Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|701
Gene name
LocationContig_1141:5980..6745
Strand-
Gene length (bp)765
Transcript length (bp)765
Coding sequence length (bp)765
Protein length (aa) 255

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04847 Calcipressin Calcipressin 5.5E-50 49 248

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RES7|RCAN1_PONAB Calcipressin-1 OS=Pongo abelii GN=RCAN1 PE=2 SV=1 72 170 4.0E-09
sp|P53806|RCANL_CAEEL Calcipressin-like protein OS=Caenorhabditis elegans GN=rcn-1 PE=1 SV=2 38 178 5.0E-09
sp|Q6XXM7|RCAN1_SHEEP Calcipressin-1 OS=Ovis aries GN=RCAN1 PE=2 SV=1 72 170 6.0E-09
sp|Q3ZBP4|RCAN1_BOVIN Calcipressin-1 OS=Bos taurus GN=RCAN1 PE=2 SV=1 72 170 6.0E-09
sp|Q3ZC15|RCAN2_BOVIN Calcipressin-2 OS=Bos taurus GN=RCAN2 PE=2 SV=1 72 170 8.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RES7|RCAN1_PONAB Calcipressin-1 OS=Pongo abelii GN=RCAN1 PE=2 SV=1 72 170 4.0E-09
sp|P53806|RCANL_CAEEL Calcipressin-like protein OS=Caenorhabditis elegans GN=rcn-1 PE=1 SV=2 38 178 5.0E-09
sp|Q6XXM7|RCAN1_SHEEP Calcipressin-1 OS=Ovis aries GN=RCAN1 PE=2 SV=1 72 170 6.0E-09
sp|Q3ZBP4|RCAN1_BOVIN Calcipressin-1 OS=Bos taurus GN=RCAN1 PE=2 SV=1 72 170 6.0E-09
sp|Q3ZC15|RCAN2_BOVIN Calcipressin-2 OS=Bos taurus GN=RCAN2 PE=2 SV=1 72 170 8.0E-09
sp|Q6IN33|RCAN1_RAT Calcipressin-1 OS=Rattus norvegicus GN=Rcan1 PE=2 SV=1 72 170 8.0E-09
sp|O35847|RCAN1_CRIGR Calcipressin-1 OS=Cricetulus griseus GN=RCAN1 PE=2 SV=1 72 170 8.0E-09
sp|Q9JHG6|RCAN1_MOUSE Calcipressin-1 OS=Mus musculus GN=Rcan1 PE=1 SV=1 72 170 8.0E-09
sp|A5A6I8|RCAN2_PANTR Calcipressin-2 OS=Pan troglodytes GN=RCAN2 PE=2 SV=2 72 170 1.0E-08
sp|Q8CH27|RCAN2_RAT Calcipressin-2 OS=Rattus norvegicus GN=Rcan2 PE=2 SV=1 72 170 1.0E-08
sp|Q14206|RCAN2_HUMAN Calcipressin-2 OS=Homo sapiens GN=RCAN2 PE=2 SV=3 72 170 1.0E-08
sp|Q5RE25|RCAN2_PONAB Calcipressin-2 OS=Pongo abelii GN=RCAN2 PE=2 SV=1 72 170 1.0E-08
sp|Q4R4P5|RCAN2_MACFA Calcipressin-2 OS=Macaca fascicularis GN=RCAN2 PE=2 SV=1 72 170 1.0E-08
sp|P53805|RCAN1_HUMAN Calcipressin-1 OS=Homo sapiens GN=RCAN1 PE=1 SV=4 72 170 2.0E-08
sp|Q9JHG2|RCAN2_MOUSE Calcipressin-2 OS=Mus musculus GN=Rcan2 PE=1 SV=1 72 170 3.0E-08
sp|Q9XZL8|SRA_DROME Protein sarah OS=Drosophila melanogaster GN=sra PE=1 SV=1 39 170 2.0E-07
sp|Q9JKK0|RCAN3_MOUSE Calcipressin-3 OS=Mus musculus GN=Rcan3 PE=2 SV=1 72 170 1.0E-06
sp|Q2KIA1|RCAN3_BOVIN Calcipressin-3 OS=Bos taurus GN=RCAN3 PE=2 SV=1 22 170 1.0E-06
sp|Q5ZJV6|RCAN3_CHICK Calcipressin-3 OS=Gallus gallus GN=RCAN3 PE=2 SV=2 72 170 3.0E-06
sp|Q9UKA8|RCAN3_HUMAN Calcipressin-3 OS=Homo sapiens GN=RCAN3 PE=1 SV=1 72 170 5.0E-06
sp|Q09791|YA9F_SCHPO Uncharacterized protein C13G6.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13G6.15c PE=3 SV=1 53 170 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0019722 calcium-mediated signaling Yes
GO:0007165 signal transduction No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0035556 intracellular signal transduction No
GO:0019932 second-messenger-mediated signaling No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|701
MEPSPRSSRSSSSASRKANLTLDLSALPPLTQPTPPSNTLLFTNINATDVFRPDNLQTIRNLIAKTAPIHAFAPL
KSFRRIVVSFFDVDAAIAVRRTWNGKAVFGERLKVYFGQPTPVHSKDEHLALPDAGKLFFISPPPSPPHGWEMRL
EDAPNKMVHADDLADALARLHHHNPDGLESPLSPSDSSLSGGRTRSRSSTLIWHPDNNGCSPDLPAVFVVDMTEE
PTEMSPLEKPSRPIMAHTARPPVELMRDA*
Coding >Hirsu2|701
ATGGAGCCGTCGCCACGATCCTCGCGCTCCTCCTCGTCAGCCTCCCGCAAAGCCAATCTCACCCTCGACCTGTCC
GCCTTGCCGCCCCTGACGCAGCCGACGCCGCCGTCCAACACGCTGCTCTTCACAAACATCAACGCCACCGACGTC
TTCCGCCCGGACAACCTGCAGACCATCCGCAACCTGATCGCCAAGACGGCGCCCATCCACGCCTTCGCGCCCCTC
AAGTCCTTCCGCCGCATCGTCGTCTCCTTCTTCGACGTCGACGCCGCCATCGCCGTCCGCCGCACCTGGAACGGC
AAGGCCGTTTTCGGCGAGCGCCTCAAGGTCTATTTCGGCCAGCCCACGCCCGTCCACTCCAAGGACGAGCATCTG
GCCCTGCCCGACGCCGGCAAGCTCTTCTTCATCTCGCCGCCGCCCAGCCCGCCGCACGGCTGGGAGATGCGTCTC
GAGGACGCGCCCAATAAGATGGTCCACGCCGACGACCTGGCCGACGCCCTGGCCCGCCTGCACCACCACAATCCC
GACGGCCTCGAGTCTCCGCTGAGCCCGAGCGACAGCTCCCTGTCCGGCGGCCGCACCCGCAGTCGCAGCTCTACC
CTCATCTGGCACCCGGACAACAACGGCTGCAGCCCCGACCTGCCCGCCGTCTTCGTCGTCGACATGACGGAGGAG
CCCACCGAGATGAGCCCCTTGGAAAAGCCGTCGCGCCCCATCATGGCCCACACGGCTCGGCCGCCTGTCGAGCTC
ATGCGCGACGCATAA
Transcript >Hirsu2|701
ATGGAGCCGTCGCCACGATCCTCGCGCTCCTCCTCGTCAGCCTCCCGCAAAGCCAATCTCACCCTCGACCTGTCC
GCCTTGCCGCCCCTGACGCAGCCGACGCCGCCGTCCAACACGCTGCTCTTCACAAACATCAACGCCACCGACGTC
TTCCGCCCGGACAACCTGCAGACCATCCGCAACCTGATCGCCAAGACGGCGCCCATCCACGCCTTCGCGCCCCTC
AAGTCCTTCCGCCGCATCGTCGTCTCCTTCTTCGACGTCGACGCCGCCATCGCCGTCCGCCGCACCTGGAACGGC
AAGGCCGTTTTCGGCGAGCGCCTCAAGGTCTATTTCGGCCAGCCCACGCCCGTCCACTCCAAGGACGAGCATCTG
GCCCTGCCCGACGCCGGCAAGCTCTTCTTCATCTCGCCGCCGCCCAGCCCGCCGCACGGCTGGGAGATGCGTCTC
GAGGACGCGCCCAATAAGATGGTCCACGCCGACGACCTGGCCGACGCCCTGGCCCGCCTGCACCACCACAATCCC
GACGGCCTCGAGTCTCCGCTGAGCCCGAGCGACAGCTCCCTGTCCGGCGGCCGCACCCGCAGTCGCAGCTCTACC
CTCATCTGGCACCCGGACAACAACGGCTGCAGCCCCGACCTGCCCGCCGTCTTCGTCGTCGACATGACGGAGGAG
CCCACCGAGATGAGCCCCTTGGAAAAGCCGTCGCGCCCCATCATGGCCCACACGGCTCGGCCGCCTGTCGAGCTC
ATGCGCGACGCATAA
Gene >Hirsu2|701
ATGGAGCCGTCGCCACGATCCTCGCGCTCCTCCTCGTCAGCCTCCCGCAAAGCCAATCTCACCCTCGACCTGTCC
GCCTTGCCGCCCCTGACGCAGCCGACGCCGCCGTCCAACACGCTGCTCTTCACAAACATCAACGCCACCGACGTC
TTCCGCCCGGACAACCTGCAGACCATCCGCAACCTGATCGCCAAGACGGCGCCCATCCACGCCTTCGCGCCCCTC
AAGTCCTTCCGCCGCATCGTCGTCTCCTTCTTCGACGTCGACGCCGCCATCGCCGTCCGCCGCACCTGGAACGGC
AAGGCCGTTTTCGGCGAGCGCCTCAAGGTCTATTTCGGCCAGCCCACGCCCGTCCACTCCAAGGACGAGCATCTG
GCCCTGCCCGACGCCGGCAAGCTCTTCTTCATCTCGCCGCCGCCCAGCCCGCCGCACGGCTGGGAGATGCGTCTC
GAGGACGCGCCCAATAAGATGGTCCACGCCGACGACCTGGCCGACGCCCTGGCCCGCCTGCACCACCACAATCCC
GACGGCCTCGAGTCTCCGCTGAGCCCGAGCGACAGCTCCCTGTCCGGCGGCCGCACCCGCAGTCGCAGCTCTACC
CTCATCTGGCACCCGGACAACAACGGCTGCAGCCCCGACCTGCCCGCCGTCTTCGTCGTCGACATGACGGAGGAG
CCCACCGAGATGAGCCCCTTGGAAAAGCCGTCGCGCCCCATCATGGCCCACACGGCTCGGCCGCCTGTCGAGCTC
ATGCGCGACGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail