sapiens GN=SALL3 PE=1 SV=2 184 237 8.0E-07
sp|Q9UL59|ZN214_HUMAN Zinc finger protein 214 OS=Homo sapiens GN=ZNF214 PE=2 SV=2 189 239 8.0E-07
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 189 239 8.0E-07
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 189 239 8.0E-07
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 189 239 8.0E-07
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 189 239 8.0E-07
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 189 239 8.0E-07
sp|Q12901|ZN155_HUMAN Zinc finger protein 155 OS=Homo sapiens GN=ZNF155 PE=1 SV=4 189 239 8.0E-07
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 189 237 8.0E-07
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 189 239 8.0E-07
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 189 239 8.0E-07
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 189 239 8.0E-07
sp|Q9H7R0|ZN442_HUMAN Zinc finger protein 442 OS=Homo sapiens GN=ZNF442 PE=2 SV=1 189 237 8.0E-07
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 189 239 8.0E-07
sp|A1YGJ4|ZNF24_PANPA Zinc finger protein 24 OS=Pan paniscus GN=ZNF24 PE=3 SV=1 183 239 8.0E-07
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 189 239 8.0E-07
sp|Q810A1|ZNF18_MOUSE Zinc finger protein 18 OS=Mus musculus GN=Znf18 PE=2 SV=1 189 239 8.0E-07
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 189 239 8.0E-07
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 189 239 8.0E-07
sp|Q642B9|ZNF18_RAT Zinc finger protein 18 OS=Rattus norvegicus GN=Znf18 PE=2 SV=1 189 239 8.0E-07
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 179 239 8.0E-07
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 189 239 8.0E-07
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 189 239 8.0E-07
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 189 239 8.0E-07
sp|Q8IYX0|ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens GN=ZNF679 PE=1 SV=2 189 239 8.0E-07
sp|Q9Y2A4|ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens GN=ZNF443 PE=2 SV=2 189 239 8.0E-07
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 186 239 8.0E-07
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 189 239 8.0E-07
sp|Q62255|SALL3_MOUSE Sal-like protein 3 OS=Mus musculus GN=Sall3 PE=1 SV=2 184 237 9.0E-07
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 189 239 9.0E-07
sp|Q9UJQ4|SALL4_HUMAN Sal-like protein 4 OS=Homo sapiens GN=SALL4 PE=1 SV=1 191 237 9.0E-07
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 189 238 9.0E-07
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 189 240 9.0E-07
sp|Q8N7K0|ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens GN=ZNF433 PE=1 SV=1 189 239 9.0E-07
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 189 240 9.0E-07
sp|Q91VN1|ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus GN=Znf24 PE=1 SV=1 183 239 9.0E-07
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 189 237 9.0E-07
sp|Q7TNK3|ZNF24_RAT Zinc finger protein 24 OS=Rattus norvegicus GN=Znf24 PE=2 SV=1 183 239 9.0E-07
sp|A2T7D7|ZNF24_PANTR Zinc finger protein 24 OS=Pan troglodytes GN=ZNF24 PE=3 SV=1 183 239 9.0E-07
sp|Q5RAE6|ZNF24_PONAB Zinc finger protein 24 OS=Pongo abelii GN=ZNF24 PE=2 SV=1 183 239 9.0E-07
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 184 239 9.0E-07
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 189 239 9.0E-07
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 189 239 9.0E-07
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 184 239 9.0E-07
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 189 239 9.0E-07
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 189 239 9.0E-07
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 189 239 9.0E-07
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 140 239 9.0E-07
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 186 239 9.0E-07
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 189 239 9.0E-07
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 189 239 9.0E-07
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 127 239 9.0E-07
sp|Q8N8L2|ZN491_HUMAN Zinc finger protein 491 OS=Homo sapiens GN=ZNF491 PE=2 SV=1 191 239 1.0E-06
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 194 240 1.0E-06
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 189 240 1.0E-06
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 189 239 1.0E-06
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 189 239 1.0E-06
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 189 239 1.0E-06
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 189 239 1.0E-06
sp|Q9ER74|SALL1_MOUSE Sal-like protein 1 OS=Mus musculus GN=Sall1 PE=1 SV=1 191 237 1.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 189 239 1.0E-06
sp|Q9NSC2|SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens GN=SALL1 PE=1 SV=2 191 237 1.0E-06
sp|Q8TBZ8|ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens GN=ZNF564 PE=1 SV=1 189 237 1.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 189 229 1.0E-06
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 189 239 1.0E-06
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 189 239 1.0E-06
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 189 237 1.0E-06
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 189 239 1.0E-06
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 189 239 1.0E-06
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 189 239 1.0E-06
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 189 239 1.0E-06
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 189 239 1.0E-06
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 189 239 1.0E-06
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 189 239 1.0E-06
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 189 239 1.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 189 239 1.0E-06
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 189 239 1.0E-06
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 189 239 1.0E-06
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 189 239 1.0E-06
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 191 239 1.0E-06
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 189 239 1.0E-06
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 191 239 1.0E-06
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 189 240 1.0E-06
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 189 239 1.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 189 239 1.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 189 239 1.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 189 239 1.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 189 239 1.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 189 239 1.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 189 239 1.0E-06
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 189 239 1.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 238 1.0E-06
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 189 247 1.0E-06
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 189 239 1.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 189 239 1.0E-06
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 189 239 1.0E-06
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 189 238 1.0E-06
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 189 238 1.0E-06
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 189 239 1.0E-06
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 189 243 1.0E-06
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 189 239 1.0E-06
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 189 239 1.0E-06
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 189 237 1.0E-06
sp|Q8BX22|SALL4_MOUSE Sal-like protein 4 OS=Mus musculus GN=Sall4 PE=1 SV=2 188 237 1.0E-06
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 189 239 1.0E-06
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 189 239 1.0E-06
sp|Q86XU0|ZN677_HUMAN Zinc finger protein 677 OS=Homo sapiens GN=ZNF677 PE=2 SV=1 189 239 1.0E-06
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 189 240 1.0E-06
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 186 239 1.0E-06
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 189 239 1.0E-06
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 189 239 1.0E-06
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 189 237 1.0E-06
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 189 239 1.0E-06
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 189 239 1.0E-06
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 189 239 1.0E-06
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 189 239 1.0E-06
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 189 237 1.0E-06
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 184 239 1.0E-06
sp|Q9H7R0|ZN442_HUMAN Zinc finger protein 442 OS=Homo sapiens GN=ZNF442 PE=2 SV=1 191 238 1.0E-06
sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 189 239 1.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 186 239 1.0E-06
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 189 239 1.0E-06
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 189 239 1.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 189 239 1.0E-06
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 186 238 1.0E-06
sp|P17028|ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens GN=ZNF24 PE=1 SV=4 183 239 1.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 189 239 1.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 189 239 1.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 51 239 1.0E-06
sp|P15621|ZNF44_HUMAN Zinc finger protein 44 OS=Homo sapiens GN=ZNF44 PE=2 SV=3 189 239 1.0E-06
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 194 239 1.0E-06
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 189 239 1.0E-06
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 194 239 1.0E-06
sp|Q8NDP4|ZN439_HUMAN Zinc finger protein 439 OS=Homo sapiens GN=ZNF439 PE=1 SV=1 189 239 1.0E-06
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 189 239 1.0E-06
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 189 238 1.0E-06
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 189 239 1.0E-06
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 189 239 1.0E-06
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 189 239 1.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 189 239 1.0E-06
sp|Q6ZN08|ZNF66_HUMAN Putative zinc finger protein 66 OS=Homo sapiens GN=ZNF66 PE=5 SV=3 189 239 1.0E-06
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 189 239 1.0E-06
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 184 239 1.0E-06
sp|P39770|SALM_DROME Homeotic protein spalt-major OS=Drosophila melanogaster GN=salm PE=1 SV=3 191 237 1.0E-06
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 189 239 1.0E-06
sp|A6NK53|ZN233_HUMAN Zinc finger protein 233 OS=Homo sapiens GN=ZNF233 PE=2 SV=3 189 239 1.0E-06
sp|P17024|ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens GN=ZNF20 PE=1 SV=2 189 239 1.0E-06
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 189 239 1.0E-06
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 189 239 1.0E-06
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 189 239 1.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 177 239 1.0E-06
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 189 239 1.0E-06
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 189 239 1.0E-06
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 189 239 1.0E-06
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 189 238 1.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 189 239 1.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 189 239 1.0E-06
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 189 238 1.0E-06
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 186 238 1.0E-06
sp|P39806|SALM_DROVI Homeotic protein spalt-major OS=Drosophila virilis GN=salm PE=2 SV=1 191 237 1.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 189 239 1.0E-06
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 189 243 1.0E-06
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 189 239 1.0E-06
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 189 239 1.0E-06
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=ZNF77 PE=2 SV=2 189 239 2.0E-06
sp|Q8N8L2|ZN491_HUMAN Zinc finger protein 491 OS=Homo sapiens GN=ZNF491 PE=2 SV=1 191 239 2.0E-06
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 189 239 2.0E-06
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 189 253 2.0E-06
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 189 239 2.0E-06
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 189 239 2.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 189 239 2.0E-06
sp|Q8TBZ8|ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens GN=ZNF564 PE=1 SV=1 189 237 2.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 136 239 2.0E-06
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 191 237 2.0E-06
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 189 239 2.0E-06
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 177 239 2.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 190 239 2.0E-06
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 189 239 2.0E-06
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 189 239 2.0E-06
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 189 237 2.0E-06
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 190 239 2.0E-06
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 189 239 2.0E-06
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 180 239 2.0E-06
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 189 245 2.0E-06
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 189 239 2.0E-06
sp|A1YG26|ZSC21_PANPA Zinc finger and SCAN domain-containing protein 21 OS=Pan paniscus GN=ZSCAN21 PE=3 SV=1 2 239 2.0E-06
sp|Q9Y5A6|ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens GN=ZSCAN21 PE=1 SV=2 2 239 2.0E-06
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 190 239 2.0E-06
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 189 239 2.0E-06
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 189 240 2.0E-06
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 191 239 2.0E-06
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 189 239 2.0E-06
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 191 239 2.0E-06
sp|A2T712|ZSC21_PANTR Zinc finger and SCAN domain-containing protein 21 OS=Pan troglodytes GN=ZSCAN21 PE=3 SV=1 2 239 2.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 189 239 2.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 189 239 2.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 189 239 2.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 189 239 2.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 189 239 2.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 238 2.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 238 2.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 239 2.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 239 2.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 239 2.0E-06
sp|Q95K49|ZN614_MACFA Zinc finger protein 614 OS=Macaca fascicularis GN=ZNF614 PE=2 SV=1 189 239 2.0E-06
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 189 239 2.0E-06
sp|P16415|ZN823_HUMAN Zinc finger protein 823 OS=Homo sapiens GN=ZNF823 PE=2 SV=2 191 238 2.0E-06
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 189 238 2.0E-06
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 189 238 2.0E-06
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 191 238 2.0E-06
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 189 239 2.0E-06
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 190 239 2.0E-06
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 189 239 2.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 189 239 2.0E-06
sp|A6NNF4|ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens GN=ZNF726 PE=2 SV=4 189 239 2.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 189 245 2.0E-06
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 190 239 2.0E-06
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 189 239 2.0E-06
sp|Q6ZTB9|ZN833_HUMAN Putative zinc finger protein 833 OS=Homo sapiens GN=ZNF833P PE=5 SV=1 189 238 2.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 186 239 2.0E-06
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 189 239 2.0E-06
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 185 237 2.0E-06
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 189 239 2.0E-06
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 189 245 2.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 189 239 2.0E-06
sp|Q03938|ZNF90_HUMAN Zinc finger protein 90 OS=Homo sapiens GN=ZNF90 PE=2 SV=3 189 238 2.0E-06
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 189 239 2.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 189 239 2.0E-06
sp|P59923|ZN445_HUMAN Zinc finger protein 445 OS=Homo sapiens GN=ZNF445 PE=1 SV=1 181 239 2.0E-06
sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 191 239 2.0E-06
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 189 239 2.0E-06
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 189 239 2.0E-06
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 189 239 2.0E-06
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 189 239 2.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 189 239 2.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 189 239 2.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 189 239 2.0E-06
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 189 239 2.0E-06
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 189 239 2.0E-06
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 188 239 2.0E-06
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 189 239 2.0E-06
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 189 239 2.0E-06
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 189 239 2.0E-06
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 189 239 2.0E-06
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 189 239 2.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 189 239 2.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 189 239 2.0E-06
sp|Q8BZ89|ZN322_MOUSE Zinc finger protein 322 OS=Mus musculus GN=Znf322 PE=2 SV=1 78 239 2.0E-06
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 189 239 2.0E-06
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 186 239 2.0E-06
sp|A1YGJ4|ZNF24_PANPA Zinc finger protein 24 OS=Pan paniscus GN=ZNF24 PE=3 SV=1 189 237 2.0E-06
sp|Q8NDW4|ZN248_HUMAN Zinc finger protein 248 OS=Homo sapiens GN=ZNF248 PE=2 SV=1 189 239 2.0E-06
sp|P17022|ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens GN=ZNF18 PE=1 SV=2 189 239 2.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 189 239 2.0E-06
sp|A2T7D7|ZNF24_PANTR Zinc finger protein 24 OS=Pan troglodytes GN=ZNF24 PE=3 SV=1 189 237 2.0E-06
sp|Q9Y473|ZN175_HUMAN Zinc finger protein 175 OS=Homo sapiens GN=ZNF175 PE=1 SV=1 189 238 2.0E-06
sp|Q8N141|ZFP82_HUMAN Zinc finger protein 82 homolog OS=Homo sapiens GN=ZFP82 PE=2 SV=1 189 239 2.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 189 239 2.0E-06
sp|Q642B9|ZNF18_RAT Zinc finger protein 18 OS=Rattus norvegicus GN=Znf18 PE=2 SV=1 191 239 2.0E-06
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 189 239 2.0E-06
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 189 239 2.0E-06
sp|Q96I27|ZN625_HUMAN Zinc finger protein 625 OS=Homo sapiens GN=ZNF625 PE=1 SV=1 189 238 2.0E-06
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 189 239 2.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 191 239 2.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 189 239 2.0E-06
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 189 239 2.0E-06
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 186 239 2.0E-06
sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 189 239 2.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 189 239 2.0E-06
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 168 239 2.0E-06
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 189 239 2.0E-06
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 190 239 2.0E-06
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 186 239 2.0E-06
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 189 239 2.0E-06
sp|P17024|ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens GN=ZNF20 PE=1 SV=2 191 239 2.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 189 239 2.0E-06
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 189 239 2.0E-06
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 189 239 2.0E-06
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 189 238 2.0E-06
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 177 239 2.0E-06
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 186 237 2.0E-06
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 189 239 2.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 189 239 2.0E-06
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 181 238 2.0E-06
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 186 239 2.0E-06
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 189 239 2.0E-06
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 181 238 2.0E-06
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 181 238 2.0E-06
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 160 239 2.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 189 239 2.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 189 239 2.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 189 239 2.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 189 239 2.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 189 253 2.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 189 239 2.0E-06
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 186 238 2.0E-06
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 186 239 2.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 189 239 2.0E-06
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 186 239 2.0E-06
sp|Q8IVC4|ZN584_HUMAN Zinc finger protein 584 OS=Homo sapiens GN=ZNF584 PE=2 SV=1 189 239 2.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 189 253 2.0E-06
sp|Q9Y2G7|ZFP30_HUMAN Zinc finger protein 30 homolog OS=Homo sapiens GN=ZFP30 PE=2 SV=1 189 239 2.0E-06
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 189 239 2.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 189 239 2.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 189 239 2.0E-06
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 189 239 2.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 189 239 3.0E-06
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 189 239 3.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 189 239 3.0E-06
sp|Q5VV52|ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens GN=ZNF691 PE=1 SV=1 189 239 3.0E-06
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 184 237 3.0E-06
sp|Q8NEP9|ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens GN=ZNF555 PE=1 SV=4 189 237 3.0E-06
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 189 239 3.0E-06
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 189 239 3.0E-06
sp|Q13360|ZN177_HUMAN Zinc finger protein 177 OS=Homo sapiens GN=ZNF177 PE=1 SV=4 189 239 3.0E-06
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 189 239 3.0E-06
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 189 239 3.0E-06
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 189 239 3.0E-06
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 189 239 3.0E-06
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 189 239 3.0E-06
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 190 239 3.0E-06
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 186 237 3.0E-06
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 189 239 3.0E-06
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 189 239 3.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 189 239 3.0E-06
sp|A2T7L7|ZSC21_PONPY Zinc finger and SCAN domain-containing protein 21 OS=Pongo pygmaeus GN=ZSCAN21 PE=3 SV=1 189 239 3.0E-06
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 191 242 3.0E-06
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 190 239 3.0E-06
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 189 239 3.0E-06
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 189 239 3.0E-06
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 189 239 3.0E-06
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 191 239 3.0E-06
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 191 239 3.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 189 239 3.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 189 239 3.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 189 239 3.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 189 239 3.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 238 3.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 239 3.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 239 3.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 239 3.0E-06
sp|Q9Y467|SALL2_HUMAN Sal-like protein 2 OS=Homo sapiens GN=SALL2 PE=1 SV=4 191 240 3.0E-06
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 189 239 3.0E-06
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 189 239 3.0E-06
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 189 239 3.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 189 239 3.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 191 239 3.0E-06
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 189 239 3.0E-06
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 189 239 3.0E-06
sp|Q8IYI8|ZN440_HUMAN Zinc finger protein 440 OS=Homo sapiens GN=ZNF440 PE=1 SV=1 152 239 3.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 189 239 3.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 189 239 3.0E-06
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 189 239 3.0E-06
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 189 239 3.0E-06
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 189 239 3.0E-06
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 189 237 3.0E-06
sp|P52737|ZN136_HUMAN Zinc finger protein 136 OS=Homo sapiens GN=ZNF136 PE=1 SV=1 189 239 3.0E-06
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 189 239 3.0E-06
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 189 237 3.0E-06
sp|Q9H7R0|ZN442_HUMAN Zinc finger protein 442 OS=Homo sapiens GN=ZNF442 PE=2 SV=1 189 239 3.0E-06
sp|Q96SK3|ZN607_HUMAN Zinc finger protein 607 OS=Homo sapiens GN=ZNF607 PE=1 SV=3 189 239 3.0E-06
sp|Q3ZCT1|ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens GN=ZNF260 PE=1 SV=3 189 239 3.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 189 239 3.0E-06
sp|Q810A1|ZNF18_MOUSE Zinc finger protein 18 OS=Mus musculus GN=Znf18 PE=2 SV=1 191 239 3.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 189 239 3.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 189 239 3.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 186 239 3.0E-06
sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 189 239 3.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 189 239 3.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 189 239 3.0E-06
sp|Q4R7X8|ZN322_MACFA Zinc finger protein 322 OS=Macaca fascicularis GN=ZNF322 PE=2 SV=1 189 239 3.0E-06
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 189 239 3.0E-06
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 70 251 3.0E-06
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 191 239 3.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 189 239 3.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 189 239 3.0E-06
sp|Q62521|ZIC3_MOUSE Zinc finger protein ZIC 3 OS=Mus musculus GN=Zic3 PE=1 SV=2 173 239 3.0E-06
sp|O60481|ZIC3_HUMAN Zinc finger protein ZIC 3 OS=Homo sapiens GN=ZIC3 PE=1 SV=1 173 239 3.0E-06
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 189 239 3.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 189 239 3.0E-06
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 189 239 3.0E-06
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 186 239 3.0E-06
sp|Q9QX96|SALL2_MOUSE Sal-like protein 2 OS=Mus musculus GN=Sall2 PE=1 SV=2 191 237 3.0E-06
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 189 238 3.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 187 238 3.0E-06
sp|Q969J2|ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens GN=ZKSCAN4 PE=1 SV=1 189 239 3.0E-06
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 189 239 3.0E-06
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 184 239 3.0E-06
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 189 239 3.0E-06
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 189 239 3.0E-06
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 189 239 3.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 189 239 3.0E-06
sp|Q1H9T6|ZBT48_MOUSE Zinc finger and BTB domain-containing protein 48 OS=Mus musculus GN=Zbtb48 PE=1 SV=1 191 241 3.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 189 239 3.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 189 239 3.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 189 239 3.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 189 239 3.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 189 238 3.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 189 239 3.0E-06
sp|Q96BR6|ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens GN=ZNF669 PE=2 SV=2 189 239 4.0E-06
sp|Q15935|ZNF77_HUMAN Zinc finger protein 77 OS=Homo sapiens GN=ZNF77 PE=2 SV=2 189 237 4.0E-06
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 186 239 4.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 189 239 4.0E-06
sp|Q8N972|ZN709_HUMAN Zinc finger protein 709 OS=Homo sapiens GN=ZNF709 PE=2 SV=1 189 239 4.0E-06
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 189 239 4.0E-06
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 189 239 4.0E-06
sp|Q5R5N5|MYNN_PONAB Myoneurin OS=Pongo abelii GN=MYNN PE=2 SV=1 189 245 4.0E-06
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 189 239 4.0E-06
sp|Q14584|ZN266_HUMAN Zinc finger protein 266 OS=Homo sapiens GN=ZNF266 PE=1 SV=2 189 239 4.0E-06
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 189 239 4.0E-06
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 189 239 4.0E-06
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 189 239 4.0E-06
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 189 239 4.0E-06
sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 189 245 4.0E-06
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 189 239 4.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 185 239 4.0E-06
sp|Q8N883|ZN614_HUMAN Zinc finger protein 614 OS=Homo sapiens GN=ZNF614 PE=1 SV=2 189 247 4.0E-06
sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 189 238 4.0E-06
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 189 239 4.0E-06
sp|Q95K49|ZN614_MACFA Zinc finger protein 614 OS=Macaca fascicularis GN=ZNF614 PE=2 SV=1 189 247 4.0E-06
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 189 239 4.0E-06
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 189 238 4.0E-06
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 189 238 4.0E-06
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 189 238 4.0E-06
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 189 239 4.0E-06
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 189 239 4.0E-06
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 189 239 4.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 189 239 4.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 189 239 4.0E-06
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 189 239 4.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 189 239 4.0E-06
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 189 239 4.0E-06
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 189 239 4.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 189 239 4.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 189 239 4.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 160 239 4.0E-06
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 189 239 4.0E-06
sp|Q8N7Q3|ZN676_HUMAN Zinc finger protein 676 OS=Homo sapiens GN=ZNF676 PE=2 SV=2 189 239 4.0E-06
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 189 239 4.0E-06
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 189 239 4.0E-06
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 189 239 4.0E-06
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 189 239 4.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 189 239 4.0E-06
sp|Q5RBY9|ZNF2_PONAB Zinc finger protein 2 OS=Pongo abelii GN=ZNF2 PE=2 SV=1 189 239 4.0E-06
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 189 239 4.0E-06
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 191 239 4.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 189 239 4.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 189 239 4.0E-06
sp|Q5RCJ2|ZN614_PONAB Zinc finger protein 614 OS=Pongo abelii GN=ZNF614 PE=2 SV=1 189 247 4.0E-06
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 189 239 4.0E-06
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 189 239 4.0E-06
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 189 239 4.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 189 239 4.0E-06
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 189 239 4.0E-06
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 189 239 4.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 191 239 4.0E-06
sp|P15621|ZNF44_HUMAN Zinc finger protein 44 OS=Homo sapiens GN=ZNF44 PE=2 SV=3 189 237 4.0E-06
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 189 239 4.0E-06
sp|Q6U7Q0|ZN322_HUMAN Zinc finger protein 322 OS=Homo sapiens GN=ZNF322 PE=1 SV=2 189 239 4.0E-06
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 189 238 4.0E-06
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 189 239 4.0E-06
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 189 239 4.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 189 239 4.0E-06
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 160 239 4.0E-06
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 189 239 4.0E-06
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 189 238 4.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 186 239 4.0E-06
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 189 239 4.0E-06
sp|Q8BI99|ZN879_MOUSE Zinc finger protein 879 OS=Mus musculus GN=Znf879 PE=2 SV=1 191 239 4.0E-06
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 189 239 4.0E-06
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 189 239 4.0E-06
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 189 239 4.0E-06
sp|P17024|ZNF20_HUMAN Zinc finger protein 20 OS=Homo sapiens GN=ZNF20 PE=1 SV=2 191 239 4.0E-06
sp|Q9Y2A4|ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens GN=ZNF443 PE=2 SV=2 191 238 4.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 189 237 4.0E-06
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 189 239 4.0E-06
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 189 240 4.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 189 239 4.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 189 238 4.0E-06
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 189 238 4.0E-06
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 189 239 4.0E-06
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 189 239 4.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 189 239 5.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 189 240 5.0E-06
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 189 239 5.0E-06
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 189 239 5.0E-06
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 189 239 5.0E-06
sp|Q2M3X9|ZN674_HUMAN Zinc finger protein 674 OS=Homo sapiens GN=ZNF674 PE=2 SV=1 189 239 5.0E-06
sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 191 239 5.0E-06
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 189 239 5.0E-06
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 190 239 5.0E-06
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 191 239 5.0E-06
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 189 239 5.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 189 239 5.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 189 239 5.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 189 239 5.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 189 239 5.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 189 239 5.0E-06
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 92 238 5.0E-06
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 189 239 5.0E-06
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 190 239 5.0E-06
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 189 239 5.0E-06
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 189 239 5.0E-06
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 189 239 5.0E-06
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 189 239 5.0E-06
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 189 239 5.0E-06
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 189 245 5.0E-06
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 189 239 5.0E-06
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 189 239 5.0E-06
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 189 239 5.0E-06
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 189 239 5.0E-06
sp|Q8N7K0|ZN433_HUMAN Zinc finger protein 433 OS=Homo sapiens GN=ZNF433 PE=1 SV=1 189 239 5.0E-06
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 189 239 5.0E-06
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 189 239 5.0E-06
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 191 239 5.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 186 238 5.0E-06
sp|Q5R670|ZKSC1_PONAB Zinc finger protein with KRAB and SCAN domains 1 OS=Pongo abelii GN=ZKSCAN1 PE=2 SV=1 189 239 5.0E-06
sp|P17029|ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens GN=ZKSCAN1 PE=1 SV=3 189 239 5.0E-06
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 189 238 5.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 189 239 5.0E-06
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 189 239 5.0E-06
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 189 239 5.0E-06
sp|Q4KLI1|ZKSC1_RAT Zinc finger protein with KRAB and SCAN domains 1 OS=Rattus norvegicus GN=Zkscan1 PE=1 SV=1 189 239 5.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 189 239 5.0E-06
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 189 247 5.0E-06
sp|Q16600|ZN239_HUMAN Zinc finger protein 239 OS=Homo sapiens GN=ZNF239 PE=1 SV=3 189 237 5.0E-06
sp|P15621|ZNF44_HUMAN Zinc finger protein 44 OS=Homo sapiens GN=ZNF44 PE=2 SV=3 189 239 5.0E-06
sp|Q5R8G9|ZN239_PONAB Zinc finger protein 239 OS=Pongo abelii GN=ZNF239 PE=2 SV=1 189 249 5.0E-06
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 189 239 5.0E-06
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 189 239 5.0E-06
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 189 239 5.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 189 239 5.0E-06
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 189 237 5.0E-06
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 189 239 5.0E-06
sp|O57311|ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis GN=zic3 PE=2 SV=3 173 239 5.0E-06
sp|Q6ZR52|ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens GN=ZNF493 PE=2 SV=3 189 239 5.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 189 239 5.0E-06
sp|Q9UII5|ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens GN=ZNF107 PE=2 SV=1 189 239 5.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 189 239 5.0E-06
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 189 239 5.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 189 255 5.0E-06
sp|Q96GE5|ZN799_HUMAN Zinc finger protein 799 OS=Homo sapiens GN=ZNF799 PE=2 SV=4 191 238 5.0E-06
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 189 240 5.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 189 239 5.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 169 239 5.0E-06
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 189 238 5.0E-06
sp|P18753|ZO84_XENLA Oocyte zinc finger protein XlCOF8.4 (Fragment) OS=Xenopus laevis PE=2 SV=1 189 237 5.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 189 239 5.0E-06
sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 189 239 5.0E-06
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 189 239 5.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 189 238 5.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 189 239 5.0E-06
sp|A6NJL1|ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens GN=ZSCAN5B PE=3 SV=1 189 237 5.0E-06
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 189 239 5.0E-06
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 186 239 5.0E-06
sp|Q96H40|ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens GN=ZNF486 PE=2 SV=4 189 238 5.0E-06
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 189 239 5.0E-06
sp|Q96BR6|ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens GN=ZNF669 PE=2 SV=2 189 237 6.0E-06
sp|P25490|TYY1_HUMAN Transcriptional repressor protein YY1 OS=Homo sapiens GN=YY1 PE=1 SV=2 194 237 6.0E-06
sp|Q00899|TYY1_MOUSE Transcriptional repressor protein YY1 OS=Mus musculus GN=Yy1 PE=1 SV=1 194 237 6.0E-06
sp|Q96PQ6|ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens GN=ZNF317 PE=1 SV=2 189 237 6.0E-06
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 189 239 6.0E-06
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 189 239 6.0E-06
sp|P10077|ZFP27_MOUSE Zinc finger protein 27 OS=Mus musculus GN=Zfp27 PE=2 SV=2 189 239 6.0E-06
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 189 239 6.0E-06
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 189 239 6.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 189 239 6.0E-06
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 189 239 6.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 189 252 6.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 189 239 6.0E-06
sp|Q9BSG1|ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens GN=ZNF2 PE=1 SV=4 189 239 6.0E-06
sp|P16415|ZN823_HUMAN Zinc finger protein 823 OS=Homo sapiens GN=ZNF823 PE=2 SV=2 189 238 6.0E-06
sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=3 191 238 6.0E-06
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 189 239 6.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 189 237 6.0E-06
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 189 237 6.0E-06
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 189 239 6.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 189 239 6.0E-06
sp|Q03938|ZNF90_HUMAN Zinc finger protein 90 OS=Homo sapiens GN=ZNF90 PE=2 SV=3 189 238 6.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 189 239 6.0E-06
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 189 239 6.0E-06
sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens GN=ZNF267 PE=2 SV=3 189 239 6.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 160 239 6.0E-06
sp|Q5REK1|ZN136_PONAB Zinc finger protein 136 OS=Pongo abelii GN=ZNF136 PE=2 SV=1 189 239 6.0E-06
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 189 239 6.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 189 238 6.0E-06
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 186 239 6.0E-06
sp|P15621|ZNF44_HUMAN Zinc finger protein 44 OS=Homo sapiens GN=ZNF44 PE=2 SV=3 191 238 6.0E-06
sp|Q5MYW4|ZN667_RAT Zinc finger protein 667 OS=Rattus norvegicus GN=Znf667 PE=2 SV=1 189 239 6.0E-06
sp|Q8BGS3|ZKSC1_MOUSE Zinc finger protein with KRAB and SCAN domains 1 OS=Mus musculus GN=Zkscan1 PE=2 SV=1 189 239 6.0E-06
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 189 238 6.0E-06
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 189 238 6.0E-06
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 189 239 6.0E-06
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 189 239 6.0E-06
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 138 238 6.0E-06
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 189 239 6.0E-06
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 189 251 6.0E-06
sp|B4DU55|ZN879_HUMAN Zinc finger protein 879 OS=Homo sapiens GN=ZNF879 PE=2 SV=2 189 239 6.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 189 239 6.0E-06
sp|O88553|ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus GN=Zfp37 PE=2 SV=1 189 239 6.0E-06
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 189 238 6.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 189 239 6.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 189 239 6.0E-06
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 189 239 6.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 177 239 6.0E-06
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 189 239 6.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 186 239 6.0E-06
sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 189 239 6.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 189 238 6.0E-06
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 189 237 7.0E-06
sp|Q96LW9|ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens GN=ZSCAN31 PE=1 SV=2 186 239 7.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 189 239 7.0E-06
sp|Q8TBZ8|ZN564_HUMAN Zinc finger protein 564 OS=Homo sapiens GN=ZNF564 PE=1 SV=1 189 237 7.0E-06
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 189 239 7.0E-06
sp|Q8BIQ3|ZNF2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Znf2 PE=2 SV=1 189 239 7.0E-06
sp|Q5EAC5|ZN410_BOVIN Zinc finger protein 410 OS=Bos taurus GN=ZNF410 PE=2 SV=1 189 237 7.0E-06
sp|Q86YE8|ZN573_HUMAN Zinc finger protein 573 OS=Homo sapiens GN=ZNF573 PE=2 SV=4 173 239 7.0E-06
sp|P17017|ZNF14_HUMAN Zinc finger protein 14 OS=Homo sapiens GN=ZNF14 PE=2 SV=3 189 238 7.0E-06
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 181 239 7.0E-06
sp|Q5R9F0|ZNF14_PONAB Zinc finger protein 14 OS=Pongo abelii GN=ZNF14 PE=2 SV=1 189 238 7.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 189 237 7.0E-06
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 189 237 7.0E-06
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 189 239 7.0E-06
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 189 239 7.0E-06
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 189 239 7.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 189 252 7.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 189 252 7.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 191 239 7.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 189 239 7.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 189 252 7.0E-06
sp|Q8N883|ZN614_HUMAN Zinc finger protein 614 OS=Homo sapiens GN=ZNF614 PE=1 SV=2 189 239 7.0E-06
sp|Q8N883|ZN614_HUMAN Zinc finger protein 614 OS=Homo sapiens GN=ZNF614 PE=1 SV=2 189 239 7.0E-06
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 189 239 7.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 189 238 7.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 189 239 7.0E-06
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 189 239 7.0E-06
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 189 239 7.0E-06
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 189 245 7.0E-06
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 189 239 7.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 160 239 7.0E-06
sp|Q5RCJ2|ZN614_PONAB Zinc finger protein 614 OS=Pongo abelii GN=ZNF614 PE=2 SV=1 189 239 7.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 189 239 7.0E-06
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 142 239 7.0E-06
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 189 238 7.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 186 239 7.0E-06
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 175 239 7.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 189 237 7.0E-06
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 189 239 7.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 189 239 7.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 189 239 7.0E-06
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 189 247 7.0E-06
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 189 239 7.0E-06
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 189 239 7.0E-06
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 189 238 7.0E-06
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 189 239 7.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 189 239 7.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 189 239 7.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 189 237 7.0E-06
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 189 238 7.0E-06
sp|Q03936|ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens GN=ZNF92 PE=2 SV=2 189 238 7.0E-06
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 170 239 7.0E-06
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 168 239 7.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 189 239 7.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 189 245 7.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 189 239 7.0E-06
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 189 237 7.0E-06
sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 189 245 7.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 189 245 7.0E-06
sp|P0DKX0|ZN728_HUMAN Zinc finger protein 728 OS=Homo sapiens GN=ZNF728 PE=3 SV=1 186 239 7.0E-06
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 170 239 7.0E-06
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 189 239 7.0E-06
sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 189 239 8.0E-06
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 189 239 8.0E-06
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 189 239 8.0E-06
sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=1 SV=1 189 239 8.0E-06
sp|Q4R4C7|ZNF14_MACFA Zinc finger protein 14 OS=Macaca fascicularis GN=ZNF14 PE=2 SV=1 189 238 8.0E-06
sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 186 239 8.0E-06
sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 189 239 8.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 189 238 8.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 189 238 8.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 189 238 8.0E-06
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 189 239 8.0E-06
sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 186 239 8.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 189 239 8.0E-06
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 189 239 8.0E-06
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 189 239 8.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 189 239 8.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 189 239 8.0E-06
sp|Q9BRR0|ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens GN=ZKSCAN3 PE=1 SV=2 188 239 8.0E-06
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 189 239 8.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 189 239 8.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 189 239 8.0E-06
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 189 239 8.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 189 239 8.0E-06
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 189 239 8.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 189 248 8.0E-06
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 189 239 8.0E-06
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 189 238 8.0E-06
sp|A8MTY0|ZN724_HUMAN Putative zinc finger protein 724 OS=Homo sapiens GN=ZNF724P PE=5 SV=3 189 237 8.0E-06
sp|P24399|ZN239_MOUSE Zinc finger protein 239 OS=Mus musculus GN=Znf239 PE=2 SV=2 189 239 8.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 189 239 8.0E-06
sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 189 239 8.0E-06
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 189 239 8.0E-06
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 189 238 8.0E-06
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 189 239 8.0E-06
sp|Q8TF32|ZN431_HUMAN Zinc finger protein 431 OS=Homo sapiens GN=ZNF431 PE=2 SV=2 189 239 8.0E-06
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 189 239 8.0E-06
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 189 239 8.0E-06
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 189 239 8.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 189 239 8.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 189 239 8.0E-06
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 189 255 8.0E-06
sp|Q6ZN79|Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens GN=ZNF705A PE=2 SV=1 189 239 9.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 189 239 9.0E-06
sp|Q3KP31|ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens GN=ZNF791 PE=2 SV=1 189 239 9.0E-06
sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 186 239 9.0E-06
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 189 239 9.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 88 239 9.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 189 239 9.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 189 239 9.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 189 238 9.0E-06
sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=1 SV=1 189 237 9.0E-06
sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 186 239 9.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 189 237 9.0E-06
sp|Q8NF99|ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens GN=ZNF397 PE=1 SV=2 189 247 9.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 189 239 9.0E-06
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 163 238 9.0E-06
sp|Q9UJW7|ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens GN=ZNF229 PE=2 SV=3 189 255 9.0E-06
sp|P15621|ZNF44_HUMAN Zinc finger protein 44 OS=Homo sapiens GN=ZNF44 PE=2 SV=3 189 238 9.0E-06
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 189 243 9.0E-06
sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 189 239 9.0E-06
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 189 239 9.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 189 253 9.0E-06
sp|Q68DY1|ZN626_HUMAN Zinc finger protein 626 OS=Homo sapiens GN=ZNF626 PE=2 SV=2 189 239 9.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 189 239 9.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 189 239 9.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 189 239 9.0E-06
sp|Q6INV8|Z652B_XENLA Zinc finger protein 652-B OS=Xenopus laevis GN=znf652-b PE=2 SV=1 189 237 9.0E-06
sp|Q6GNP2|Z652A_XENLA Zinc finger protein 652-A OS=Xenopus laevis GN=znf652-a PE=2 SV=1 189 237 9.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 189 239 9.0E-06
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 179 239 9.0E-06
sp|Q96BR6|ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens GN=ZNF669 PE=2 SV=2 189 239 1.0E-05
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 189 239 1.0E-05
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 189 239 1.0E-05
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 189 239 1.0E-05
sp|Q95K49|ZN614_MACFA Zinc finger protein 614 OS=Macaca fascicularis GN=ZNF614 PE=2 SV=1 189 239 1.0E-05
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 189 239 1.0E-05
sp|Q5REI6|ZN791_PONAB Zinc finger protein 791 OS=Pongo abelii GN=ZNF791 PE=2 SV=1 180 239 1.0E-05
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 189 239 1.0E-05
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 189 239 1.0E-05
sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 189 239 1.0E-05
sp|Q5RCJ2|ZN614_PONAB Zinc finger protein 614 OS=Pongo abelii GN=ZNF614 PE=2 SV=1 189 239 1.0E-05
sp|P17038|ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens GN=ZNF43 PE=2 SV=4 189 239 1.0E-05
sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=2 186 238 1.0E-05
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 189 239 1.0E-05
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 189 239 1.0E-05
sp|Q14593|ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens GN=ZNF273 PE=1 SV=3 189 239 1.0E-05
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 189 239 1.0E-05
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 189 239 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7022
MESPRAEVAGSTSHQVRQESFSAAVESRPSSGYAKSFQPRGMPPTPPMGADASFDGYSSPMTKPVSQLSGLSTAA
AGRFYETTPPLDADYRRHQMSSATPRPALRQSFSASPFPAQAPLATYYQSPVPAATASHPQISNLFYQQPLPQTF
PPLSVPVVVAPSSGANPWQHHHYLTPSHGAGYPQNQDRYICQTCNKAFSRPSSLRIHSHSHTGEKPFKCPHAGCG
KAFSVRSNMKRHERGCHSFEAGSGRSSHGQ*
Coding >Hirsu2|7022
ATGGAGTCTCCTCGAGCTGAAGTTGCGGGTTCAACTTCACACCAAGTCCGCCAAGAGTCCTTCTCTGCCGCCGTC
GAAAGCCGGCCTAGCTCTGGTTACGCGAAGTCGTTCCAGCCTAGAGGCATGCCTCCCACCCCTCCTATGGGGGCC
GACGCATCCTTCGACGGCTACAGCTCGCCCATGACCAAGCCAGTGAGCCAACTCTCGGGCCTGTCCACGGCCGCT
GCCGGTCGCTTCTACGAGACGACGCCGCCTCTGGACGCCGACTATCGTCGACATCAGATGTCGTCAGCCACGCCC
CGTCCGGCCCTCCGCCAGTCTTTCTCCGCGAGCCCCTTCCCGGCCCAGGCGCCGCTGGCCACGTACTATCAGTCT
CCGGTGCCGGCTGCCACGGCCTCTCATCCCCAGATTTCCAACCTGTTCTACCAGCAGCCTCTTCCTCAGACATTC
CCGCCGCTCTCGGTGCCGGTGGTGGTGGCTCCGTCGTCTGGCGCCAACCCGTGGCAACACCATCACTACCTTACC
CCATCGCACGGGGCTGGCTACCCGCAGAACCAGGACCGATACATCTGCCAGACTTGCAACAAGGCGTTCAGTCGC
CCAAGCAGCCTTCGCATCCACAGTCACTCCCACACGGGAGAGAAGCCGTTCAAGTGTCCCCACGCCGGATGTGGA
AAGGCCTTCAGCGTGCGGAGCAACATGAAGCGCCACGAGAGAGGCTGCCACAGCTTTGAGGCTGGCAGCGGGAGA
TCCTCACACGGTCAATGA
Transcript >Hirsu2|7022
ATGGAGTCTCCTCGAGCTGAAGTTGCGGGTTCAACTTCACACCAAGTCCGCCAAGAGTCCTTCTCTGCCGCCGTC
GAAAGCCGGCCTAGCTCTGGTTACGCGAAGTCGTTCCAGCCTAGAGGCATGCCTCCCACCCCTCCTATGGGGGCC
GACGCATCCTTCGACGGCTACAGCTCGCCCATGACCAAGCCAGTGAGCCAACTCTCGGGCCTGTCCACGGCCGCT
GCCGGTCGCTTCTACGAGACGACGCCGCCTCTGGACGCCGACTATCGTCGACATCAGATGTCGTCAGCCACGCCC
CGTCCGGCCCTCCGCCAGTCTTTCTCCGCGAGCCCCTTCCCGGCCCAGGCGCCGCTGGCCACGTACTATCAGTCT
CCGGTGCCGGCTGCCACGGCCTCTCATCCCCAGATTTCCAACCTGTTCTACCAGCAGCCTCTTCCTCAGACATTC
CCGCCGCTCTCGGTGCCGGTGGTGGTGGCTCCGTCGTCTGGCGCCAACCCGTGGCAACACCATCACTACCTTACC
CCATCGCACGGGGCTGGCTACCCGCAGAACCAGGACCGATACATCTGCCAGACTTGCAACAAGGCGTTCAGTCGC
CCAAGCAGCCTTCGCATCCACAGTCACTCCCACACGGGAGAGAAGCCGTTCAAGTGTCCCCACGCCGGATGTGGA
AAGGCCTTCAGCGTGCGGAGCAACATGAAGCGCCACGAGAGAGGCTGCCACAGCTTTGAGGCTGGCAGCGGGAGA
TCCTCACACGGTCAATGA
Gene >Hirsu2|7022
ATGGAGTCTCCTCGAGCTGAAGGTGTGTTTCCAAATCCCACGATGCCCGCAGACGGCCAACAGCCGCTGACGCAA
AGACCTGTCACAGTTGCGGGTTCAACTTCACACCAAGTCCGCCAAGAGTCCTTCTCTGCCGCCGTCGAAAGCCGG
CCTAGCTCTGGTTACGCGAAGTCGTTCCAGCCTAGAGGCATGCCTCCCACCCCTCCTATGGGGGCCGACGCATCC
TTCGACGGCTACAGCTCGCCCATGACCAAGCCAGTGAGCCAACTCTCGGGCCTGTCCACGGCCGCTGCCGGTCGC
TTCTACGAGACGACGCCGCCTCTGGACGCCGACTATCGTCGACATCAGATGTCGTCAGCCACGCCCCGTCCGGCC
CTCCGCCAGTCTTTCTCCGCGAGCCCCTTCCCGGCCCAGGCGCCGCTGGCCACGTACTATCAGTCTCCGGTGCCG
GCTGCCACGGCCTCTCATCCCCAGATTTCCAACCTGTTCTACCAGCAGCCTCTTCCTCAGACATTCCCGCCGCTC
TCGGTGCCGGTGGTGGTGGCTCCGTCGTCTGGCGCCAACCCGTGGCAACACCATCACTACCTTACCCCATCGCAC
GGGGCTGGCTACCCGCAGAACCAGGACCGATACATCTGCCAGACTTGCAACAAGGCGTTCAGTCGCCCAAGCAGC
CTTCGCATCCACAGTCACTCCCACACGGGAGAGAAGCCGTTCAAGTGTCCCCACGCCGGATGTGGAAAGGCCTTC
AGCGTGCGGAGCAACATGAAGCGCCACGAGAGAGGCTGCCACAGCTTTGAGGCTGGCAGCGGGAGATCCTCACAC
GGTCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail