Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7018
Gene name
LocationContig_388:12773..14790
Strand+
Gene length (bp)2017
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00514 Arm Armadillo/beta-catenin-like repeat 1.2E-10 114 153
PF00514 Arm Armadillo/beta-catenin-like repeat 3.9E-13 158 194
PF00514 Arm Armadillo/beta-catenin-like repeat 6.7E-12 197 238
PF00514 Arm Armadillo/beta-catenin-like repeat 1.5E-05 250 280
PF00514 Arm Armadillo/beta-catenin-like repeat 1.6E-07 282 321
PF00514 Arm Armadillo/beta-catenin-like repeat 2.8E-13 324 364
PF00514 Arm Armadillo/beta-catenin-like repeat 7.1E-13 366 405
PF00514 Arm Armadillo/beta-catenin-like repeat 1.8E-08 412 449
PF01749 IBB Importin beta binding domain 1.1E-27 10 103
PF13513 HEAT_EZ HEAT-like repeat 7.4E-09 140 193
PF16186 Arm_3 Atypical Arm repeat 2.2E-22 468 518
PF13646 HEAT_2 HEAT repeats 2.1E-08 129 230
PF02985 HEAT HEAT repeat 1.7E-05 168 194

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp1 PE=1 SV=1 1 551 0.0E+00
sp|O14063|IMA1_SCHPO Importin subunit alpha-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut15 PE=1 SV=1 2 551 0.0E+00
sp|P52294|IMA5_HUMAN Importin subunit alpha-5 OS=Homo sapiens GN=KPNA1 PE=1 SV=3 8 513 0.0E+00
sp|A2VE08|IMA5_BOVIN Importin subunit alpha-5 OS=Bos taurus GN=KPNA1 PE=2 SV=1 8 513 0.0E+00
sp|Q5ZML1|IMA5_CHICK Importin subunit alpha-5 OS=Gallus gallus GN=KPNA1 PE=2 SV=1 8 513 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94374|IMA2_SCHPO Importin subunit alpha-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp1 PE=1 SV=1 1 551 0.0E+00
sp|O14063|IMA1_SCHPO Importin subunit alpha-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut15 PE=1 SV=1 2 551 0.0E+00
sp|P52294|IMA5_HUMAN Importin subunit alpha-5 OS=Homo sapiens GN=KPNA1 PE=1 SV=3 8 513 0.0E+00
sp|A2VE08|IMA5_BOVIN Importin subunit alpha-5 OS=Bos taurus GN=KPNA1 PE=2 SV=1 8 513 0.0E+00
sp|Q5ZML1|IMA5_CHICK Importin subunit alpha-5 OS=Gallus gallus GN=KPNA1 PE=2 SV=1 8 513 0.0E+00
sp|Q56R16|IMA6_RAT Importin subunit alpha-6 OS=Rattus norvegicus GN=Kpna5 PE=2 SV=1 9 512 0.0E+00
sp|Q76P29|IMAB_DICDI Importin subunit alpha-B OS=Dictyostelium discoideum GN=DDB_G0272318 PE=3 SV=1 3 533 0.0E+00
sp|O15131|IMA6_HUMAN Importin subunit alpha-6 OS=Homo sapiens GN=KPNA5 PE=1 SV=2 9 512 0.0E+00
sp|Q503E9|IMA6_DANRE Importin subunit alpha-6 OS=Danio rerio GN=kpna5 PE=2 SV=2 9 513 0.0E+00
sp|O04294|IMPA3_ARATH Importin subunit alpha-3 OS=Arabidopsis thaliana GN=IMPA3 PE=1 SV=2 8 542 0.0E+00
sp|Q9FWY7|IMPA6_ARATH Importin subunit alpha-6 OS=Arabidopsis thaliana GN=IMPA6 PE=2 SV=1 8 542 0.0E+00
sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens GN=KPNA6 PE=1 SV=1 9 513 0.0E+00
sp|Q02821|IMA1_YEAST Importin subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP1 PE=1 SV=1 4 542 0.0E+00
sp|Q5RBV0|IMA7_PONAB Importin subunit alpha-7 OS=Pongo abelii GN=KPNA6 PE=2 SV=1 9 513 0.0E+00
sp|Q96321|IMPA1_ARATH Importin subunit alpha-1 OS=Arabidopsis thaliana GN=IMPA1 PE=1 SV=2 8 543 0.0E+00
sp|Q9SLX0|IMA1B_ORYSJ Importin subunit alpha-1b OS=Oryza sativa subsp. japonica GN=Os05g0155500 PE=1 SV=2 8 542 0.0E+00
sp|Q71VM4|IMA1A_ORYSJ Importin subunit alpha-1a OS=Oryza sativa subsp. japonica GN=Os01g0253300 PE=1 SV=2 8 535 0.0E+00
sp|O80480|IMPA4_ARATH Importin subunit alpha-4 OS=Arabidopsis thaliana GN=IMPA4 PE=1 SV=1 17 543 0.0E+00
sp|O22478|IMA_SOLLC Importin subunit alpha OS=Solanum lycopersicum PE=2 SV=2 8 543 0.0E+00
sp|O35345|IMA7_MOUSE Importin subunit alpha-7 OS=Mus musculus GN=Kpna6 PE=1 SV=2 9 513 0.0E+00
sp|Q0V7M0|IMA7_BOVIN Importin subunit alpha-7 OS=Bos taurus GN=KPNA6 PE=2 SV=1 9 513 0.0E+00
sp|F4JL11|IMPA2_ARATH Importin subunit alpha-2 OS=Arabidopsis thaliana GN=IMPA2 PE=1 SV=1 8 542 0.0E+00
sp|Q5R909|IMA5_PONAB Importin subunit alpha-5 OS=Pongo abelii GN=KPNA1 PE=2 SV=1 8 513 1.0E-180
sp|P83953|IMA5_RAT Importin subunit alpha-5 OS=Rattus norvegicus GN=Kpna1 PE=1 SV=1 8 513 5.0E-180
sp|Q60960|IMA5_MOUSE Importin subunit alpha-5 OS=Mus musculus GN=Kpna1 PE=1 SV=2 8 513 7.0E-179
sp|Q9FJ09|IMPA5_ARATH Importin subunit alpha-5 OS=Arabidopsis thaliana GN=IMPA5 PE=2 SV=1 8 530 9.0E-176
sp|O00629|IMA3_HUMAN Importin subunit alpha-3 OS=Homo sapiens GN=KPNA4 PE=1 SV=1 9 542 8.0E-162
sp|O35343|IMA3_MOUSE Importin subunit alpha-3 OS=Mus musculus GN=Kpna4 PE=1 SV=1 9 542 1.0E-161
sp|O35344|IMA4_MOUSE Importin subunit alpha-4 OS=Mus musculus GN=Kpna3 PE=1 SV=1 9 542 5.0E-159
sp|O00505|IMA4_HUMAN Importin subunit alpha-4 OS=Homo sapiens GN=KPNA3 PE=1 SV=2 1 542 1.0E-158
sp|Q9M9X7|IMPA7_ARATH Importin subunit alpha-7 OS=Arabidopsis thaliana GN=IMPA7 PE=2 SV=1 26 506 3.0E-152
sp|P52293|IMA1_MOUSE Importin subunit alpha-1 OS=Mus musculus GN=Kpna2 PE=1 SV=2 6 542 3.0E-150
sp|P52292|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens GN=KPNA2 PE=1 SV=1 7 542 7.0E-150
sp|Q19969|IMA3_CAEEL Importin subunit alpha-3 OS=Caenorhabditis elegans GN=ima-3 PE=1 SV=2 13 530 2.0E-145
sp|P52171|IMA1_XENLA Importin subunit alpha-1 OS=Xenopus laevis GN=kpna2 PE=1 SV=2 10 542 7.0E-142
sp|P52170|IMA5_XENLA Importin subunit alpha-5 OS=Xenopus laevis GN=kpna1 PE=1 SV=2 10 542 5.0E-141
sp|A9QM74|IMA8_HUMAN Importin subunit alpha-8 OS=Homo sapiens GN=KPNA7 PE=1 SV=1 7 519 9.0E-128
sp|C1JZ66|IMA8_BOVIN Importin subunit alpha-8 OS=Bos taurus GN=KPNA7 PE=1 SV=2 7 513 3.0E-121
sp|P52295|IMA_DROME Importin subunit alpha OS=Drosophila melanogaster GN=Pen PE=1 SV=2 10 542 4.0E-121
sp|Q557F4|IMA1A_DICDI Probable importin subunit alpha-A OS=Dictyostelium discoideum GN=DDB_G0273149 PE=3 SV=1 1 529 9.0E-121
sp|C6K7I2|IMA8_PIG Importin subunit alpha-8 OS=Sus scrofa GN=KPNA7 PE=2 SV=2 7 509 2.0E-118
sp|Q9FJ92|IMPA8_ARATH Importin subunit alpha-8 OS=Arabidopsis thaliana GN=IMPA8 PE=3 SV=1 76 502 8.0E-109
sp|C0LLJ0|IMA8_MOUSE Importin subunit alpha-8 OS=Mus musculus GN=Kpna7 PE=1 SV=1 1 511 2.0E-107
sp|P91276|IMA2_CAEEL Importin subunit alpha-2 OS=Caenorhabditis elegans GN=ima-2 PE=1 SV=1 17 527 1.0E-96
sp|F4KF65|IMPA9_ARATH Importin subunit alpha-9 OS=Arabidopsis thaliana GN=IMPA9 PE=3 SV=1 27 509 1.0E-43
sp|Q9FYP9|IMAP2_ORYSJ Importin subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os01g0158000 PE=2 SV=1 8 509 2.0E-42
sp|Q22560|IMA1_CAEEL Importin subunit alpha-1 OS=Caenorhabditis elegans GN=ima-1 PE=1 SV=1 1 509 5.0E-20
sp|Q5EFZ4|VAC8_PICPA Vacuolar protein 8 OS=Komagataella pastoris GN=VAC8 PE=3 SV=3 90 402 2.0E-18
sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vac8 PE=3 SV=1 73 431 1.0E-16
sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vac8 PE=3 SV=1 81 431 2.0E-16
sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 90 402 4.0E-16
sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VAC8 PE=3 SV=1 90 454 5.0E-16
sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VAC8 PE=3 SV=1 91 402 3.0E-14
sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VAC8 PE=3 SV=1 91 402 3.0E-14
sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vac8 PE=3 SV=4 90 402 4.0E-14
sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VAC8 PE=3 SV=4 90 402 5.0E-14
sp|Q6CX49|VAC8_KLULA Vacuolar protein 8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VAC8 PE=3 SV=3 90 434 7.0E-14
sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VAC8 PE=3 SV=3 90 402 9.0E-14
sp|P39968|VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC8 PE=1 SV=3 83 457 2.0E-13
sp|Q9JLI7|SPAG6_MOUSE Sperm-associated antigen 6 OS=Mus musculus GN=Spag6 PE=1 SV=1 51 395 6.0E-13
sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VAC8 PE=3 SV=1 83 406 6.0E-12
sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VAC8 PE=3 SV=1 83 406 6.0E-12
sp|Q757R0|VAC8_ASHGO Vacuolar protein 8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VAC8 PE=3 SV=3 83 402 1.0E-11
sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapiens GN=SPAG6 PE=2 SV=1 51 390 2.0E-11
sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 83 401 2.0E-11
sp|O43028|VAC8_SCHPO Vacuolar protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vac8 PE=1 SV=4 91 401 3.0E-11
sp|Q9JLI7|SPAG6_MOUSE Sperm-associated antigen 6 OS=Mus musculus GN=Spag6 PE=1 SV=1 271 451 1.0E-10
sp|Q9JLI7|SPAG6_MOUSE Sperm-associated antigen 6 OS=Mus musculus GN=Spag6 PE=1 SV=1 100 376 1.0E-10
sp|P39968|VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC8 PE=1 SV=3 83 383 2.0E-10
sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 161 401 2.0E-10
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 116 401 3.0E-10
sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 114 313 1.0E-09
sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VAC8 PE=3 SV=3 90 402 1.0E-09
sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 169 463 1.0E-09
sp|Q5EFZ4|VAC8_PICPA Vacuolar protein 8 OS=Komagataella pastoris GN=VAC8 PE=3 SV=3 83 391 2.0E-09
sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapiens GN=SPAG6 PE=2 SV=1 271 451 2.0E-09
sp|Q6FJV1|VAC8_CANGA Vacuolar protein 8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VAC8 PE=3 SV=3 124 463 3.0E-09
sp|Q6FJV1|VAC8_CANGA Vacuolar protein 8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VAC8 PE=3 SV=3 83 383 5.0E-09
sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VAC8 PE=3 SV=1 86 406 6.0E-09
sp|Q757R0|VAC8_ASHGO Vacuolar protein 8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VAC8 PE=3 SV=3 83 383 7.0E-09
sp|Q6CX49|VAC8_KLULA Vacuolar protein 8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VAC8 PE=3 SV=3 83 457 2.0E-08
sp|Q7RXW1|VAC8_NEUCR Vacuolar protein 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vac8 PE=3 SV=4 83 406 2.0E-08
sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VAC8 PE=3 SV=1 174 483 6.0E-08
sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VAC8 PE=3 SV=1 174 483 6.0E-08
sp|O75602|SPAG6_HUMAN Sperm-associated antigen 6 OS=Homo sapiens GN=SPAG6 PE=2 SV=1 100 383 6.0E-08
sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VAC8 PE=3 SV=3 83 359 2.0E-07
sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 124 217 2.0E-07
sp|Q2GW27|VAC8_CHAGB Vacuolar protein 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VAC8 PE=3 SV=3 83 401 3.0E-07
sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vac8 PE=3 SV=1 45 320 4.0E-07
sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VAC8 PE=3 SV=4 83 359 7.0E-07
sp|Q6BTZ4|VAC8_DEBHA Vacuolar protein 8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VAC8 PE=3 SV=4 205 403 7.0E-07
sp|Q59MN0|VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VAC8 PE=3 SV=3 205 403 8.0E-07
sp|A2RT91|ANKAR_MOUSE Ankyrin and armadillo repeat-containing protein OS=Mus musculus GN=Ankar PE=2 SV=1 120 383 2.0E-06
sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabidopsis thaliana GN=PUB4 PE=1 SV=3 126 402 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006606 protein import into nucleus Yes
GO:0005515 protein binding Yes
GO:0061608 nuclear import signal receptor activity Yes
GO:0006913 nucleocytoplasmic transport No
GO:0005488 binding No
GO:0140104 molecular carrier activity No
GO:0008150 biological_process No
GO:0033365 protein localization to organelle No
GO:0071705 nitrogen compound transport No
GO:0015833 peptide transport No
GO:0006810 transport No
GO:0045184 establishment of protein localization No
GO:0003674 molecular_function No
GO:0140142 nucleocytoplasmic carrier activity No
GO:0006886 intracellular protein transport No
GO:0017038 protein import No
GO:0051649 establishment of localization in cell No
GO:0051641 cellular localization No
GO:0051170 import into nucleus No
GO:0008104 protein localization No
GO:0034504 protein localization to nucleus No
GO:0033036 macromolecule localization No
GO:0046907 intracellular transport No
GO:0051179 localization No
GO:0015031 protein transport No
GO:0072594 establishment of protein localization to organelle No
GO:0042886 amide transport No
GO:0051169 nuclear transport No
GO:0051234 establishment of localization No
GO:0070727 cellular macromolecule localization No
GO:0034613 cellular protein localization No
GO:0071702 organic substance transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7018
MAERYIPEHRRTQFKAKNTFKPEELRRRREEQQVEIRKAKREENLAKRRGIGTGENRPGASLGAAPDSDDESAPT
ESQLNEDLPQMVQGVFSDQIDLQIQATTKFRKLLSKERNPPIEEVIKTGVVSRFVEFLRSPHTLVQFEAAWALTN
IASGSATQTQVVIEAGAVPIFVELLASPEPDVREQAVWALGNIAGDSPHCRDYVLSCGALKPLLNLLGDSRKLSM
LRNATWTLSNFCRGKTPQPDWNTIAPALPILSKLVYSLDDEVLIDACWAISYLSDGSNDKIQAVIEAGIPRRLVE
LLMHASTSVQTPALRSVGNIVTGDDVQTQVIINCGALPCLLSLLSSTKDGIRKEACWTISNITAGNSSQIQSVID
ANIIPPLIHLLQNGDLKTRKEACWAISNATSGGLQKPEQIRYLVSQGCIKPLCDLLSCPDNKIIQVALDGLENIL
KIGDLDKQAAGDSAESINRYALFIEECGGMEKIHECQNNANEEIYVKSYHIIEKYFSDEGENADEGMAQPAGPNG
TFGFGTNGPAQSGGFNFANGGDSMDM*
Coding >Hirsu2|7018
ATGGCAGAGCGATACATCCCCGAGCACCGCCGGACGCAGTTCAAGGCCAAAAACACATTCAAGCCTGAGGAGCTT
CGTCGCCGCCGCGAGGAGCAGCAGGTTGAGATCCGCAAAGCGAAGCGAGAGGAGAACTTGGCCAAGCGACGGGGT
ATCGGCACTGGCGAGAACCGCCCTGGTGCGTCGCTGGGTGCTGCTCCCGACAGCGACGATGAGTCGGCACCCACG
GAATCGCAGTTGAACGAGGATCTTCCTCAGATGGTGCAGGGCGTCTTCTCAGACCAAATCGACTTGCAGATCCAA
GCCACCACCAAGTTCAGAAAACTCCTGTCCAAGGAGCGAAACCCCCCCATCGAGGAGGTTATCAAGACTGGTGTC
GTCAGCCGCTTTGTCGAGTTCCTGCGCTCCCCCCACACCCTCGTGCAATTCGAGGCCGCGTGGGCCTTGACCAAC
ATCGCCTCTGGCTCGGCTACACAGACGCAAGTCGTCATCGAGGCTGGCGCCGTCCCCATCTTTGTCGAGCTGCTT
GCCAGCCCGGAGCCCGATGTCAGAGAACAGGCCGTCTGGGCCCTCGGCAACATCGCAGGCGACAGTCCTCACTGC
CGCGACTACGTCCTGAGCTGCGGCGCCCTGAAGCCGCTGCTCAACCTGCTGGGGGACAGCCGCAAGCTGAGCATG
CTGCGTAATGCCACATGGACTCTCAGCAACTTTTGCCGAGGCAAGACGCCGCAGCCTGATTGGAACACCATTGCG
CCCGCTCTTCCAATTCTCTCCAAACTGGTCTACTCGTTGGATGACGAGGTCTTGATTGACGCTTGCTGGGCCATT
TCGTATCTTTCGGATGGTTCCAACGACAAGATCCAAGCCGTCATCGAGGCCGGCATCCCGCGCAGGCTGGTGGAG
CTGCTCATGCACGCATCCACTTCAGTCCAGACCCCTGCGCTGCGCTCTGTGGGCAACATCGTCACGGGCGACGAC
GTCCAGACTCAGGTCATCATCAACTGCGGCGCGCTGCCTTGCCTCCTGTCTCTCCTGAGCTCCACCAAGGATGGC
ATTCGCAAGGAAGCATGTTGGACCATCTCAAACATTACAGCCGGGAATTCGTCCCAGATCCAGTCCGTCATTGAC
GCCAACATCATCCCGCCGCTCATCCATCTCCTCCAAAATGGGGACCTGAAGACGCGCAAGGAAGCTTGCTGGGCC
ATCAGCAACGCCACCTCGGGCGGCCTGCAGAAGCCGGAGCAGATCCGATACCTGGTTTCGCAGGGCTGCATCAAG
CCGCTGTGCGACCTCCTCTCGTGCCCTGACAACAAGATTATCCAGGTTGCCCTCGACGGCCTAGAGAACATTCTC
AAGATTGGCGACCTCGACAAGCAAGCGGCCGGTGACAGCGCCGAATCGATCAACCGCTACGCCCTGTTCATCGAG
GAATGCGGCGGCATGGAGAAGATCCACGAGTGCCAGAACAACGCCAACGAGGAGATCTACGTCAAGTCGTACCAC
ATCATTGAGAAGTACTTCTCGGACGAGGGCGAGAATGCCGACGAGGGCATGGCTCAGCCGGCCGGGCCCAACGGC
ACCTTTGGCTTCGGTACCAATGGCCCGGCCCAGTCTGGCGGCTTCAACTTCGCCAACGGGGGTGACTCGATGGAC
ATGTAG
Transcript >Hirsu2|7018
ATGGCAGAGCGATACATCCCCGAGCACCGCCGGACGCAGTTCAAGGCCAAAAACACATTCAAGCCTGAGGAGCTT
CGTCGCCGCCGCGAGGAGCAGCAGGTTGAGATCCGCAAAGCGAAGCGAGAGGAGAACTTGGCCAAGCGACGGGGT
ATCGGCACTGGCGAGAACCGCCCTGGTGCGTCGCTGGGTGCTGCTCCCGACAGCGACGATGAGTCGGCACCCACG
GAATCGCAGTTGAACGAGGATCTTCCTCAGATGGTGCAGGGCGTCTTCTCAGACCAAATCGACTTGCAGATCCAA
GCCACCACCAAGTTCAGAAAACTCCTGTCCAAGGAGCGAAACCCCCCCATCGAGGAGGTTATCAAGACTGGTGTC
GTCAGCCGCTTTGTCGAGTTCCTGCGCTCCCCCCACACCCTCGTGCAATTCGAGGCCGCGTGGGCCTTGACCAAC
ATCGCCTCTGGCTCGGCTACACAGACGCAAGTCGTCATCGAGGCTGGCGCCGTCCCCATCTTTGTCGAGCTGCTT
GCCAGCCCGGAGCCCGATGTCAGAGAACAGGCCGTCTGGGCCCTCGGCAACATCGCAGGCGACAGTCCTCACTGC
CGCGACTACGTCCTGAGCTGCGGCGCCCTGAAGCCGCTGCTCAACCTGCTGGGGGACAGCCGCAAGCTGAGCATG
CTGCGTAATGCCACATGGACTCTCAGCAACTTTTGCCGAGGCAAGACGCCGCAGCCTGATTGGAACACCATTGCG
CCCGCTCTTCCAATTCTCTCCAAACTGGTCTACTCGTTGGATGACGAGGTCTTGATTGACGCTTGCTGGGCCATT
TCGTATCTTTCGGATGGTTCCAACGACAAGATCCAAGCCGTCATCGAGGCCGGCATCCCGCGCAGGCTGGTGGAG
CTGCTCATGCACGCATCCACTTCAGTCCAGACCCCTGCGCTGCGCTCTGTGGGCAACATCGTCACGGGCGACGAC
GTCCAGACTCAGGTCATCATCAACTGCGGCGCGCTGCCTTGCCTCCTGTCTCTCCTGAGCTCCACCAAGGATGGC
ATTCGCAAGGAAGCATGTTGGACCATCTCAAACATTACAGCCGGGAATTCGTCCCAGATCCAGTCCGTCATTGAC
GCCAACATCATCCCGCCGCTCATCCATCTCCTCCAAAATGGGGACCTGAAGACGCGCAAGGAAGCTTGCTGGGCC
ATCAGCAACGCCACCTCGGGCGGCCTGCAGAAGCCGGAGCAGATCCGATACCTGGTTTCGCAGGGCTGCATCAAG
CCGCTGTGCGACCTCCTCTCGTGCCCTGACAACAAGATTATCCAGGTTGCCCTCGACGGCCTAGAGAACATTCTC
AAGATTGGCGACCTCGACAAGCAAGCGGCCGGTGACAGCGCCGAATCGATCAACCGCTACGCCCTGTTCATCGAG
GAATGCGGCGGCATGGAGAAGATCCACGAGTGCCAGAACAACGCCAACGAGGAGATCTACGTCAAGTCGTACCAC
ATCATTGAGAAGTACTTCTCGGACGAGGGCGAGAATGCCGACGAGGGCATGGCTCAGCCGGCCGGGCCCAACGGC
ACCTTTGGCTTCGGTACCAATGGCCCGGCCCAGTCTGGCGGCTTCAACTTCGCCAACGGGGGTGACTCGATGGAC
ATGTAG
Gene >Hirsu2|7018
ATGGCAGAGCGATACATCCCCGAGCACCGCCGGACGCAGTTCAAGGCCAAAAACACATTCAAGCCTGAGGAGCTT
CGTCGCCGCCGCGAGGAGCAGCAGGTTGAGATCCGCAAAGCGAAGCGAGAGGAGAACTTGGCCAAGCGACGGGGT
ATCGGCACTGGCGAGAACCGCCCTGGTGCGTCGCTGGGTGCTGCTCCCGACAGCGACGATGAGTCGGCACCCACG
GAATCGCAGGTAAGCAAATGGCCTTCTCTTGCGTCGCCCGTTTTTCTGCCCTCCTGGCGGTTTTGCCTCCGCCCG
GGCGGAGGCGAGCACTCGTTCCCACACCCTCGTCGGTGTGCGTCAAGACCCATGTGGGGGAGCCGAGCATGCGCT
GCTCTGACCCCACACTCCTTCTGCTTCCCGACGGCACCATCTTATGAAAACAAGATGCATAACATGAGGCTGCCG
CGGGGGCCCATCCTTTCCCCATTGCCCTGGTTTCTTTGCCAACGTCGGCGCTGCGTCATGTCGCTGACCATGTGC
CCAGTTGAACGAGGATCTTCCTCAGATGGTGCAGGGCGTCTTCTCAGACCAAATCGACTTGCAGATCCAAGCCAC
CACCAAGTTCAGAAAACTCCTGTCCAAGGAGCGAAACCCCCCCATCGAGGAGGTTATCAAGACTGGTGTCGTCAG
CCGCTTTGTCGAGTTCCTGCGCTCCCCCCACACCCTCGTGCAATTCGAGGCCGCGTGGGCCTTGACCAACATCGC
CTCTGGCTCGGCTACACAGACGCAAGTCGTCATCGAGGCTGGCGCCGTCCCCATCTTTGTCGAGCTGCTTGCCAG
CCCGGAGCCCGATGTCAGAGAACAGGCCGTCTGGGCCCTCGGCAACATCGCAGGCGACAGTCCTCACTGCCGCGA
CTACGTCCTGAGCTGCGGCGCCCTGAAGCCGCTGCTCAACCTGCTGGGGGACAGCCGCAAGCTGAGCATGCTGCG
TAATGCCACATGGACTCTCAGCAACTTTTGCCGAGGCAAGACGCCGCAGCCTGATTGGAACACCGTATGGCCCCT
GTCCGCCTCCTCCCCTTGCCTTCGCGCCGGTTGCTTACCCCCCATTGACCGTCAGATTGCGCCCGCTCTTCCAAT
TCTCTCCAAACTGGTCTACTCGTTGGATGACGAGGTCTTGATTGACGCTTGCTGGGCCATTTCGTATCTTTCGGA
TGGTTCCAACGACAAGATCCAAGCCGTCATCGAGGCCGGCATCCCGCGCAGGCTGGTGGAGCTGCTCATGCACGC
ATCCACTTCAGTCCAGACCCCTGCGCTGCGCTCTGTGGGCAACATCGTCACGGGCGACGACGTCCAGACTCAGGT
CATCATCAACTGCGGCGCGCTGCCTTGCCTCCTGTCTCTCCTGAGCTCCACCAAGGATGGCATTCGCAAGGAAGC
ATGTTGGACCATCTCAAACATTACAGCCGGGAATTCGTCCCAGATCCAGTCCGTCATTGACGCCAACATCATCCC
GCCGCTCATCCATCTCCTCCAAAATGGGGACCTGAAGACGCGCAAGGAAGCTTGCTGGGCCATCAGCAACGCCAC
CTCGGGCGGCCTGCAGAAGCCGGAGCAGATCCGATACCTGGTTTCGCAGGGCTGCATCAAGCCGCTGTGCGACCT
CCTCTCGTGCCCTGACAACAAGATTATCCAGGTTGCCCTCGACGGCCTAGAGAACATTCTCAAGATTGGCGACCT
CGACAAGCAAGCGGCCGGTGACAGCGCCGAATCGATCAACCGCTACGCCCTGTTCATCGAGGAATGCGGCGGCAT
GGAGAAGATCCACGAGTGCCAGAACAACGCCAACGAGGAGATCTACGTCAAGTCGTACCACATCATTGAGAAGTA
CTTCTCGGACGAGGGCGAGAATGCCGACGAGGGCATGGCTCAGCCGGCCGGGCCCAACGGCACCTTTGGCTTCGG
TACCAATGGCCCGGCCCAGTCTGGCGGCTTCAACTTCGCCAACGGGGGTGACTCGATGGACATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail