Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7007
Gene name
LocationContig_386:18827..20702
Strand+
Gene length (bp)1875
Transcript length (bp)1719
Coding sequence length (bp)1719
Protein length (aa) 573

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 9.5E-75 18 403
PF06723 MreB_Mbl MreB/Mbl protein 1.6E-07 133 260

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38788|SSZ1_YEAST Ribosome-associated complex subunit SSZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSZ1 PE=1 SV=2 19 569 1.0E-142
sp|P87142|YDMC_SCHPO Heat shock protein 70 homolog C57A7.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.12 PE=1 SV=3 16 570 1.0E-132
sp|Q75C78|GRP78_ASHGO 78 kDa glucose-regulated protein homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KAR2 PE=3 SV=1 19 474 3.0E-60
sp|Q5RGE6|HSP7E_DANRE Heat shock 70 kDa protein 14 OS=Danio rerio GN=hspa14 PE=2 SV=1 18 454 4.0E-60
sp|Q96W30|HSP72_PARBA Heat shock 70 kDa protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-2 PE=2 SV=2 18 474 5.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38788|SSZ1_YEAST Ribosome-associated complex subunit SSZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSZ1 PE=1 SV=2 19 569 1.0E-142
sp|P87142|YDMC_SCHPO Heat shock protein 70 homolog C57A7.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.12 PE=1 SV=3 16 570 1.0E-132
sp|Q75C78|GRP78_ASHGO 78 kDa glucose-regulated protein homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KAR2 PE=3 SV=1 19 474 3.0E-60
sp|Q5RGE6|HSP7E_DANRE Heat shock 70 kDa protein 14 OS=Danio rerio GN=hspa14 PE=2 SV=1 18 454 4.0E-60
sp|Q96W30|HSP72_PARBA Heat shock 70 kDa protein 2 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-2 PE=2 SV=2 18 474 5.0E-59
sp|Q5FVX7|HSP7E_XENTR Heat shock 70 kDa protein 14 OS=Xenopus tropicalis GN=hspa14 PE=2 SV=1 18 475 3.0E-58
sp|Q01877|HSP71_PUCGR Heat shock protein HSS1 OS=Puccinia graminis GN=HSS1 PE=3 SV=1 18 474 1.0E-57
sp|P22010|GRP78_KLULA 78 kDa glucose-regulated protein homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GRP78 PE=3 SV=1 19 474 1.0E-57
sp|Q54BE0|HS7C3_DICDI Heat shock cognate 70 kDa protein 3 OS=Dictyostelium discoideum GN=DDB_G0293674 PE=3 SV=1 18 474 2.0E-57
sp|P08418|HSP70_SCHMA Heat shock 70 kDa protein homolog OS=Schistosoma mansoni PE=2 SV=2 18 474 2.0E-57
sp|Q71U34|HSP7C_SAGOE Heat shock cognate 71 kDa protein OS=Saguinus oedipus GN=HSPA8 PE=2 SV=1 18 474 3.0E-57
sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 18 474 3.0E-57
sp|A2Q0Z1|HSP7C_HORSE Heat shock cognate 71 kDa protein OS=Equus caballus GN=HSPA8 PE=2 SV=1 18 474 3.0E-57
sp|P63018|HSP7C_RAT Heat shock cognate 71 kDa protein OS=Rattus norvegicus GN=Hspa8 PE=1 SV=1 18 474 3.0E-57
sp|P63017|HSP7C_MOUSE Heat shock cognate 71 kDa protein OS=Mus musculus GN=Hspa8 PE=1 SV=1 18 474 3.0E-57
sp|P19120|HSP7C_BOVIN Heat shock cognate 71 kDa protein OS=Bos taurus GN=HSPA8 PE=1 SV=2 18 474 3.0E-57
sp|Q05944|HSP70_HYDVU Heat shock 70 kDa protein OS=Hydra vulgaris GN=HSP70.1 PE=3 SV=1 18 474 4.0E-57
sp|P34933|HSP72_BOVIN Heat shock-related 70 kDa protein 2 OS=Bos taurus GN=HSPA2 PE=2 SV=2 18 474 5.0E-57
sp|Q5NVM9|HSP7C_PONAB Heat shock cognate 71 kDa protein OS=Pongo abelii GN=HSPA8 PE=2 SV=2 18 474 5.0E-57
sp|P14659|HSP72_RAT Heat shock-related 70 kDa protein 2 OS=Rattus norvegicus GN=Hspa2 PE=1 SV=2 18 474 7.0E-57
sp|P17156|HSP72_MOUSE Heat shock-related 70 kDa protein 2 OS=Mus musculus GN=Hspa2 PE=1 SV=2 18 474 7.0E-57
sp|Q6FW50|GRP78_CANGA 78 kDa glucose-regulated protein homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KAR2 PE=3 SV=1 19 474 7.0E-57
sp|O73885|HSP7C_CHICK Heat shock cognate 71 kDa protein OS=Gallus gallus GN=HSPA8 PE=1 SV=1 18 474 7.0E-57
sp|P11147|HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster GN=Hsc70-4 PE=1 SV=3 18 474 1.0E-56
sp|P54652|HSP72_HUMAN Heat shock-related 70 kDa protein 2 OS=Homo sapiens GN=HSPA2 PE=1 SV=1 18 474 1.0E-56
sp|P87047|HSP71_PARBA Heat shock 70 kDa protein 1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP70-1 PE=1 SV=1 18 474 2.0E-56
sp|P02827|HSP70_XENLA Heat shock 70 kDa protein OS=Xenopus laevis PE=2 SV=1 17 474 3.0E-56
sp|P16474|GRP78_YEAST 78 kDa glucose-regulated protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KAR2 PE=1 SV=1 19 474 4.0E-56
sp|A2VD93|HS7EB_XENLA Heat shock 70 kDa protein 14-B OS=Xenopus laevis GN=hspa14-b PE=2 SV=1 18 473 4.0E-56
sp|P78695|GRP78_NEUCR 78 kDa glucose-regulated protein homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=grp78 PE=3 SV=3 19 474 1.0E-55
sp|P19378|HSP7C_CRIGR Heat shock cognate 71 kDa protein OS=Cricetulus griseus GN=HSPA8 PE=2 SV=1 18 474 1.0E-55
sp|Q5B2V1|HSP70_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hsp70 PE=1 SV=1 18 474 1.0E-55
sp|P37899|HSP70_PYRSA Heat shock 70 kDa protein OS=Pyrenomonas salina GN=HSP70 PE=3 SV=1 17 474 1.0E-55
sp|P08106|HSP70_CHICK Heat shock 70 kDa protein OS=Gallus gallus PE=1 SV=1 18 474 2.0E-55
sp|Q9TUG3|HSP72_CAPHI Heat shock-related 70 kDa protein 2 OS=Capra hircus GN=HSPA2 PE=3 SV=1 18 474 2.0E-55
sp|Q9U639|HSP7D_MANSE Heat shock 70 kDa protein cognate 4 OS=Manduca sexta PE=2 SV=1 18 474 2.0E-55
sp|Q91233|HSP70_ONCTS Heat shock 70 kDa protein OS=Oncorhynchus tshawytscha GN=hsp70 PE=2 SV=1 18 474 4.0E-55
sp|Q06248|HSP74_PARLI Heat shock 70 kDa protein IV OS=Paracentrotus lividus GN=HSP70IV PE=3 SV=1 18 401 7.0E-55
sp|O97125|HSP68_DROME Heat shock protein 68 OS=Drosophila melanogaster GN=Hsp68 PE=1 SV=1 18 474 8.0E-55
sp|Q9HG01|GRP78_PICAN 78 kDa glucose-regulated protein homolog OS=Pichia angusta GN=BiP PE=3 SV=1 19 474 1.0E-54
sp|O93866|HSP70_TRIRU Heat shock 70 kDa protein OS=Trichophyton rubrum GN=HSP70 PE=2 SV=1 18 474 2.0E-54
sp|P87222|HSP75_CANAW Heat shock protein SSB1 OS=Candida albicans (strain WO-1) GN=SSB1 PE=3 SV=2 18 401 3.0E-54
sp|P53421|HSP71_PICAN Heat shock protein 70 1 OS=Pichia angusta GN=HSA1 PE=1 SV=2 18 401 4.0E-54
sp|A5D8N7|HS7EA_XENLA Heat shock 70 kDa protein 14-A OS=Xenopus laevis GN=hspa14-a PE=2 SV=1 18 473 4.0E-54
sp|Q557E0|HS7C2_DICDI Heat shock cognate 70 kDa protein 2 OS=Dictyostelium discoideum GN=hspE-1 PE=1 SV=1 18 401 4.0E-54
sp|Q10265|HSP71_SCHPO Probable heat shock protein ssa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa1 PE=1 SV=2 18 474 5.0E-54
sp|Q04967|HSP76_PIG Heat shock 70 kDa protein 6 OS=Sus scrofa GN=HSPA6 PE=2 SV=1 14 474 5.0E-54
sp|Q01233|HSP70_NEUCR Heat shock 70 kDa protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hsps-1 PE=2 SV=2 18 474 6.0E-54
sp|P29843|HSP7A_DROME Heat shock 70 kDa protein cognate 1 OS=Drosophila melanogaster GN=Hsc70-1 PE=1 SV=1 18 474 6.0E-54
sp|P36415|HS7C1_DICDI Heat shock cognate 70 kDa protein 1 OS=Dictyostelium discoideum GN=hspB PE=1 SV=2 18 474 6.0E-54
sp|P40918|HSP70_DAVTA Heat shock 70 kDa protein OS=Davidiella tassiana GN=HSP70 PE=1 SV=1 18 474 1.0E-53
sp|Q24789|HSP70_ECHGR Heat shock cognate 70 kDa protein OS=Echinococcus granulosus GN=HSP70 PE=2 SV=1 18 479 4.0E-53
sp|P18694|HSP72_USTMA Heat shock 70 kDa protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMS2 PE=3 SV=2 18 474 4.0E-53
sp|P0DMW1|HS71B_RAT Heat shock 70 kDa protein 1B OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 14 474 4.0E-53
sp|P0DMW0|HS71A_RAT Heat shock 70 kDa protein 1A OS=Rattus norvegicus GN=Hspa1a PE=2 SV=1 14 474 4.0E-53
sp|P09435|HSP73_YEAST Heat shock protein SSA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA3 PE=1 SV=3 18 401 4.0E-53
sp|P41827|HSP74_ANOAL Heat shock protein 70 B2 OS=Anopheles albimanus GN=HSP70B2 PE=3 SV=1 18 401 5.0E-53
sp|P16627|HS71L_MOUSE Heat shock 70 kDa protein 1-like OS=Mus musculus GN=Hspa1l PE=1 SV=4 17 401 5.0E-53
sp|P08108|HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2 18 474 6.0E-53
sp|Q90473|HSP7C_DANRE Heat shock cognate 71 kDa protein OS=Danio rerio GN=hspa8 PE=2 SV=1 18 474 6.0E-53
sp|Q9I8F9|HSP71_ORYLA Heat shock 70 kDa protein 1 OS=Oryzias latipes PE=3 SV=1 14 474 6.0E-53
sp|P48720|HSP70_BLAEM Heat shock 70 kDa protein OS=Blastocladiella emersonii GN=HSP70 PE=3 SV=1 15 474 7.0E-53
sp|Q9LHA8|MD37C_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37C PE=1 SV=1 18 401 7.0E-53
sp|P22202|HSP74_YEAST Heat shock protein SSA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA4 PE=1 SV=3 18 401 7.0E-53
sp|P55063|HS71L_RAT Heat shock 70 kDa protein 1-like OS=Rattus norvegicus GN=Hspa1l PE=2 SV=2 17 401 7.0E-53
sp|P0CB32|HS71L_BOVIN Heat shock 70 kDa protein 1-like OS=Bos taurus GN=HSPA1L PE=3 SV=1 18 401 9.0E-53
sp|P10591|HSP71_YEAST Heat shock protein SSA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA1 PE=1 SV=4 18 401 1.0E-52
sp|E1C2P3|HSP7E_CHICK Heat shock 70 kDa protein 14 OS=Gallus gallus GN=HSPA14 PE=3 SV=1 18 498 1.0E-52
sp|A5A8V7|HS71L_PIG Heat shock 70 kDa protein 1-like OS=Sus scrofa GN=HSPA1L PE=2 SV=1 18 401 1.0E-52
sp|Q61696|HS71A_MOUSE Heat shock 70 kDa protein 1A OS=Mus musculus GN=Hspa1a PE=1 SV=2 14 474 1.0E-52
sp|P17879|HS71B_MOUSE Heat shock 70 kDa protein 1B OS=Mus musculus GN=Hspa1b PE=1 SV=3 14 474 1.0E-52
sp|Q2YDD0|HSP7E_BOVIN Heat shock 70 kDa protein 14 OS=Bos taurus GN=HSPA14 PE=2 SV=1 18 493 2.0E-52
sp|P34931|HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2 17 401 2.0E-52
sp|O59855|HSP72_SCHPO Probable heat shock protein ssa2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssa2 PE=1 SV=3 18 474 2.0E-52
sp|P11144|HSP70_PLAFA Heat shock 70 kDa protein OS=Plasmodium falciparum PE=2 SV=2 1 474 2.0E-52
sp|Q90593|GRP78_CHICK 78 kDa glucose-regulated protein OS=Gallus gallus GN=HSPA5 PE=1 SV=1 19 401 2.0E-52
sp|Q99170|GRP78_YARLI 78 kDa glucose-regulated protein homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KAR2 PE=3 SV=1 19 474 2.0E-52
sp|P11146|HSP7B_DROME Heat shock 70 kDa protein cognate 2 OS=Drosophila melanogaster GN=Hsc70-2 PE=1 SV=2 18 410 2.0E-52
sp|Q03684|BIP4_TOBAC Luminal-binding protein 4 OS=Nicotiana tabacum GN=BIP4 PE=2 SV=1 19 401 2.0E-52
sp|Q9S9N1|HSP7E_ARATH Heat shock 70 kDa protein 5 OS=Arabidopsis thaliana GN=HSP70-5 PE=2 SV=1 18 401 2.0E-52
sp|Q91883|GRP78_XENLA 78 kDa glucose-regulated protein OS=Xenopus laevis GN=hspa5 PE=2 SV=1 19 401 3.0E-52
sp|Q9N1U2|HSP76_SAGOE Heat shock 70 kDa protein 6 OS=Saguinus oedipus GN=HSPA6 PE=2 SV=1 17 401 3.0E-52
sp|Q4R888|HS71L_MACFA Heat shock 70 kDa protein 1-like OS=Macaca fascicularis GN=HSPA1L PE=2 SV=1 17 401 3.0E-52
sp|P83616|GRP78_ASPNG 78 kDa glucose-regulated protein homolog OS=Aspergillus niger GN=bipA PE=2 SV=1 10 474 3.0E-52
sp|P83617|GRP78_ASPKA 78 kDa glucose-regulated protein homolog OS=Aspergillus kawachii GN=bipA PE=3 SV=1 10 474 3.0E-52
sp|P59769|GRP78_ASPAW 78 kDa glucose-regulated protein homolog OS=Aspergillus awamori GN=bipA PE=2 SV=1 10 474 3.0E-52
sp|P10592|HSP72_YEAST Heat shock protein SSA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA2 PE=1 SV=3 18 401 4.0E-52
sp|Q9VG58|HSP74_DROME Major heat shock 70 kDa protein Bbb OS=Drosophila melanogaster GN=Hsp70Bbb PE=3 SV=2 18 410 4.0E-52
sp|Q03685|BIP5_TOBAC Luminal-binding protein 5 OS=Nicotiana tabacum GN=BIP5 PE=2 SV=1 19 401 5.0E-52
sp|Q5RE21|HSP7E_PONAB Heat shock 70 kDa protein 14 OS=Pongo abelii GN=HSPA14 PE=2 SV=1 18 473 5.0E-52
sp|P41826|HSP72_ANOAL Heat shock protein 70 A2 OS=Anopheles albimanus GN=HSP70A2 PE=3 SV=1 18 401 5.0E-52
sp|P41825|HSP71_ANOAL Heat shock protein 70 A1 OS=Anopheles albimanus GN=HSP70A1 PE=3 SV=1 18 401 5.0E-52
sp|Q54MR6|HS7C5_DICDI Heat shock 70-related protein 5 OS=Dictyostelium discoideum GN=DDB_G0285709 PE=3 SV=1 14 476 5.0E-52
sp|P41753|HSP70_ACHKL Heat shock 70 kDa protein OS=Achlya klebsiana GN=HSP70 PE=2 SV=1 18 474 5.0E-52
sp|P02825|HSP71_DROME Major heat shock 70 kDa protein Ab OS=Drosophila melanogaster GN=Hsp70Ab PE=2 SV=3 18 410 6.0E-52
sp|P82910|HSP70_DROME Major heat shock 70 kDa protein Aa OS=Drosophila melanogaster GN=Hsp70Aa PE=2 SV=2 18 410 6.0E-52
sp|Q54BD8|HS7C4_DICDI Heat shock cognate 70 kDa protein 4 OS=Dictyostelium discoideum GN=DDB_G0293678 PE=3 SV=1 18 474 6.0E-52
sp|Q9BIR7|HSP75_DROME Major heat shock 70 kDa protein Bc OS=Drosophila melanogaster GN=Hsp70Bc PE=2 SV=2 18 410 6.0E-52
sp|Q9BIS2|HSP73_DROME Major heat shock 70 kDa protein Bb OS=Drosophila melanogaster GN=Hsp70Bb PE=2 SV=2 18 410 6.0E-52
sp|Q8INI8|HSP72_DROME Major heat shock 70 kDa protein Ba OS=Drosophila melanogaster GN=Hsp70Ba PE=2 SV=2 18 410 6.0E-52
sp|Q0VCX2|GRP78_BOVIN 78 kDa glucose-regulated protein OS=Bos taurus GN=HSPA5 PE=2 SV=1 19 401 7.0E-52
sp|Q9GSU4|HSP72_DROSI Major heat shock 70 kDa protein Ba OS=Drosophila simulans GN=Hsp70Ba PE=3 SV=2 18 410 7.0E-52
sp|P11021|GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 19 401 7.0E-52
sp|Q6S4N2|HS71B_PIG Heat shock 70 kDa protein 1B OS=Sus scrofa GN=HSPA1B PE=2 SV=1 14 474 8.0E-52
sp|P53623|HSP72_PICAN Heat shock protein 70 2 OS=Pichia angusta GN=HSA2 PE=3 SV=2 18 401 8.0E-52
sp|Q16956|GRP78_APLCA 78 kDa glucose-regulated protein OS=Aplysia californica PE=1 SV=1 19 474 9.0E-52
sp|P20029|GRP78_MOUSE 78 kDa glucose-regulated protein OS=Mus musculus GN=Hspa5 PE=1 SV=3 19 401 9.0E-52
sp|P07823|GRP78_MESAU 78 kDa glucose-regulated protein OS=Mesocricetus auratus GN=HSPA5 PE=1 SV=1 19 401 1.0E-51
sp|P17066|HSP76_HUMAN Heat shock 70 kDa protein 6 OS=Homo sapiens GN=HSPA6 PE=1 SV=2 17 401 1.0E-51
sp|Q3S4T7|GRP78_ICTTR 78 kDa glucose-regulated protein OS=Ictidomys tridecemlineatus GN=HSPA5 PE=2 SV=1 19 401 1.0E-51
sp|Q27975|HS71A_BOVIN Heat shock 70 kDa protein 1A OS=Bos taurus GN=HSPA1A PE=1 SV=2 14 474 1.0E-51
sp|P06761|GRP78_RAT 78 kDa glucose-regulated protein OS=Rattus norvegicus GN=Hspa5 PE=1 SV=1 19 401 1.0E-51
sp|Q7YQC6|HSP71_CANLF Heat shock 70 kDa protein 1 OS=Canis lupus familiaris GN=HSPA1 PE=2 SV=1 14 474 1.0E-51
sp|P29844|HSP7C_DROME Heat shock 70 kDa protein cognate 3 OS=Drosophila melanogaster GN=Hsc70-3 PE=2 SV=2 19 474 1.0E-51
sp|P36604|GRP78_SCHPO 78 kDa glucose-regulated protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bip1 PE=3 SV=2 19 474 1.0E-51
sp|P41797|HSP71_CANAL Heat shock protein SSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA1 PE=1 SV=2 18 401 1.0E-51
sp|Q05746|HSP70_PLACB Heat shock 70 kDa protein OS=Plasmodium cynomolgi (strain Berok) PE=2 SV=1 1 474 1.0E-51
sp|Q5R4P0|GRP78_PONAB 78 kDa glucose-regulated protein OS=Pongo abelii GN=HSPA5 PE=2 SV=1 19 474 1.0E-51
sp|Q42434|BIP_SPIOL Luminal-binding protein OS=Spinacia oleracea GN=HSC70 PE=2 SV=1 13 401 1.0E-51
sp|Q4U0F3|HS71B_BOSMU Heat shock 70 kDa protein 1B OS=Bos mutus grunniens GN=HSPA1B PE=2 SV=1 14 474 2.0E-51
sp|Q9C7X7|HSP7N_ARATH Heat shock 70 kDa protein 18 OS=Arabidopsis thaliana GN=HSP70-18 PE=2 SV=1 18 474 2.0E-51
sp|P26413|HSP70_SOYBN Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1 18 401 2.0E-51
sp|Q27965|HS71B_BOVIN Heat shock 70 kDa protein 1B OS=Bos taurus GN=HSPA1B PE=2 SV=1 14 474 2.0E-51
sp|Q0VDF9|HSP7E_HUMAN Heat shock 70 kDa protein 14 OS=Homo sapiens GN=HSPA14 PE=1 SV=1 18 473 2.0E-51
sp|P47773|HSP7C_ICTPU Heat shock cognate 71 kDa protein OS=Ictalurus punctatus GN=hsc70 PE=2 SV=1 18 474 2.0E-51
sp|P27420|HSP7C_CAEEL Heat shock 70 kDa protein C OS=Caenorhabditis elegans GN=hsp-3 PE=3 SV=2 19 474 2.0E-51
sp|O65719|HSP7C_ARATH Heat shock 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSP70-3 PE=1 SV=1 18 474 2.0E-51
sp|Q6BZH1|GRP78_DEBHA 78 kDa glucose-regulated protein homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=KAR2 PE=3 SV=1 19 474 3.0E-51
sp|P09189|HSP7C_PETHY Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1 18 401 3.0E-51
sp|Q5R7D3|HSP71_PONAB Heat shock 70 kDa protein 1 OS=Pongo abelii GN=HSPA1 PE=2 SV=1 18 474 3.0E-51
sp|P0DMV9|HS71B_HUMAN Heat shock 70 kDa protein 1B OS=Homo sapiens GN=HSPA1B PE=1 SV=1 18 474 3.0E-51
sp|P0DMV8|HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 18 474 3.0E-51
sp|Q00043|HSP70_AJECA Heat shock 70 kDa protein OS=Ajellomyces capsulatus GN=HSP70 PE=3 SV=1 18 474 3.0E-51
sp|P34930|HS71A_PIG Heat shock 70 kDa protein 1A OS=Sus scrofa GN=HSPA1A PE=3 SV=1 14 474 3.0E-51
sp|P19208|HSP7C_CAEBR Heat shock 70 kDa protein C OS=Caenorhabditis briggsae GN=hsp-3 PE=3 SV=2 19 474 3.0E-51
sp|Q9W6Y1|HSP7C_ORYLA Heat shock cognate 71 kDa protein OS=Oryzias latipes GN=hsc70 PE=2 SV=1 18 479 5.0E-51
sp|P41770|HSP75_KLUMA Heat shock protein SSB OS=Kluyveromyces marxianus GN=SSB PE=3 SV=2 18 408 6.0E-51
sp|Q9GSU7|HSP71_DROSI Major heat shock 70 kDa protein Ab OS=Drosophila simulans GN=Hsp70Ab PE=3 SV=2 18 401 7.0E-51
sp|P11484|HSP75_YEAST Heat shock protein SSB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB1 PE=1 SV=3 18 474 8.0E-51
sp|Q4R6J2|HSP7E_MACFA Heat shock 70 kDa protein 14 OS=Macaca fascicularis GN=HSPA14 PE=2 SV=1 18 473 9.0E-51
sp|P09446|HSP7A_CAEEL Heat shock 70 kDa protein A OS=Caenorhabditis elegans GN=hsp-1 PE=1 SV=2 18 474 1.0E-50
sp|P05456|HSP70_TRYCR Heat shock 70 kDa protein OS=Trypanosoma cruzi GN=HSP70 PE=3 SV=1 18 401 1.0E-50
sp|P24067|BIP2_MAIZE Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=1 SV=3 19 401 1.0E-50
sp|P20163|HSP7D_CAEEL Heat shock 70 kDa protein D OS=Caenorhabditis elegans GN=hsp-4 PE=1 SV=2 19 454 2.0E-50
sp|P46587|HSP72_CANAL Heat shock protein SSA2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA2 PE=1 SV=3 18 401 2.0E-50
sp|P22953|MD37E_ARATH Probable mediator of RNA polymerase II transcription subunit 37e OS=Arabidopsis thaliana GN=MED37E PE=1 SV=3 18 401 2.0E-50
sp|P16019|HSP70_THEAN Heat shock 70 kDa protein OS=Theileria annulata GN=TA11610 PE=3 SV=2 18 474 2.0E-50
sp|Q75E44|HSP75_ASHGO Heat shock protein SSB OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SSB PE=3 SV=3 18 401 3.0E-50
sp|P24629|HSP71_SOLLC Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1 18 401 3.0E-50
sp|Q9LKR3|MD37A_ARATH Mediator of RNA polymerase II transcription subunit 37a OS=Arabidopsis thaliana GN=MED37A PE=1 SV=1 19 401 3.0E-50
sp|Q27031|HSP70_THEPA Heat shock 70 kDa protein OS=Theileria parva GN=TP02_0148 PE=2 SV=2 18 474 4.0E-50
sp|P11145|HSP74_TRYBB Heat shock 70 kDa protein 4 OS=Trypanosoma brucei brucei PE=2 SV=2 18 401 5.0E-50
sp|P40150|HSP76_YEAST Heat shock protein SSB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSB2 PE=1 SV=2 18 408 5.0E-50
sp|Q07437|HSP70_LEIAM Heat shock 70 kDa protein OS=Leishmania amazonensis GN=HSP70 PE=2 SV=1 18 401 5.0E-50
sp|Q5UQ49|HSP70_MIMIV Heat shock 70 kDa protein homolog OS=Acanthamoeba polyphaga mimivirus GN=HSP70 PE=3 SV=1 14 474 5.0E-50
sp|O24581|BIP3_MAIZE Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=2 SV=1 19 401 6.0E-50
sp|P25840|HSP70_CHLRE Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2 18 401 6.0E-50
sp|Q05866|GRP78_PLAFO 78 kDa glucose-regulated protein homolog OS=Plasmodium falciparum (isolate NF54) PE=3 SV=1 18 474 7.0E-50
sp|Q39043|MD37F_ARATH Mediator of RNA polymerase II transcription subunit 37f OS=Arabidopsis thaliana GN=MED37F PE=1 SV=2 19 401 1.0E-49
sp|Q8H1B3|MD37B_ARATH Probable mediator of RNA polymerase II transcription subunit 37b OS=Arabidopsis thaliana GN=MED37B PE=1 SV=1 18 463 2.0E-49
sp|P27322|HSP72_SOLLC Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1 18 401 2.0E-49
sp|P22954|MD37D_ARATH Probable mediator of RNA polymerase II transcription subunit 37c OS=Arabidopsis thaliana GN=MED37D PE=1 SV=2 18 474 2.0E-49
sp|P11143|HSP70_MAIZE Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2 18 401 2.0E-49
sp|P16394|HSP70_BRELC Heat shock 70 kDa protein OS=Bremia lactucae GN=HSP70 PE=3 SV=1 18 401 3.0E-49
sp|Q6CQ83|HSP75_KLULA Heat shock protein SSB OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SSB PE=3 SV=3 18 408 4.0E-49
sp|Q24798|GRP78_ECHGR 78 kDa glucose-regulated protein OS=Echinococcus granulosus GN=GRP78 PE=2 SV=1 19 405 6.0E-49
sp|P49118|BIP_SOLLC Luminal-binding protein OS=Solanum lycopersicum PE=2 SV=1 19 401 6.0E-49
sp|Q91291|HSP70_PLEWA Heat shock 70 kDa protein OS=Pleurodeles waltl GN=HSP70 PE=2 SV=1 17 474 1.0E-48
sp|P91902|HSP70_CERCA Heat shock protein 70 OS=Ceratitis capitata PE=2 SV=1 17 410 1.0E-48
sp|Q707W3|HSP75_KLUDE Heat shock protein SSB OS=Kluyveromyces delphensis GN=SSB PE=3 SV=3 18 408 1.0E-48
sp|Q8YW74|DNAK2_NOSS1 Chaperone protein dnaK2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaK2 PE=3 SV=1 19 401 2.0E-48
sp|A5FGL1|DNAK_FLAJ1 Chaperone protein DnaK OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=dnaK PE=3 SV=1 19 454 3.0E-48
sp|P22358|DNAK2_SYNY3 Chaperone protein dnaK2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaK2 PE=2 SV=1 19 474 3.0E-48
sp|Q876N3|HSP75_CANGA Heat shock protein SSB OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SSB1 PE=3 SV=3 18 408 3.0E-48
sp|Q24895|GRP78_ECHMU 78 kDa glucose-regulated protein OS=Echinococcus multilocularis GN=GRP78 PE=2 SV=1 19 401 4.0E-48
sp|Q72IK5|DNAK_THET2 Chaperone protein DnaK OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaK PE=3 SV=1 18 401 5.0E-48
sp|Q707X3|HSP75_ZYGRC Heat shock protein SSB OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SSB PE=3 SV=3 18 401 6.0E-48
sp|Q10284|HSP75_SCHPO Heat shock protein sks2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sks2 PE=1 SV=2 18 411 6.0E-48
sp|P94695|DNAK_DEIPM Chaperone protein DnaK OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaK PE=3 SV=2 18 474 6.0E-48
sp|Q56235|DNAK_THET8 Chaperone protein DnaK OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaK PE=3 SV=2 18 401 7.0E-48
sp|Q8DI58|DNAK2_THEEB Chaperone protein dnaK2 OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaK2 PE=3 SV=1 19 401 7.0E-48
sp|Q7NDH1|DNAK_GLOVI Chaperone protein DnaK OS=Gloeobacter violaceus (strain PCC 7421) GN=dnaK PE=3 SV=1 19 474 1.0E-47
sp|Q8KEP3|DNAK_CHLTE Chaperone protein DnaK OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaK PE=3 SV=1 19 454 1.0E-47
sp|Q6AYB4|HSP7E_RAT Heat shock 70 kDa protein 14 OS=Rattus norvegicus GN=Hspa14 PE=2 SV=1 18 499 2.0E-47
sp|P29357|HSP7E_SPIOL Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3 18 401 6.0E-47
sp|C1CZH9|DNAK_DEIDV Chaperone protein DnaK OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=dnaK PE=3 SV=1 18 474 7.0E-47
sp|A6GXZ1|DNAK_FLAPJ Chaperone protein DnaK OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=dnaK PE=3 SV=1 19 401 7.0E-47
sp|B3EHR1|DNAK_CHLL2 Chaperone protein DnaK OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaK PE=3 SV=1 19 454 8.0E-47
sp|B9LUC7|DNAK_HALLT Chaperone protein DnaK OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=dnaK PE=3 SV=1 19 401 8.0E-47
sp|Q1IWL4|DNAK_DEIGD Chaperone protein DnaK OS=Deinococcus geothermalis (strain DSM 11300) GN=dnaK PE=3 SV=1 18 402 1.0E-46
sp|Q9TLT1|DNAK_CYACA Chaperone protein dnaK OS=Cyanidium caldarium GN=dnaK PE=3 SV=1 19 474 2.0E-46
sp|P27541|HSP70_BRUMA Heat shock 70 kDa protein OS=Brugia malayi GN=HSP70 PE=3 SV=1 18 401 2.0E-46
sp|Q85FW4|DNAK_CYAME Chaperone protein dnaK OS=Cyanidioschyzon merolae GN=dnaK PE=3 SV=1 19 401 2.0E-46
sp|B3QMB2|DNAK_CHLP8 Chaperone protein DnaK OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaK PE=3 SV=1 19 454 2.0E-46
sp|B0T138|DNAK_CAUSK Chaperone protein DnaK OS=Caulobacter sp. (strain K31) GN=dnaK PE=3 SV=1 19 454 3.0E-46
sp|Q3APD2|DNAK_CHLCH Chaperone protein DnaK OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaK PE=3 SV=1 19 454 3.0E-46
sp|Q02028|HSP7S_PEA Stromal 70 kDa heat shock-related protein, chloroplastic OS=Pisum sativum GN=HSP70 PE=2 SV=1 19 401 3.0E-46
sp|P14834|HSP70_LEIMA Heat shock 70 kDa protein (Fragment) OS=Leishmania major GN=HSP70 PE=3 SV=1 18 401 3.0E-46
sp|A0M353|DNAK_GRAFK Chaperone protein DnaK OS=Gramella forsetii (strain KT0803) GN=dnaK PE=3 SV=1 19 401 8.0E-46
sp|Q3B577|DNAK_CHLL7 Chaperone protein DnaK OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaK PE=3 SV=1 19 454 8.0E-46
sp|Q826F6|DNAK2_STRAW Chaperone protein dnaK2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaK2 PE=3 SV=1 18 463 9.0E-46
sp|B4SDA0|DNAK_PELPB Chaperone protein DnaK OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=dnaK PE=3 SV=1 19 454 1.0E-45
sp|Q9RY23|DNAK_DEIRA Chaperone protein DnaK OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=dnaK PE=1 SV=3 18 474 1.0E-45
sp|P20030|HSP7C_TRYBB Heat shock cognate HSP70 protein OS=Trypanosoma brucei brucei PE=3 SV=1 18 401 1.0E-45
sp|Q11QH3|DNAK_CYTH3 Chaperone protein DnaK OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=dnaK PE=3 SV=1 19 454 1.0E-45
sp|B3ERN8|DNAK_AMOA5 Chaperone protein DnaK OS=Amoebophilus asiaticus (strain 5a2) GN=dnaK PE=3 SV=1 19 454 1.0E-45
sp|Q99M31|HSP7E_MOUSE Heat shock 70 kDa protein 14 OS=Mus musculus GN=Hspa14 PE=1 SV=2 18 473 2.0E-45
sp|Q46I76|DNAK_PROMT Chaperone protein DnaK OS=Prochlorococcus marinus (strain NATL2A) GN=dnaK PE=3 SV=1 19 452 2.0E-45
sp|P50021|DNAK2_SYNE7 Chaperone protein dnaK2 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK2 PE=3 SV=2 19 401 2.0E-45
sp|A1BET8|DNAK_CHLPD Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaK PE=3 SV=1 19 454 3.0E-45
sp|A4SFB1|DNAK_CHLPM Chaperone protein DnaK OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dnaK PE=3 SV=1 19 454 3.0E-45
sp|Q93GF1|DNAK_PRELO Chaperone protein DnaK OS=Prevotella loescheii GN=dnaK PE=3 SV=1 19 403 4.0E-45
sp|Q28222|HSP71_CHLAE Heat shock 70 kDa protein 1 OS=Chlorocebus aethiops GN=HSPA1 PE=2 SV=1 18 401 4.0E-45
sp|Q37106|DNAK_CYAPA Chaperone protein dnaK OS=Cyanophora paradoxa GN=dnaK-A PE=3 SV=2 19 360 4.0E-45
sp|Q7UM31|DNAK_RHOBA Chaperone protein DnaK OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=dnaK PE=3 SV=2 19 401 5.0E-45
sp|Q9STW6|HSP7F_ARATH Heat shock 70 kDa protein 6, chloroplastic OS=Arabidopsis thaliana GN=HSP70-6 PE=1 SV=1 19 474 5.0E-45
sp|P48741|HSP77_HUMAN Putative heat shock 70 kDa protein 7 OS=Homo sapiens GN=HSPA7 PE=5 SV=2 17 359 6.0E-45
sp|P17804|HSP70_LEIDO Heat shock 70 kDa protein OS=Leishmania donovani GN=HSP70 PE=3 SV=1 18 401 8.0E-45
sp|P20442|DNAK_CAUCR Chaperone protein DnaK OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaK PE=2 SV=2 19 454 8.0E-45
sp|P26791|HSP70_DAUCA Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1 18 401 8.0E-45
sp|Q9LTX9|HSP7G_ARATH Heat shock 70 kDa protein 7, chloroplastic OS=Arabidopsis thaliana GN=HSP70-7 PE=2 SV=1 19 401 1.0E-44
sp|Q7V3T5|DNAK2_PROMM Chaperone protein dnaK2 OS=Prochlorococcus marinus (strain MIT 9313) GN=dnaK2 PE=3 SV=1 19 401 1.0E-44
sp|A6L2X7|DNAK_BACV8 Chaperone protein DnaK OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=dnaK PE=3 SV=1 19 474 1.0E-44
sp|Q64X01|DNAK_BACFR Chaperone protein DnaK OS=Bacteroides fragilis (strain YCH46) GN=dnaK PE=3 SV=1 19 474 1.0E-44
sp|Q5LG30|DNAK_BACFN Chaperone protein DnaK OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=dnaK PE=3 SV=1 19 474 1.0E-44
sp|Q7U3C4|DNAK2_SYNPX Chaperone protein dnaK2 OS=Synechococcus sp. (strain WH8102) GN=dnaK2 PE=3 SV=1 19 401 2.0E-44
sp|Q5N1J4|DNAK2_SYNP6 Chaperone protein DnaK 2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaK2 PE=3 SV=1 19 401 2.0E-44
sp|Q89YW6|DNAK_BACTN Chaperone protein DnaK OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=dnaK PE=3 SV=1 19 474 2.0E-44
sp|Q7UZG3|DNAK2_PROMP Chaperone protein dnaK2 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=dnaK2 PE=3 SV=1 19 401 2.0E-44
sp|A2BZ91|DNAK_PROM5 Chaperone protein DnaK OS=Prochlorococcus marinus (strain MIT 9515) GN=dnaK PE=3 SV=1 19 401 2.0E-44
sp|B4S6P7|DNAK_PROA2 Chaperone protein DnaK OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dnaK PE=3 SV=1 19 454 2.0E-44
sp|Q7V9G2|DNAK2_PROMA Chaperone protein dnaK2 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaK2 PE=3 SV=1 19 474 2.0E-44
sp|B8CKF3|DNAK_SHEPW Chaperone protein DnaK OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dnaK PE=3 SV=1 19 401 4.0E-44
sp|Q8T869|BIP2_DICDI Luminal-binding protein 2 OS=Dictyostelium discoideum GN=bip2 PE=1 SV=1 19 474 5.0E-44
sp|Q03MR6|DNAK_STRTD Chaperone protein DnaK OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=dnaK PE=3 SV=1 19 454 5.0E-44
sp|Q5M1T8|DNAK_STRT1 Chaperone protein DnaK OS=Streptococcus thermophilus (strain CNRZ 1066) GN=dnaK PE=3 SV=1 19 454 5.0E-44
sp|Q2S307|DNAK_SALRD Chaperone protein DnaK OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaK PE=3 SV=1 19 401 5.0E-44
sp|Q5M6D1|DNAK_STRT2 Chaperone protein DnaK OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=dnaK PE=3 SV=1 19 454 6.0E-44
sp|A8AVA8|DNAK_STRGC Chaperone protein DnaK OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=dnaK PE=3 SV=1 19 401 6.0E-44
sp|Q67S54|DNAK_SYMTH Chaperone protein DnaK OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaK PE=3 SV=1 19 464 6.0E-44
sp|Q8DH10|DNAK3_THEEB Chaperone protein dnaK3 OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaK3 PE=3 SV=1 19 474 7.0E-44
sp|B3QZ38|DNAK_CHLT3 Chaperone protein DnaK OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=dnaK PE=3 SV=1 19 454 7.0E-44
sp|P22623|HSP72_PARLI Heat shock 70 kDa protein II (Fragment) OS=Paracentrotus lividus GN=HSP70II PE=3 SV=1 18 360 9.0E-44
sp|B6YRF7|DNAK_AZOPC Chaperone protein DnaK OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=dnaK PE=3 SV=1 19 401 1.0E-43
sp|O67118|DNAK_AQUAE Chaperone protein DnaK OS=Aquifex aeolicus (strain VF5) GN=dnaK PE=3 SV=1 19 401 1.0E-43
sp|Q01100|DNAK_HALMA Chaperone protein DnaK OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=dnaK PE=3 SV=2 19 401 2.0E-43
sp|Q9HRY2|DNAK_HALSA Chaperone protein DnaK OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=dnaK PE=3 SV=1 19 401 2.0E-43
sp|B0R3H4|DNAK_HALS3 Chaperone protein DnaK OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=dnaK PE=3 SV=1 19 401 2.0E-43
sp|O86103|DNAK_AQUPY Chaperone protein DnaK (Fragment) OS=Aquifex pyrophilus GN=dnaK PE=3 SV=1 19 401 2.0E-43
sp|P29215|DNAK_GUITH Chaperone protein dnaK OS=Guillardia theta GN=dnaK PE=3 SV=2 19 401 2.0E-43
sp|A3CQC2|DNAK_STRSV Chaperone protein DnaK OS=Streptococcus sanguinis (strain SK36) GN=dnaK PE=3 SV=1 19 454 2.0E-43
sp|Q3A8C2|DNAK_PELCD Chaperone protein DnaK OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaK PE=3 SV=1 19 402 4.0E-43
sp|Q5WHG1|DNAK_BACSK Chaperone protein DnaK OS=Bacillus clausii (strain KSM-K16) GN=dnaK PE=3 SV=1 19 454 5.0E-43
sp|A8ZRW3|DNAK_DESOH Chaperone protein DnaK OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=dnaK PE=3 SV=1 19 402 6.0E-43
sp|P50022|DNAK3_SYNE7 Chaperone protein dnaK3 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK3 PE=3 SV=1 19 454 8.0E-43
sp|A6LM32|DNAK_THEM4 Chaperone protein DnaK OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaK PE=3 SV=1 19 474 9.0E-43
sp|P42374|DNAK_RHIME Chaperone protein DnaK OS=Rhizobium meliloti (strain 1021) GN=dnaK PE=3 SV=2 19 454 9.0E-43
sp|Q5N1V0|DNAK1_SYNP6 Chaperone protein DnaK 1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaK1 PE=3 SV=1 19 454 9.0E-43
sp|A7HZ39|DNAK_PARL1 Chaperone protein DnaK OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaK PE=3 SV=1 19 474 1.0E-42
sp|A4VT29|DNAK_STRSY Chaperone protein DnaK OS=Streptococcus suis (strain 05ZYH33) GN=dnaK PE=3 SV=1 19 401 1.0E-42
sp|A4VZB5|DNAK_STRS2 Chaperone protein DnaK OS=Streptococcus suis (strain 98HAH33) GN=dnaK PE=3 SV=1 19 401 1.0E-42
sp|C1CCQ8|DNAK_STRZJ Chaperone protein DnaK OS=Streptococcus pneumoniae (strain JJA) GN=dnaK PE=3 SV=1 19 454 2.0E-42
sp|P95829|DNAK_STRPN Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dnaK PE=3 SV=2 19 454 2.0E-42
sp|B8ZLY9|DNAK_STRPJ Chaperone protein DnaK OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dnaK PE=3 SV=1 19 454 2.0E-42
sp|B2IMB5|DNAK_STRPS Chaperone protein DnaK OS=Streptococcus pneumoniae (strain CGSP14) GN=dnaK PE=3 SV=1 19 454 2.0E-42
sp|C1CQ18|DNAK_STRZT Chaperone protein DnaK OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dnaK PE=3 SV=1 19 454 2.0E-42
sp|C1CJ06|DNAK_STRZP Chaperone protein DnaK OS=Streptococcus pneumoniae (strain P1031) GN=dnaK PE=3 SV=1 19 454 2.0E-42
sp|Q8CWT3|DNAK_STRR6 Chaperone protein DnaK OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dnaK PE=3 SV=1 19 454 2.0E-42
sp|B1IA52|DNAK_STRPI Chaperone protein DnaK OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=dnaK PE=3 SV=1 19 454 2.0E-42
sp|C1C5N7|DNAK_STRP7 Chaperone protein DnaK OS=Streptococcus pneumoniae (strain 70585) GN=dnaK PE=3 SV=1 19 454 2.0E-42
sp|Q04LY0|DNAK_STRP2 Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dnaK PE=3 SV=1 19 454 2.0E-42
sp|Q49Y22|DNAK_STAS1 Chaperone protein DnaK OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dnaK PE=3 SV=1 19 401 2.0E-42
sp|A1UUC3|DNAK_BARBK Chaperone protein DnaK OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dnaK PE=3 SV=1 19 474 2.0E-42
sp|B3EKT9|DNAK_CHLPB Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain BS1) GN=dnaK PE=3 SV=1 19 454 2.0E-42
sp|Q7VC04|DNAK1_PROMA Chaperone protein dnaK1 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaK1 PE=3 SV=1 19 401 2.0E-42
sp|B7ID00|DNAK_THEAB Chaperone protein DnaK OS=Thermosipho africanus (strain TCF52B) GN=dnaK PE=3 SV=1 19 464 3.0E-42
sp|P96133|DNAK_THERP Chaperone protein DnaK OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=dnaK PE=3 SV=2 19 474 3.0E-42
sp|A6UEY0|DNAK_SINMW Chaperone protein DnaK OS=Sinorhizobium medicae (strain WSM419) GN=dnaK PE=3 SV=1 19 454 3.0E-42
sp|Q9XCB1|DNAK_RHOMR Chaperone protein DnaK OS=Rhodothermus marinus GN=dnaK PE=3 SV=1 19 463 4.0E-42
sp|C5BQ33|DNAK_TERTT Chaperone protein DnaK OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=dnaK PE=3 SV=1 19 474 5.0E-42
sp|A8H760|DNAK_SHEPA Chaperone protein DnaK OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dnaK PE=3 SV=1 19 401 5.0E-42
sp|Q2LUH6|DNAK_SYNAS Chaperone protein DnaK OS=Syntrophus aciditrophicus (strain SB) GN=dnaK PE=3 SV=1 19 401 5.0E-42
sp|A9ILH7|DNAK_BART1 Chaperone protein DnaK OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dnaK PE=3 SV=1 19 474 5.0E-42
sp|O06942|DNAK_STRMU Chaperone protein DnaK OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dnaK PE=2 SV=2 19 454 6.0E-42
sp|A3QGW2|DNAK_SHELP Chaperone protein DnaK OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaK PE=3 SV=1 19 453 6.0E-42
sp|Q835R7|DNAK_ENTFA Chaperone protein DnaK OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=dnaK PE=3 SV=1 19 454 6.0E-42
sp|Q92260|HSP70_PENCI Heat shock 70 kDa protein (Fragment) OS=Penicillium citrinum GN=HSP70 PE=1 SV=1 147 474 6.0E-42
sp|B9E6X1|DNAK_MACCJ Chaperone protein DnaK OS=Macrococcus caseolyticus (strain JCSC5402) GN=dnaK PE=3 SV=1 19 401 7.0E-42
sp|B2RJ90|DNAK_PORG3 Chaperone protein DnaK OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaK PE=3 SV=1 19 401 7.0E-42
sp|P0C937|DNAK_PORGI Chaperone protein DnaK OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaK PE=3 SV=1 19 401 8.0E-42
sp|B9JZ87|DNAK_AGRVS Chaperone protein DnaK OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaK PE=3 SV=1 19 454 8.0E-42
sp|B3E7W9|DNAK_GEOLS Chaperone protein DnaK OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=dnaK PE=3 SV=1 19 454 8.0E-42
sp|Q4L6T0|DNAK_STAHJ Chaperone protein DnaK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dnaK PE=3 SV=1 19 401 1.0E-41
sp|B9DVF3|DNAK_STRU0 Chaperone protein DnaK OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=dnaK PE=3 SV=1 19 454 1.0E-41
sp|Q2YT47|DNAK_STAAB Chaperone protein DnaK OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaK PE=3 SV=1 19 401 1.0E-41
sp|B5E232|DNAK_STRP4 Chaperone protein DnaK OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=dnaK PE=3 SV=1 19 454 1.0E-41
sp|Q7V1H4|DNAK1_PROMP Chaperone protein dnaK1 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=dnaK1 PE=3 SV=1 19 401 1.0E-41
sp|Q1XDH2|DNAK_PYRYE Chaperone protein dnaK OS=Pyropia yezoensis GN=dnaK PE=3 SV=1 19 401 1.0E-41
sp|Q9LDZ0|HSP7J_ARATH Heat shock 70 kDa protein 10, mitochondrial OS=Arabidopsis thaliana GN=HSP70-10 PE=2 SV=1 12 474 1.0E-41
sp|P30722|DNAK_DIALT Chaperone protein dnaK OS=Diacronema lutheri GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|C6E643|DNAK_GEOSM Chaperone protein DnaK OS=Geobacter sp. (strain M21) GN=dnaK PE=3 SV=1 19 402 2.0E-41
sp|Q52701|DNAK_RHOCA Chaperone protein DnaK OS=Rhodobacter capsulatus GN=dnaK PE=3 SV=1 19 474 2.0E-41
sp|Q06W39|DNAK_PYRHA Chaperone protein dnaK OS=Pyropia haitanensis GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|A1ANV0|DNAK_PELPD Chaperone protein DnaK OS=Pelobacter propionicus (strain DSM 2379) GN=dnaK PE=3 SV=1 19 454 2.0E-41
sp|Q6G1F9|DNAK_BARQU Chaperone protein DnaK OS=Bartonella quintana (strain Toulouse) GN=dnaK PE=3 SV=1 19 474 2.0E-41
sp|Q086J3|DNAK_SHEFN Chaperone protein DnaK OS=Shewanella frigidimarina (strain NCIMB 400) GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|B5EC42|DNAK_GEOBB Chaperone protein DnaK OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=dnaK PE=3 SV=1 19 402 2.0E-41
sp|Q6AMQ3|DNAK_DESPS Chaperone protein DnaK OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=dnaK PE=3 SV=1 19 402 2.0E-41
sp|P45554|DNAK_STAAU Chaperone protein DnaK OS=Staphylococcus aureus GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|B7J282|DNAK_BORBZ Chaperone protein DnaK OS=Borrelia burgdorferi (strain ZS7) GN=dnaK PE=2 SV=1 19 401 2.0E-41
sp|P0C922|DNAK_BORBU Chaperone protein DnaK OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=dnaK PE=2 SV=1 19 401 2.0E-41
sp|P64408|DNAK_STAAW Chaperone protein DnaK OS=Staphylococcus aureus (strain MW2) GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|A8Z4B9|DNAK_STAAT Chaperone protein DnaK OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|Q6G8Y7|DNAK_STAAS Chaperone protein DnaK OS=Staphylococcus aureus (strain MSSA476) GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|Q6GGC0|DNAK_STAAR Chaperone protein DnaK OS=Staphylococcus aureus (strain MRSA252) GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|P99110|DNAK_STAAN Chaperone protein DnaK OS=Staphylococcus aureus (strain N315) GN=dnaK PE=1 SV=1 19 401 2.0E-41
sp|P64407|DNAK_STAAM Chaperone protein DnaK OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|A6QHC3|DNAK_STAAE Chaperone protein DnaK OS=Staphylococcus aureus (strain Newman) GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|Q5HFI0|DNAK_STAAC Chaperone protein DnaK OS=Staphylococcus aureus (strain COL) GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|A5ITA8|DNAK_STAA9 Chaperone protein DnaK OS=Staphylococcus aureus (strain JH9) GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|Q2FXZ2|DNAK_STAA8 Chaperone protein DnaK OS=Staphylococcus aureus (strain NCTC 8325) GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|Q2FGE3|DNAK_STAA3 Chaperone protein DnaK OS=Staphylococcus aureus (strain USA300) GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|A6U252|DNAK_STAA2 Chaperone protein DnaK OS=Staphylococcus aureus (strain JH1) GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|A7X2Y1|DNAK_STAA1 Chaperone protein DnaK OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|Q661A3|DNAK_BORBP Chaperone protein DnaK OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|C5D4U1|DNAK_GEOSW Chaperone protein DnaK OS=Geobacillus sp. (strain WCH70) GN=dnaK PE=3 SV=1 19 454 2.0E-41
sp|Q6G554|DNAK_BARHE Chaperone protein DnaK OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaK PE=3 SV=1 19 474 2.0E-41
sp|Q0SMZ0|DNAK_BORAP Chaperone protein DnaK OS=Borrelia afzelii (strain PKo) GN=dnaK PE=3 SV=1 19 401 2.0E-41
sp|P17820|DNAK_BACSU Chaperone protein DnaK OS=Bacillus subtilis (strain 168) GN=dnaK PE=1 SV=3 19 454 3.0E-41
sp|B0TQC2|DNAK_SHEHH Chaperone protein DnaK OS=Shewanella halifaxensis (strain HAW-EB4) GN=dnaK PE=3 SV=1 19 401 3.0E-41
sp|Q1JKD6|DNAK_STRPC Chaperone protein DnaK OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dnaK PE=3 SV=1 19 454 3.0E-41
sp|Q1JA83|DNAK_STRPB Chaperone protein DnaK OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=dnaK PE=3 SV=1 19 454 3.0E-41
sp|Q5KWZ7|DNAK_GEOKA Chaperone protein DnaK OS=Geobacillus kaustophilus (strain HTA426) GN=dnaK PE=1 SV=1 19 463 3.0E-41
sp|C0M7T9|DNAK_STRE4 Chaperone protein DnaK OS=Streptococcus equi subsp. equi (strain 4047) GN=dnaK PE=3 SV=1 19 454 3.0E-41
sp|A6WRU9|DNAK_SHEB8 Chaperone protein DnaK OS=Shewanella baltica (strain OS185) GN=dnaK PE=3 SV=1 19 401 3.0E-41
sp|A3D7T4|DNAK_SHEB5 Chaperone protein DnaK OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dnaK PE=3 SV=1 19 401 3.0E-41
sp|B8E4S1|DNAK_SHEB2 Chaperone protein DnaK OS=Shewanella baltica (strain OS223) GN=dnaK PE=3 SV=1 19 401 3.0E-41
sp|P0A3J4|DNAK_STRAG Chaperone protein DnaK OS=Streptococcus agalactiae GN=dnaK PE=3 SV=1 19 454 3.0E-41
sp|P0A3J3|DNAK_STRA5 Chaperone protein DnaK OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dnaK PE=3 SV=1 19 454 3.0E-41
sp|P0A3J2|DNAK_STRA3 Chaperone protein DnaK OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dnaK PE=3 SV=1 19 454 3.0E-41
sp|Q3K3T2|DNAK_STRA1 Chaperone protein DnaK OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dnaK PE=3 SV=1 19 454 3.0E-41
sp|A7Z6W1|DNAK_BACMF Chaperone protein DnaK OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dnaK PE=3 SV=1 19 401 3.0E-41
sp|Q7U6R7|DNAK1_SYNPX Chaperone protein dnaK1 OS=Synechococcus sp. (strain WH8102) GN=dnaK1 PE=3 SV=1 19 401 3.0E-41
sp|C0ME86|DNAK_STRS7 Chaperone protein DnaK OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=dnaK PE=3 SV=1 19 454 3.0E-41
sp|A9L0R8|DNAK_SHEB9 Chaperone protein DnaK OS=Shewanella baltica (strain OS195) GN=dnaK PE=3 SV=1 19 401 3.0E-41
sp|Q5LWJ6|DNAK_RUEPO Chaperone protein DnaK OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dnaK PE=3 SV=1 19 474 4.0E-41
sp|A8FFD2|DNAK_BACP2 Chaperone protein DnaK OS=Bacillus pumilus (strain SAFR-032) GN=dnaK PE=3 SV=1 19 454 4.0E-41
sp|A1RGN1|DNAK_SHESW Chaperone protein DnaK OS=Shewanella sp. (strain W3-18-1) GN=dnaK PE=3 SV=1 19 401 4.0E-41
sp|A4Y9Q3|DNAK_SHEPC Chaperone protein DnaK OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dnaK PE=3 SV=1 19 401 4.0E-41
sp|Q4FNP9|DNAK_PELUB Chaperone protein DnaK OS=Pelagibacter ubique (strain HTCC1062) GN=dnaK PE=3 SV=1 19 402 4.0E-41
sp|A0L4Z2|DNAK_MAGMM Chaperone protein DnaK OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=dnaK PE=3 SV=1 19 474 4.0E-41
sp|Q8CP17|DNAK_STAES Chaperone protein DnaK OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaK PE=3 SV=1 19 401 4.0E-41
sp|Q18GZ4|DNAK_HALWD Chaperone protein DnaK OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=dnaK PE=3 SV=1 19 401 4.0E-41
sp|Q01899|HSP7M_PHAVU Heat shock 70 kDa protein, mitochondrial OS=Phaseolus vulgaris PE=2 SV=1 13 474 4.0E-41
sp|Q5HNW6|DNAK_STAEQ Chaperone protein DnaK OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dnaK PE=3 SV=1 19 401 4.0E-41
sp|B5XHZ0|DNAK_STRPZ Chaperone protein DnaK OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dnaK PE=3 SV=1 19 454 5.0E-41
sp|Q11KJ6|DNAK_CHESB Chaperone protein DnaK OS=Chelativorans sp. (strain BNC1) GN=dnaK PE=3 SV=1 19 474 5.0E-41
sp|Q1JFC8|DNAK_STRPD Chaperone protein DnaK OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dnaK PE=3 SV=1 19 454 5.0E-41
sp|B1KRT2|DNAK_SHEWM Chaperone protein DnaK OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dnaK PE=3 SV=1 19 401 5.0E-41
sp|Q08276|HSP7M_SOLTU Heat shock 70 kDa protein, mitochondrial OS=Solanum tuberosum GN=HSP68 PE=2 SV=1 12 474 5.0E-41
sp|P0DB71|DNAK_STRPQ Chaperone protein DnaK OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dnaK PE=3 SV=1 19 454 5.0E-41
sp|P0DB70|DNAK_STRP3 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dnaK PE=3 SV=1 19 454 5.0E-41
sp|A1KSG3|DNAK_NEIMF Chaperone protein DnaK OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dnaK PE=3 SV=1 19 401 6.0E-41
sp|Q9HHB9|DNAK_HALMT Chaperone protein DnaK OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=dnaK PE=3 SV=1 19 401 6.0E-41
sp|C1DD88|DNAK_LARHH Chaperone protein DnaK OS=Laribacter hongkongensis (strain HLHK9) GN=dnaK PE=3 SV=1 19 401 7.0E-41
sp|Q95YL7|HSP70_ENCHE Mitochondrial-type heat shock protein 70 OS=Encephalitozoon hellem GN=HSP70 PE=3 SV=1 19 474 7.0E-41
sp|P0C0C5|DNAK_STRPY Chaperone protein DnaK OS=Streptococcus pyogenes GN=dnaK PE=3 SV=2 19 454 8.0E-41
sp|Q48RR3|DNAK_STRPM Chaperone protein DnaK OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dnaK PE=3 SV=1 19 454 8.0E-41
sp|A2RCW6|DNAK_STRPG Chaperone protein DnaK OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dnaK PE=3 SV=1 19 454 8.0E-41
sp|Q1J578|DNAK_STRPF Chaperone protein DnaK OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dnaK PE=3 SV=1 19 454 8.0E-41
sp|P68837|DNAK_STRP8 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dnaK PE=3 SV=2 19 454 8.0E-41
sp|Q5XAD6|DNAK_STRP6 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dnaK PE=1 SV=3 19 454 8.0E-41
sp|P0C0C6|DNAK_STRP1 Chaperone protein DnaK OS=Streptococcus pyogenes serotype M1 GN=dnaK PE=3 SV=2 19 454 8.0E-41
sp|A5GDC8|DNAK_GEOUR Chaperone protein DnaK OS=Geobacter uraniireducens (strain Rf4) GN=dnaK PE=3 SV=1 19 402 8.0E-41
sp|B9DNK0|DNAK_STACT Chaperone protein DnaK OS=Staphylococcus carnosus (strain TM300) GN=dnaK PE=3 SV=1 19 401 9.0E-41
sp|Q45551|DNAK_GEOSE Chaperone protein DnaK OS=Geobacillus stearothermophilus GN=dnaK PE=3 SV=2 19 463 1.0E-40
sp|B7GKC8|DNAK_ANOFW Chaperone protein DnaK OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=dnaK PE=3 SV=1 19 463 1.0E-40
sp|A8EWT6|DNAK_ARCB4 Chaperone protein DnaK OS=Arcobacter butzleri (strain RM4018) GN=dnaK PE=3 SV=1 19 370 1.0E-40
sp|Q39PT7|DNAK_GEOMG Chaperone protein DnaK OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=dnaK PE=3 SV=1 19 454 1.0E-40
sp|P69377|DNAK_PORUM Chaperone protein dnaK OS=Porphyra umbilicalis GN=dnaK PE=3 SV=1 19 401 1.0E-40
sp|P69376|DNAK_PORPU Chaperone protein dnaK OS=Porphyra purpurea GN=dnaK PE=3 SV=1 19 401 1.0E-40
sp|Q1GKS3|DNAK_RUEST Chaperone protein DnaK OS=Ruegeria sp. (strain TM1040) GN=dnaK PE=3 SV=1 19 474 1.0E-40
sp|Q12Q08|DNAK_SHEDO Chaperone protein DnaK OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dnaK PE=3 SV=1 19 401 1.0E-40
sp|B8CXL1|DNAK_HALOH Chaperone protein DnaK OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaK PE=3 SV=1 19 474 1.0E-40
sp|Q3SIN4|DNAK_THIDA Chaperone protein DnaK OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaK PE=3 SV=1 19 402 2.0E-40
sp|Q28VY3|DNAK_JANSC Chaperone protein DnaK OS=Jannaschia sp. (strain CCS1) GN=dnaK PE=3 SV=1 19 454 2.0E-40
sp|A1B4E9|DNAK_PARDP Chaperone protein DnaK OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaK PE=3 SV=1 19 474 2.0E-40
sp|Q04EE1|DNAK_OENOB Chaperone protein DnaK OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=dnaK PE=3 SV=1 19 401 2.0E-40
sp|A0KTS5|DNAK_SHESA Chaperone protein DnaK OS=Shewanella sp. (strain ANA-3) GN=dnaK PE=3 SV=1 19 401 2.0E-40
sp|Q9K0N4|DNAK_NEIMB Chaperone protein DnaK OS=Neisseria meningitidis serogroup B (strain MC58) GN=dnaK PE=1 SV=1 19 401 2.0E-40
sp|Q0HY11|DNAK_SHESR Chaperone protein DnaK OS=Shewanella sp. (strain MR-7) GN=dnaK PE=3 SV=1 19 401 2.0E-40
sp|Q2KDW6|DNAK_RHIEC Chaperone protein DnaK OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaK PE=3 SV=1 19 474 2.0E-40
sp|B3PXH3|DNAK_RHIE6 Chaperone protein DnaK OS=Rhizobium etli (strain CIAT 652) GN=dnaK PE=3 SV=1 19 474 2.0E-40
sp|P05646|DNAK_BACME Chaperone protein DnaK OS=Bacillus megaterium GN=dnaK PE=3 SV=3 19 454 2.0E-40
sp|Q8EHT7|DNAK_SHEON Chaperone protein DnaK OS=Shewanella oneidensis (strain MR-1) GN=dnaK PE=3 SV=1 19 401 2.0E-40
sp|A8Z5V5|DNAK_SULMW Chaperone protein DnaK OS=Sulcia muelleri (strain GWSS) GN=dnaK PE=3 SV=1 19 454 2.0E-40
sp|Q03WI2|DNAK_LEUMM Chaperone protein DnaK OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=dnaK PE=3 SV=1 19 454 2.0E-40
sp|Q01PM8|DNAK_SOLUE Chaperone protein DnaK OS=Solibacter usitatus (strain Ellin6076) GN=dnaK PE=3 SV=1 19 474 2.0E-40
sp|Q0HLN0|DNAK_SHESM Chaperone protein DnaK OS=Shewanella sp. (strain MR-4) GN=dnaK PE=3 SV=1 19 401 2.0E-40
sp|B2G6W3|DNAK_LACRJ Chaperone protein DnaK OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaK PE=3 SV=1 19 454 2.0E-40
sp|A5VJE7|DNAK_LACRD Chaperone protein DnaK OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaK PE=3 SV=1 19 454 2.0E-40
sp|B9M357|DNAK_GEODF Chaperone protein DnaK OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=dnaK PE=3 SV=1 19 454 2.0E-40
sp|P49463|DNAK_ODOSI Chaperone protein dnaK OS=Odontella sinensis GN=dnaK PE=3 SV=1 19 454 2.0E-40
sp|A0AIS4|DNAK_LISW6 Chaperone protein DnaK OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dnaK PE=3 SV=1 19 454 2.0E-40
sp|Q16D45|DNAK_ROSDO Chaperone protein DnaK OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dnaK PE=3 SV=1 19 474 3.0E-40
sp|A1WX31|DNAK_HALHL Chaperone protein DnaK OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaK PE=3 SV=1 19 401 3.0E-40
sp|P50019|DNAK_AGRFC Chaperone protein DnaK OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaK PE=2 SV=2 19 474 3.0E-40
sp|A6LDG8|DNAK_PARD8 Chaperone protein DnaK OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=dnaK PE=3 SV=1 19 401 3.0E-40
sp|Q8EPW4|DNAK_OCEIH Chaperone protein DnaK OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dnaK PE=3 SV=1 19 402 3.0E-40
sp|A6QBG0|DNAK_SULNB Chaperone protein DnaK OS=Sulfurovum sp. (strain NBC37-1) GN=dnaK PE=3 SV=1 19 454 3.0E-40
sp|Q9KD72|DNAK_BACHD Chaperone protein DnaK OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dnaK PE=3 SV=3 19 454 4.0E-40
sp|P50020|DNAK1_SYNE7 Chaperone protein dnaK1 OS=Synechococcus elongatus (strain PCC 7942) GN=dnaK1 PE=3 SV=2 19 474 4.0E-40
sp|Q7VIE3|DNAK_HELHP Chaperone protein DnaK OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=dnaK PE=3 SV=1 19 402 4.0E-40
sp|Q1MN11|DNAK_RHIL3 Chaperone protein DnaK OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaK PE=3 SV=1 19 474 4.0E-40
sp|Q9JVQ9|DNAK_NEIMA Chaperone protein DnaK OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dnaK PE=3 SV=1 19 401 4.0E-40
sp|B6IVA4|DNAK_RHOCS Chaperone protein DnaK OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dnaK PE=3 SV=1 19 402 4.0E-40
sp|C0QGP6|DNAK_DESAH Chaperone protein DnaK OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=dnaK PE=3 SV=1 19 402 4.0E-40
sp|A8FYU0|DNAK_SHESH Chaperone protein DnaK OS=Shewanella sediminis (strain HAW-EB3) GN=dnaK PE=3 SV=1 19 401 5.0E-40
sp|Q74H59|DNAK_GEOSL Chaperone protein DnaK OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaK PE=3 SV=1 19 454 5.0E-40
sp|B5ZWQ2|DNAK_RHILW Chaperone protein DnaK OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaK PE=3 SV=1 19 474 5.0E-40
sp|Q3IUI0|DNAK_NATPD Chaperone protein DnaK OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=dnaK PE=3 SV=1 19 401 6.0E-40
sp|B4EDZ2|DNAK_BURCJ Chaperone protein DnaK OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dnaK PE=3 SV=1 19 474 6.0E-40
sp|B2S2G4|DNAK_TREPS Chaperone protein DnaK OS=Treponema pallidum subsp. pallidum (strain SS14) GN=dnaK PE=3 SV=1 19 464 6.0E-40
sp|O83246|DNAK_TREPA Chaperone protein DnaK OS=Treponema pallidum (strain Nichols) GN=dnaK PE=3 SV=1 19 464 6.0E-40
sp|Q98DD1|DNAK_RHILO Chaperone protein DnaK OS=Rhizobium loti (strain MAFF303099) GN=dnaK PE=3 SV=1 19 474 7.0E-40
sp|Q892R0|DNAK_CLOTE Chaperone protein DnaK OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaK PE=3 SV=1 19 474 8.0E-40
sp|B2S0M0|DNAK_BORHD Chaperone protein DnaK OS=Borrelia hermsii (strain HS1 / DAH) GN=dnaK PE=3 SV=1 19 401 8.0E-40
sp|B8GNX1|DNAK_THISH Chaperone protein DnaK OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaK PE=3 SV=1 19 401 8.0E-40
sp|A4IR31|DNAK_GEOTN Chaperone protein DnaK OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dnaK PE=3 SV=1 19 463 8.0E-40
sp|B0S1F8|DNAK_FINM2 Chaperone protein DnaK OS=Finegoldia magna (strain ATCC 29328) GN=dnaK PE=3 SV=1 19 474 8.0E-40
sp|Q6MNF8|DNAK_BDEBA Chaperone protein DnaK OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dnaK PE=3 SV=1 19 454 8.0E-40
sp|Q47HK2|DNAK_DECAR Chaperone protein DnaK OS=Dechloromonas aromatica (strain RCB) GN=dnaK PE=3 SV=1 19 402 9.0E-40
sp|Q2SYZ4|DNAK_BURTA Chaperone protein DnaK OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dnaK PE=3 SV=1 19 474 9.0E-40
sp|A9M296|DNAK_NEIM0 Chaperone protein DnaK OS=Neisseria meningitidis serogroup C (strain 053442) GN=dnaK PE=3 SV=1 19 401 9.0E-40
sp|B2GBQ5|DNAK_LACF3 Chaperone protein DnaK OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=dnaK PE=3 SV=1 19 454 9.0E-40
sp|Q5P1H5|DNAK_AROAE Chaperone protein DnaK OS=Aromatoleum aromaticum (strain EbN1) GN=dnaK PE=3 SV=1 19 402 9.0E-40
sp|Q2SMM8|DNAK_HAHCH Chaperone protein DnaK OS=Hahella chejuensis (strain KCTC 2396) GN=dnaK PE=3 SV=1 19 454 9.0E-40
sp|B0BC31|DNAK_CHLTB Chaperone protein DnaK OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dnaK PE=3 SV=1 19 454 1.0E-39
sp|Q3KLV7|DNAK_CHLTA Chaperone protein DnaK OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dnaK PE=3 SV=1 19 454 1.0E-39
sp|B0B7W6|DNAK_CHLT2 Chaperone protein DnaK OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dnaK PE=3 SV=1 19 454 1.0E-39
sp|P73098|DNAK3_SYNY3 Chaperone protein dnaK3 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaK3 PE=3 SV=2 19 401 1.0E-39
sp|P17821|DNAK_CHLTR Chaperone protein DnaK OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dnaK PE=3 SV=4 19 454 1.0E-39
sp|Q65H54|DNAK_BACLD Chaperone protein DnaK OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dnaK PE=3 SV=1 19 454 1.0E-39
sp|A0T0H7|DNAK_PHATC Chaperone protein dnaK OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=dnaK PE=3 SV=1 19 454 1.0E-39
sp|O96772|HSP70_ENCCU Mitochondrial-type heat shock protein 70 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HSP70 PE=3 SV=1 19 402 1.0E-39
sp|A5V5P9|DNAK_SPHWW Chaperone protein DnaK OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=dnaK PE=3 SV=1 19 474 1.0E-39
sp|Q8RB68|DNAK_CALS4 Chaperone protein DnaK OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaK PE=3 SV=1 19 463 1.0E-39
sp|Q9LCQ5|DNAK_BRECH Chaperone protein DnaK OS=Brevibacillus choshinensis GN=dnaK PE=3 SV=1 19 401 1.0E-39
sp|B9L8Z0|DNAK_NAUPA Chaperone protein DnaK OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=dnaK PE=3 SV=1 19 454 1.0E-39
sp|B9IY81|DNAK_BACCQ Chaperone protein DnaK OS=Bacillus cereus (strain Q1) GN=dnaK PE=3 SV=1 19 454 1.0E-39
sp|B7HPL3|DNAK_BACC7 Chaperone protein DnaK OS=Bacillus cereus (strain AH187) GN=dnaK PE=3 SV=1 19 454 1.0E-39
sp|Q03FR7|DNAK_PEDPA Chaperone protein DnaK OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=dnaK PE=3 SV=1 19 454 1.0E-39
sp|B5RPM1|DNAK_BORRA Chaperone protein DnaK OS=Borrelia recurrentis (strain A1) GN=dnaK PE=3 SV=1 19 474 1.0E-39
sp|A0K4S8|DNAK_BURCH Chaperone protein DnaK OS=Burkholderia cenocepacia (strain HI2424) GN=dnaK PE=3 SV=1 19 474 1.0E-39
sp|B1JW19|DNAK_BURCC Chaperone protein DnaK OS=Burkholderia cenocepacia (strain MC0-3) GN=dnaK PE=3 SV=1 19 474 1.0E-39
sp|Q1BYX3|DNAK_BURCA Chaperone protein DnaK OS=Burkholderia cenocepacia (strain AU 1054) GN=dnaK PE=3 SV=1 19 474 1.0E-39
sp|Q730M1|DNAK_BACC1 Chaperone protein DnaK OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dnaK PE=3 SV=1 19 454 1.0E-39
sp|Q73Q16|DNAK_TREDE Chaperone protein DnaK OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dnaK PE=3 SV=1 19 464 1.0E-39
sp|B5RM75|DNAK_BORDL Chaperone protein DnaK OS=Borrelia duttonii (strain Ly) GN=dnaK PE=3 SV=1 19 474 1.0E-39
sp|P37900|HSP7M_PEA Heat shock 70 kDa protein, mitochondrial OS=Pisum sativum GN=HSP1 PE=2 SV=1 13 474 1.0E-39
sp|A3PNM1|DNAK_RHOS1 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dnaK PE=3 SV=1 19 474 2.0E-39
sp|Q3IYM7|DNAK_RHOS4 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dnaK PE=3 SV=1 19 474 2.0E-39
sp|Q71ZJ7|DNAK_LISMF Chaperone protein DnaK OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dnaK PE=3 SV=3 19 401 2.0E-39
sp|C1KVC0|DNAK_LISMC Chaperone protein DnaK OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dnaK PE=3 SV=1 19 401 2.0E-39
sp|Q9ZEJ6|DNAK1_NOSS1 Chaperone protein dnaK1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaK1 PE=3 SV=2 19 474 2.0E-39
sp|Q17VY4|DNAK_HELAH Chaperone protein DnaK OS=Helicobacter acinonychis (strain Sheeba) GN=dnaK PE=3 SV=1 19 454 2.0E-39
sp|Q6MB26|DNAK_PARUW Chaperone protein DnaK OS=Protochlamydia amoebophila (strain UWE25) GN=dnaK PE=3 SV=1 19 401 2.0E-39
sp|A9VHU1|DNAK_BACWK Chaperone protein DnaK OS=Bacillus weihenstephanensis (strain KBAB4) GN=dnaK PE=3 SV=1 19 454 2.0E-39
sp|Q92BN8|DNAK_LISIN Chaperone protein DnaK OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dnaK PE=3 SV=3 19 401 2.0E-39
sp|B2JGE2|DNAK_BURP8 Chaperone protein DnaK OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaK PE=3 SV=1 19 474 2.0E-39
sp|P56836|DNAK_CHLMU Chaperone protein DnaK OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dnaK PE=3 SV=2 19 454 2.0E-39
sp|P0DJM2|DNAK_LISMO Chaperone protein DnaK OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dnaK PE=3 SV=1 19 401 2.0E-39
sp|G2K046|DNAK_LISM4 Chaperone protein DnaK OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=dnaK PE=3 SV=1 19 401 2.0E-39
sp|B8DE38|DNAK_LISMH Chaperone protein DnaK OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dnaK PE=3 SV=1 19 401 2.0E-39
sp|Q02ZQ7|DNAK_LACLS Chaperone protein DnaK OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=dnaK PE=3 SV=1 19 401 2.0E-39
sp|O35501|GRP75_CRIGR Stress-70 protein, mitochondrial OS=Cricetulus griseus GN=HSPA9 PE=2 SV=1 10 474 2.0E-39
sp|Q05647|DNAK_ERYRH Chaperone protein DnaK OS=Erysipelothrix rhusiopathiae GN=dnaK PE=3 SV=2 19 401 2.0E-39
sp|P0A3J1|DNAK_LACLM Chaperone protein DnaK OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=dnaK PE=3 SV=1 19 401 2.0E-39
sp|Q8I0H7|HSP7M_DICDI Heat shock 70 kDa protein, mitochondrial OS=Dictyostelium discoideum GN=mhsp70 PE=1 SV=1 19 480 2.0E-39
sp|B1MZG6|DNAK_LEUCK Chaperone protein DnaK OS=Leuconostoc citreum (strain KM20) GN=dnaK PE=3 SV=1 19 454 2.0E-39
sp|B9KCH0|DNAK_CAMLR Chaperone protein DnaK OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dnaK PE=3 SV=1 19 474 2.0E-39
sp|B3WEQ7|DNAK_LACCB Chaperone protein DnaK OS=Lactobacillus casei (strain BL23) GN=dnaK PE=3 SV=1 19 454 2.0E-39
sp|Q038N3|DNAK_LACC3 Chaperone protein DnaK OS=Lactobacillus casei (strain ATCC 334) GN=dnaK PE=3 SV=1 19 454 2.0E-39
sp|B2SQU4|DNAK_XANOP Chaperone protein DnaK OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=dnaK PE=3 SV=1 19 453 2.0E-39
sp|Q2P459|DNAK_XANOM Chaperone protein DnaK OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dnaK PE=3 SV=1 19 453 2.0E-39
sp|Q47XI6|DNAK2_COLP3 Chaperone protein DnaK 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dnaK2 PE=3 SV=1 19 401 2.0E-39
sp|Q5H186|DNAK_XANOR Chaperone protein DnaK OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=dnaK PE=3 SV=1 19 453 2.0E-39
sp|P26823|DNAK_CLOPE Chaperone protein DnaK OS=Clostridium perfringens (strain 13 / Type A) GN=dnaK PE=3 SV=2 19 474 2.0E-39
sp|Q0TNS7|DNAK_CLOP1 Chaperone protein DnaK OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=dnaK PE=3 SV=1 19 474 2.0E-39
sp|Q8FXX2|DNAK_BRUSU Chaperone protein DnaK OS=Brucella suis biovar 1 (strain 1330) GN=dnaK PE=3 SV=1 19 474 3.0E-39
sp|O05714|DNAK_ANAVT Chaperone protein DnaK OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dnaK PE=3 SV=1 19 474 3.0E-39
sp|Q3ZCH0|GRP75_BOVIN Stress-70 protein, mitochondrial OS=Bos taurus GN=HSPA9 PE=2 SV=1 10 474 3.0E-39
sp|P38647|GRP75_MOUSE Stress-70 protein, mitochondrial OS=Mus musculus GN=Hspa9 PE=1 SV=3 10 474 3.0E-39
sp|Q05981|DNAK_BRUO2 Chaperone protein DnaK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaK PE=2 SV=2 19 474 3.0E-39
sp|Q57AD7|DNAK_BRUAB Chaperone protein DnaK OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaK PE=3 SV=1 19 474 3.0E-39
sp|P0A3J0|DNAK_LACLA Chaperone protein DnaK OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dnaK PE=3 SV=1 19 401 3.0E-39
sp|Q1IT15|DNAK_KORVE Chaperone protein DnaK OS=Koribacter versatilis (strain Ellin345) GN=dnaK PE=3 SV=1 19 402 3.0E-39
sp|Q8YE76|DNAK_BRUME Chaperone protein DnaK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaK PE=3 SV=2 19 474 3.0E-39
sp|B9MJZ1|DNAK_CALBD Chaperone protein DnaK OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaK PE=3 SV=1 19 464 3.0E-39
sp|A7GT08|DNAK_BACCN Chaperone protein DnaK OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dnaK PE=3 SV=1 19 454 3.0E-39
[Show less]

GO

GO Term Description Terminal node
GO:0000902 cell morphogenesis Yes
GO:0009987 cellular process No
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:0048869 cellular developmental process No
GO:0009653 anatomical structure morphogenesis No
GO:0016043 cellular component organization No
GO:0032989 cellular component morphogenesis No
GO:0032502 developmental process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7007
MSESKGVKPAPEPADRVAIGITFGNSNSSIAFTVDDKAEVIANEDGDRQIPTVLSYVDGDEYYGSQAKAFLVRNP
TNTVAYFRDFLGKEFKAIDPTHCHAAAHPHDSAGAVSFSVKDKSGDEEASSVPVGEASTRFLRRLVTSASEYLGK
KVTSAVITVPTNFSDKQREALTKAASDADLETLQLISDPIAAVLAYDARPEASVEDKIVVVADLGGTRSDVAVVA
SRGGMYTILATVHDYEFAGVHLDQALMDHFAKEFIKKHSTDPRSNAKSLAKLRQEAEATKKALSLGTNAQFSVES
LADGFDFSSTINRLRYEMIGRKIFEGFNRLVEGAVKKAELDVLDVDEVIMCGGTSHTPRIANNFRGIFPDTTKIL
APATSTAAINPSELQARGAALQASLIQEYEAADIEQSTHPAVTTVNHISNAIGVVAVGADGDETFTPIMQAETAA
PARRIVHLTCPKDGGDLLIKVVEGGTHIKVTKPEPKARAPVENGDKADDDDSDSDDDEEEEEEEKREKVWKVGRQ
LAEAAVKGVKKGGKVEVTINVAGDLAVTITAREVGSKGGVRGTLAAP*
Coding >Hirsu2|7007
ATGTCTGAGAGCAAGGGCGTCAAGCCGGCCCCCGAGCCGGCAGACCGGGTGGCGATTGGCATCACGTTTGGCAAC
TCGAACAGCTCAATTGCGTTTACCGTCGACGACAAGGCCGAAGTCATCGCCAATGAGGATGGAGATCGACAAATC
CCCACGGTCCTGTCCTATGTCGATGGCGACGAGTACTACGGCTCCCAGGCCAAGGCTTTCCTAGTCCGTAACCCG
ACAAACACCGTGGCCTACTTCCGCGACTTCCTGGGTAAAGAGTTCAAAGCCATCGACCCGACCCATTGCCACGCC
GCCGCCCATCCTCACGACTCGGCCGGTGCCGTCTCCTTCTCCGTCAAGGACAAGAGCGGCGACGAGGAGGCGTCG
TCGGTCCCGGTCGGCGAGGCTTCCACCCGCTTCCTGCGACGCCTCGTCACGTCGGCCTCCGAGTACCTCGGCAAG
AAGGTCACGTCCGCTGTCATCACAGTCCCGACCAACTTCAGCGACAAGCAGCGCGAGGCCCTGACCAAGGCCGCC
AGCGACGCCGACCTCGAGACGCTGCAGCTCATCTCGGACCCGATCGCCGCCGTCCTGGCCTATGATGCCCGGCCC
GAGGCCTCGGTCGAGGACAAGATCGTCGTCGTCGCCGACCTCGGCGGCACTCGCTCAGACGTGGCCGTCGTCGCC
TCGCGGGGGGGCATGTACACCATCCTGGCCACGGTGCACGACTACGAGTTCGCCGGCGTCCACCTCGACCAGGCG
CTCATGGACCACTTCGCCAAGGAGTTCATCAAGAAGCACAGCACGGATCCCCGGTCCAACGCCAAGAGCCTGGCC
AAGCTCCGACAAGAGGCCGAGGCCACGAAGAAGGCCCTCAGCCTGGGCACCAACGCCCAGTTCAGCGTCGAGAGC
CTGGCGGACGGCTTCGACTTCTCGTCGACGATCAACAGGTTACGATACGAGATGATCGGCCGCAAGATCTTCGAG
GGCTTCAACCGCCTGGTCGAGGGCGCCGTCAAGAAGGCCGAGCTCGACGTCCTGGACGTCGACGAGGTCATCATG
TGCGGCGGCACCTCGCACACGCCGCGCATCGCCAACAACTTCCGCGGCATCTTCCCCGACACGACCAAGATCCTG
GCGCCGGCGACGAGCACGGCGGCCATCAACCCGTCGGAGCTGCAGGCCCGGGGCGCGGCGCTGCAGGCGTCGCTG
ATCCAGGAGTACGAGGCGGCCGACATCGAGCAGTCGACGCACCCGGCCGTGACGACGGTCAACCACATCTCCAAC
GCCATCGGCGTCGTTGCCGTCGGCGCCGACGGCGACGAGACGTTCACGCCCATTATGCAGGCCGAGACGGCGGCG
CCCGCCCGCCGCATCGTGCACCTGACGTGCCCCAAGGACGGCGGCGACCTGCTGATCAAGGTGGTCGAGGGCGGC
ACACACATCAAGGTGACGAAGCCGGAGCCCAAGGCCAGGGCGCCGGTCGAGAACGGGGACAAGGCCGACGACGAC
GACTCGGACTCGGACGACGACGAGGAGGAGGAAGAGGAGGAGAAGCGCGAGAAGGTGTGGAAGGTGGGCAGGCAG
CTGGCCGAGGCGGCCGTCAAGGGCGTCAAGAAGGGCGGCAAGGTCGAGGTGACGATCAACGTGGCAGGCGACCTG
GCCGTCACCATCACGGCGCGCGAGGTCGGCAGCAAGGGCGGCGTGCGCGGAACGCTGGCGGCGCCCTGA
Transcript >Hirsu2|7007
ATGTCTGAGAGCAAGGGCGTCAAGCCGGCCCCCGAGCCGGCAGACCGGGTGGCGATTGGCATCACGTTTGGCAAC
TCGAACAGCTCAATTGCGTTTACCGTCGACGACAAGGCCGAAGTCATCGCCAATGAGGATGGAGATCGACAAATC
CCCACGGTCCTGTCCTATGTCGATGGCGACGAGTACTACGGCTCCCAGGCCAAGGCTTTCCTAGTCCGTAACCCG
ACAAACACCGTGGCCTACTTCCGCGACTTCCTGGGTAAAGAGTTCAAAGCCATCGACCCGACCCATTGCCACGCC
GCCGCCCATCCTCACGACTCGGCCGGTGCCGTCTCCTTCTCCGTCAAGGACAAGAGCGGCGACGAGGAGGCGTCG
TCGGTCCCGGTCGGCGAGGCTTCCACCCGCTTCCTGCGACGCCTCGTCACGTCGGCCTCCGAGTACCTCGGCAAG
AAGGTCACGTCCGCTGTCATCACAGTCCCGACCAACTTCAGCGACAAGCAGCGCGAGGCCCTGACCAAGGCCGCC
AGCGACGCCGACCTCGAGACGCTGCAGCTCATCTCGGACCCGATCGCCGCCGTCCTGGCCTATGATGCCCGGCCC
GAGGCCTCGGTCGAGGACAAGATCGTCGTCGTCGCCGACCTCGGCGGCACTCGCTCAGACGTGGCCGTCGTCGCC
TCGCGGGGGGGCATGTACACCATCCTGGCCACGGTGCACGACTACGAGTTCGCCGGCGTCCACCTCGACCAGGCG
CTCATGGACCACTTCGCCAAGGAGTTCATCAAGAAGCACAGCACGGATCCCCGGTCCAACGCCAAGAGCCTGGCC
AAGCTCCGACAAGAGGCCGAGGCCACGAAGAAGGCCCTCAGCCTGGGCACCAACGCCCAGTTCAGCGTCGAGAGC
CTGGCGGACGGCTTCGACTTCTCGTCGACGATCAACAGGTTACGATACGAGATGATCGGCCGCAAGATCTTCGAG
GGCTTCAACCGCCTGGTCGAGGGCGCCGTCAAGAAGGCCGAGCTCGACGTCCTGGACGTCGACGAGGTCATCATG
TGCGGCGGCACCTCGCACACGCCGCGCATCGCCAACAACTTCCGCGGCATCTTCCCCGACACGACCAAGATCCTG
GCGCCGGCGACGAGCACGGCGGCCATCAACCCGTCGGAGCTGCAGGCCCGGGGCGCGGCGCTGCAGGCGTCGCTG
ATCCAGGAGTACGAGGCGGCCGACATCGAGCAGTCGACGCACCCGGCCGTGACGACGGTCAACCACATCTCCAAC
GCCATCGGCGTCGTTGCCGTCGGCGCCGACGGCGACGAGACGTTCACGCCCATTATGCAGGCCGAGACGGCGGCG
CCCGCCCGCCGCATCGTGCACCTGACGTGCCCCAAGGACGGCGGCGACCTGCTGATCAAGGTGGTCGAGGGCGGC
ACACACATCAAGGTGACGAAGCCGGAGCCCAAGGCCAGGGCGCCGGTCGAGAACGGGGACAAGGCCGACGACGAC
GACTCGGACTCGGACGACGACGAGGAGGAGGAAGAGGAGGAGAAGCGCGAGAAGGTGTGGAAGGTGGGCAGGCAG
CTGGCCGAGGCGGCCGTCAAGGGCGTCAAGAAGGGCGGCAAGGTCGAGGTGACGATCAACGTGGCAGGCGACCTG
GCCGTCACCATCACGGCGCGCGAGGTCGGCAGCAAGGGCGGCGTGCGCGGAACGCTGGCGGCGCCCTGA
Gene >Hirsu2|7007
ATGTCTGAGAGCAAGGGCGTCAAGCCGGCCCCCGAGCCGGCAGACCGGGTGGCGATTGGCATCACGTTTGGCAAC
TCGAACAGCTCAATTGCGTTTACCGTCGACGACAAGGCCGAAGTCATCGCCAATGAGGATGGAGGTGCGTTTCCT
GTTGCGCCTCGGAGCCTTGTACTCGGGCAGAGCCGGACGATGTGCTGACCTGGGCCCATGAACGGGGCATGTAGA
TCGACAAATCCCCACGGTCCTGTCCTATGTCGATGGCGACGAGTACTACGGCTCCCAGGCCAAGGCTTTCCTAGT
CCGTAACCCGACAAACACCGTGGCCTACTTCCGCGACTTCCTGGGTAAAGAGTGCGAAAGCGTCCCCTCCCCCTC
AAGAGTGTGCGAGGTAGAAGCGGATTTGCTGATGAGGTGCACAACAGGTTCAAAGCCATCGACCCGACCCATTGC
CACGCCGCCGCCCATCCTCACGACTCGGCCGGTGCCGTCTCCTTCTCCGTCAAGGACAAGAGCGGCGACGAGGAG
GCGTCGTCGGTCCCGGTCGGCGAGGCTTCCACCCGCTTCCTGCGACGCCTCGTCACGTCGGCCTCCGAGTACCTC
GGCAAGAAGGTCACGTCCGCTGTCATCACAGTCCCGACCAACTTCAGCGACAAGCAGCGCGAGGCCCTGACCAAG
GCCGCCAGCGACGCCGACCTCGAGACGCTGCAGCTCATCTCGGACCCGATCGCCGCCGTCCTGGCCTATGATGCC
CGGCCCGAGGCCTCGGTCGAGGACAAGATCGTCGTCGTCGCCGACCTCGGCGGCACTCGCTCAGACGTGGCCGTC
GTCGCCTCGCGGGGGGGCATGTACACCATCCTGGCCACGGTGCACGACTACGAGTTCGCCGGCGTCCACCTCGAC
CAGGCGCTCATGGACCACTTCGCCAAGGAGTTCATCAAGAAGCACAGCACGGATCCCCGGTCCAACGCCAAGAGC
CTGGCCAAGCTCCGACAAGAGGCCGAGGCCACGAAGAAGGCCCTCAGCCTGGGCACCAACGCCCAGTTCAGCGTC
GAGAGCCTGGCGGACGGCTTCGACTTCTCGTCGACGATCAACAGGTTACGATACGAGATGATCGGCCGCAAGATC
TTCGAGGGCTTCAACCGCCTGGTCGAGGGCGCCGTCAAGAAGGCCGAGCTCGACGTCCTGGACGTCGACGAGGTC
ATCATGTGCGGCGGCACCTCGCACACGCCGCGCATCGCCAACAACTTCCGCGGCATCTTCCCCGACACGACCAAG
ATCCTGGCGCCGGCGACGAGCACGGCGGCCATCAACCCGTCGGAGCTGCAGGCCCGGGGCGCGGCGCTGCAGGCG
TCGCTGATCCAGGAGTACGAGGCGGCCGACATCGAGCAGTCGACGCACCCGGCCGTGACGACGGTCAACCACATC
TCCAACGCCATCGGCGTCGTTGCCGTCGGCGCCGACGGCGACGAGACGTTCACGCCCATTATGCAGGCCGAGACG
GCGGCGCCCGCCCGCCGCATCGTGCACCTGACGTGCCCCAAGGACGGCGGCGACCTGCTGATCAAGGTGGTCGAG
GGCGGCACACACATCAAGGTGACGAAGCCGGAGCCCAAGGCCAGGGCGCCGGTCGAGAACGGGGACAAGGCCGAC
GACGACGACTCGGACTCGGACGACGACGAGGAGGAGGAAGAGGAGGAGAAGCGCGAGAAGGTGTGGAAGGTGGGC
AGGCAGCTGGCCGAGGCGGCCGTCAAGGGCGTCAAGAAGGGCGGCAAGGTCGAGGTGACGATCAACGTGGCAGGC
GACCTGGCCGTCACCATCACGGCGCGCGAGGTCGGCAGCAAGGGCGGCGTGCGCGGAACGCTGGCGGCGCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail