Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7005
Gene name
LocationContig_386:14973..16897
Strand+
Gene length (bp)1924
Transcript length (bp)1830
Coding sequence length (bp)1830
Protein length (aa) 610

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 499 589 2.0E-09
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 499 589 2.0E-09
sp|Q9P8W3|ACE1_HYPJE Zinc finger transcription factor ace1 OS=Hypocrea jecorina GN=ace1 PE=3 SV=1 500 589 1.0E-08
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 498 586 6.0E-08
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 498 586 8.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07243|MTF1_MOUSE Metal regulatory transcription factor 1 OS=Mus musculus GN=Mtf1 PE=1 SV=2 499 589 2.0E-09
sp|Q14872|MTF1_HUMAN Metal regulatory transcription factor 1 OS=Homo sapiens GN=MTF1 PE=1 SV=2 499 589 2.0E-09
sp|Q9P8W3|ACE1_HYPJE Zinc finger transcription factor ace1 OS=Hypocrea jecorina GN=ace1 PE=3 SV=1 500 589 1.0E-08
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 498 586 6.0E-08
sp|P98169|ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens GN=ZXDB PE=2 SV=2 498 586 8.0E-08
sp|P98168|ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens GN=ZXDA PE=1 SV=2 498 586 9.0E-08
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 500 568 1.0E-07
sp|Q59KL6|TF3A_CANAL Transcription factor IIIA OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PZF1 PE=2 SV=1 499 586 1.0E-07
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 489 590 1.0E-07
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 489 589 1.0E-07
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 489 590 1.0E-07
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 489 590 1.0E-07
sp|P52747|ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens GN=ZNF143 PE=1 SV=2 486 589 2.0E-07
sp|Q17308|TRA1_CAEBR Sex-determining transformer protein 1 OS=Caenorhabditis briggsae GN=tra-1 PE=1 SV=1 500 568 2.0E-07
sp|Q91853|ZN143_XENLA Zinc finger protein 143 OS=Xenopus laevis GN=znf143 PE=1 SV=2 499 589 3.0E-07
sp|Q58DZ6|ZN143_XENTR Zinc finger protein 143 OS=Xenopus tropicalis GN=znf143 PE=2 SV=2 499 589 3.0E-07
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 498 601 4.0E-07
sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 498 601 4.0E-07
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 488 586 4.0E-07
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 489 589 4.0E-07
sp|A6QQW0|ZN143_BOVIN Zinc finger protein 143 OS=Bos taurus GN=ZNF143 PE=2 SV=1 486 589 5.0E-07
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 501 590 5.0E-07
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 488 586 5.0E-07
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 501 590 5.0E-07
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 489 589 6.0E-07
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 489 589 6.0E-07
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 489 589 7.0E-07
sp|O35738|KLF12_MOUSE Krueppel-like factor 12 OS=Mus musculus GN=Klf12 PE=1 SV=2 476 586 7.0E-07
sp|A2CE44|ZXDB_MOUSE Zinc finger X-linked protein ZXDB OS=Mus musculus GN=Zxdb PE=2 SV=1 498 601 8.0E-07
sp|Q2QGD7|ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens GN=ZXDC PE=1 SV=2 499 592 1.0E-06
sp|Q5XIU2|ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus GN=Znf143 PE=2 SV=2 485 589 1.0E-06
sp|O70230|ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus GN=Znf143 PE=1 SV=2 485 589 1.0E-06
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 489 589 1.0E-06
sp|Q9Y4X4|KLF12_HUMAN Krueppel-like factor 12 OS=Homo sapiens GN=KLF12 PE=1 SV=2 476 586 2.0E-06
sp|P10070|GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens GN=GLI2 PE=1 SV=4 500 596 2.0E-06
sp|Q7ZZ00|ZN511_DANRE Zinc finger protein 511 OS=Danio rerio GN=znf511 PE=2 SV=1 499 589 2.0E-06
sp|Q5AMH6|CAS5_CANAL Cell wall integrity transcriptional regulator CAS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAS5 PE=3 SV=1 525 591 3.0E-06
sp|Q8C8V1|ZXDC_MOUSE Zinc finger protein ZXDC OS=Mus musculus GN=Zxdc PE=2 SV=1 499 585 4.0E-06
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 469 585 4.0E-06
sp|Q5IS56|GLI3_PANTR Transcriptional activator GLI3 OS=Pan troglodytes GN=GLI3 PE=2 SV=1 500 596 4.0E-06
sp|P10071|GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens GN=GLI3 PE=1 SV=6 500 596 4.0E-06
sp|Q7TQ40|ZIC5_MOUSE Zinc finger protein ZIC 5 OS=Mus musculus GN=Zic5 PE=1 SV=1 499 585 4.0E-06
sp|Q9BU19|ZN692_HUMAN Zinc finger protein 692 OS=Homo sapiens GN=ZNF692 PE=1 SV=1 485 562 5.0E-06
sp|A0JNJ4|ZN692_BOVIN Zinc finger protein 692 OS=Bos taurus GN=ZNF692 PE=2 SV=1 485 562 5.0E-06
sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 500 596 5.0E-06
sp|Q8BMU0|ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus GN=Znf76 PE=2 SV=1 499 589 5.0E-06
sp|B4F7E9|ZNF76_RAT Zinc finger protein 76 OS=Rattus norvegicus GN=Znf76 PE=2 SV=1 499 589 5.0E-06
sp|Q3SY56|SP6_HUMAN Transcription factor Sp6 OS=Homo sapiens GN=SP6 PE=2 SV=1 465 589 5.0E-06
sp|Q61602|GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus GN=Gli3 PE=1 SV=2 500 596 5.0E-06
sp|Q9IA31|GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus GN=GLI3 PE=1 SV=1 500 596 6.0E-06
sp|Q96T25|ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens GN=ZIC5 PE=1 SV=2 499 585 6.0E-06
sp|Q9ESX2|SP6_MOUSE Transcription factor Sp6 OS=Mus musculus GN=Sp6 PE=2 SV=2 465 589 7.0E-06
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 500 596 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 26 48 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7005
MAAEAVPRLVAWGSVVRRDLDDGAIAGTVVGVVIGAALIALCLYPVVIHLVKRRRRPRSLEFDAEHGAAAAAARH
DLAGLDDRRRLSSTDSFKHDGDLSRGDSRAAPVARQWGWPSRSQAPPRPRAGHSPPRQLSSSLPDTIASDRPLAP
APFYEGEYMPVSEVRDDHPGVLQGTSADYYSPSIPSEAFGMVTSPDEVAAAGVTASRGSSFRYNVRHMFRRKSGR
DAAVEPCPPAASSGDGQPVPSAAPQALQGVALQQITPTGDPAAEPSALSHQTSPPPAVASAAQTSASPSPPPPRP
PPQLPVEQPVKVSSPSPPAHPAPGTVNPMDIMPASTESELWYRNEHELLSAYRHPAAVSPVPDHEKRMSNPDTER
APSVAPPTPSTTVPHQAAAAATESATPTQAKGQDGPQGDDVLMTDAQQPHPDPSPPAVPEPGRYPSHTSDLSTLF
QGPGSTDLSSHNTPSTQLDSPTPESLNSSDFRHSVSPQSGNSTLKMGIFRCDVPGCQQVFDQPHKLKHHQRYHSK
DHKCPYANCEKGFGTKTHLHRHINDRHEKKKKFHCSVPGCDYSRAGGKGFPRKDNWKRHMIKTHHMDHAHLPEPI
EVDPDTAAT*
Coding >Hirsu2|7005
ATGGCGGCCGAGGCCGTGCCCCGCCTCGTCGCGTGGGGGTCCGTCGTGAGGCGAGACTTGGATGATGGGGCCATT
GCCGGCACCGTCGTCGGCGTCGTCATCGGCGCCGCCCTCATCGCCCTATGCCTCTATCCCGTCGTCATCCACCTC
GTCAAGCGGAGGCGCCGCCCCCGGTCCCTCGAGTTCGACGCCGAGCATGGCGCCGCCGCCGCCGCCGCCCGCCAC
GACCTAGCTGGCCTGGACGACCGCCGCCGCCTTTCATCGACCGACTCCTTCAAGCACGACGGCGACCTGTCCCGG
GGCGACAGTCGCGCCGCACCCGTCGCCAGGCAATGGGGCTGGCCGTCTCGCTCCCAAGCTCCCCCGCGCCCCAGG
GCGGGCCACTCTCCGCCGCGACAGCTGTCGTCGTCGCTCCCGGACACCATCGCCTCGGACCGCCCGCTTGCGCCC
GCCCCCTTCTACGAGGGAGAGTACATGCCCGTGTCCGAGGTGCGCGATGACCACCCGGGCGTTCTCCAGGGCACG
AGCGCCGACTACTACAGCCCGTCGATACCGTCCGAGGCCTTCGGCATGGTCACCTCCCCCGACGAAGTCGCCGCC
GCCGGCGTCACCGCCAGCCGCGGAAGCTCCTTCAGATACAACGTGAGGCACATGTTCCGGCGCAAGAGTGGCCGC
GATGCCGCCGTCGAGCCGTGCCCGCCCGCAGCCAGCTCCGGCGACGGGCAACCCGTCCCATCCGCCGCTCCGCAA
GCATTACAAGGCGTGGCCTTGCAGCAAATCACGCCGACGGGGGACCCGGCCGCCGAGCCCTCCGCGCTGTCGCAC
CAGACGAGCCCGCCGCCGGCCGTCGCTTCAGCTGCGCAAACGTCGGCTTCACCATCTCCTCCTCCACCCAGGCCG
CCACCGCAACTTCCCGTCGAACAGCCCGTCAAGGTGTCGTCTCCCTCGCCGCCCGCCCACCCCGCGCCAGGAACG
GTGAATCCGATGGATATCATGCCGGCAAGCACCGAGTCCGAGCTCTGGTACCGAAACGAGCACGAGCTTCTCTCC
GCCTACCGCCATCCAGCCGCCGTGTCACCGGTGCCGGATCATGAAAAGCGCATGAGCAATCCCGACACGGAACGC
GCCCCCTCGGTGGCCCCTCCGACGCCGTCCACGACGGTACCGCACCAGGCCGCCGCCGCCGCCACCGAATCCGCC
ACCCCAACCCAAGCCAAGGGCCAGGACGGGCCACAAGGAGATGATGTACTCATGACGGACGCCCAGCAGCCGCAC
CCTGACCCAAGCCCGCCCGCCGTGCCCGAGCCCGGGCGATACCCCAGCCATACATCCGACCTCTCCACCCTCTTC
CAAGGCCCGGGATCGACCGATCTCTCCTCCCACAACACACCCTCAACACAGCTAGACAGCCCTACGCCGGAGTCT
CTCAACAGCTCCGACTTTCGGCACAGCGTGTCGCCGCAGTCCGGCAACTCGACCCTTAAGATGGGCATCTTCCGC
TGCGATGTGCCCGGCTGCCAACAAGTGTTTGACCAGCCACACAAACTCAAGCATCACCAGCGCTATCACAGCAAG
GACCACAAATGTCCGTACGCGAATTGCGAGAAAGGTTTCGGGACCAAGACGCACCTGCACCGCCACATCAACGAC
AGGCATGAGAAGAAGAAGAAATTCCACTGCTCCGTCCCGGGCTGCGACTATTCCCGGGCCGGCGGCAAGGGCTTT
CCCCGCAAAGACAACTGGAAGAGGCACATGATTAAGACTCATCACATGGACCATGCACATCTCCCAGAGCCCATC
GAAGTAGATCCGGACACGGCCGCGACATGA
Transcript >Hirsu2|7005
ATGGCGGCCGAGGCCGTGCCCCGCCTCGTCGCGTGGGGGTCCGTCGTGAGGCGAGACTTGGATGATGGGGCCATT
GCCGGCACCGTCGTCGGCGTCGTCATCGGCGCCGCCCTCATCGCCCTATGCCTCTATCCCGTCGTCATCCACCTC
GTCAAGCGGAGGCGCCGCCCCCGGTCCCTCGAGTTCGACGCCGAGCATGGCGCCGCCGCCGCCGCCGCCCGCCAC
GACCTAGCTGGCCTGGACGACCGCCGCCGCCTTTCATCGACCGACTCCTTCAAGCACGACGGCGACCTGTCCCGG
GGCGACAGTCGCGCCGCACCCGTCGCCAGGCAATGGGGCTGGCCGTCTCGCTCCCAAGCTCCCCCGCGCCCCAGG
GCGGGCCACTCTCCGCCGCGACAGCTGTCGTCGTCGCTCCCGGACACCATCGCCTCGGACCGCCCGCTTGCGCCC
GCCCCCTTCTACGAGGGAGAGTACATGCCCGTGTCCGAGGTGCGCGATGACCACCCGGGCGTTCTCCAGGGCACG
AGCGCCGACTACTACAGCCCGTCGATACCGTCCGAGGCCTTCGGCATGGTCACCTCCCCCGACGAAGTCGCCGCC
GCCGGCGTCACCGCCAGCCGCGGAAGCTCCTTCAGATACAACGTGAGGCACATGTTCCGGCGCAAGAGTGGCCGC
GATGCCGCCGTCGAGCCGTGCCCGCCCGCAGCCAGCTCCGGCGACGGGCAACCCGTCCCATCCGCCGCTCCGCAA
GCATTACAAGGCGTGGCCTTGCAGCAAATCACGCCGACGGGGGACCCGGCCGCCGAGCCCTCCGCGCTGTCGCAC
CAGACGAGCCCGCCGCCGGCCGTCGCTTCAGCTGCGCAAACGTCGGCTTCACCATCTCCTCCTCCACCCAGGCCG
CCACCGCAACTTCCCGTCGAACAGCCCGTCAAGGTGTCGTCTCCCTCGCCGCCCGCCCACCCCGCGCCAGGAACG
GTGAATCCGATGGATATCATGCCGGCAAGCACCGAGTCCGAGCTCTGGTACCGAAACGAGCACGAGCTTCTCTCC
GCCTACCGCCATCCAGCCGCCGTGTCACCGGTGCCGGATCATGAAAAGCGCATGAGCAATCCCGACACGGAACGC
GCCCCCTCGGTGGCCCCTCCGACGCCGTCCACGACGGTACCGCACCAGGCCGCCGCCGCCGCCACCGAATCCGCC
ACCCCAACCCAAGCCAAGGGCCAGGACGGGCCACAAGGAGATGATGTACTCATGACGGACGCCCAGCAGCCGCAC
CCTGACCCAAGCCCGCCCGCCGTGCCCGAGCCCGGGCGATACCCCAGCCATACATCCGACCTCTCCACCCTCTTC
CAAGGCCCGGGATCGACCGATCTCTCCTCCCACAACACACCCTCAACACAGCTAGACAGCCCTACGCCGGAGTCT
CTCAACAGCTCCGACTTTCGGCACAGCGTGTCGCCGCAGTCCGGCAACTCGACCCTTAAGATGGGCATCTTCCGC
TGCGATGTGCCCGGCTGCCAACAAGTGTTTGACCAGCCACACAAACTCAAGCATCACCAGCGCTATCACAGCAAG
GACCACAAATGTCCGTACGCGAATTGCGAGAAAGGTTTCGGGACCAAGACGCACCTGCACCGCCACATCAACGAC
AGGCATGAGAAGAAGAAGAAATTCCACTGCTCCGTCCCGGGCTGCGACTATTCCCGGGCCGGCGGCAAGGGCTTT
CCCCGCAAAGACAACTGGAAGAGGCACATGATTAAGACTCATCACATGGACCATGCACATCTCCCAGAGCCCATC
GAAGTAGATCCGGACACGGCCGCGACATGA
Gene >Hirsu2|7005
ATGGCGGCCGAGGCCGTGCCCCGCCTCGTCGCGTGGGGGTCCGTCGTGAGGCGAGACTTGGATGATGGGGCCATT
GCCGGCACCGTCGTCGGCGTCGTCATCGGCGCCGCCCTCATCGCCCTATGCCTCTATCCCGTCGTCATCCACCTC
GTCAAGCGGAGGCGCCGCCCCCGGTCCCTCGAGTTCGACGCCGAGCATGGCGCCGCCGCCGCCGCCGCCCGCCAC
GACCTAGCTGGCCTGGACGACCGCCGCCGCCTTTCATCGACCGACTCCTTCAAGCACGACGGCGACCTGTCCCGG
GGCGACAGTCGCGCCGCACCCGTCGCCAGGCAATGGGGCTGGCCGTCTCGCTCCCAAGCTCCCCCGCGCCCCAGG
GCGGGCCACTCTCCGCCGCGACAGCTGTCGTCGTCGCTCCCGGACACCATCGCCTCGGACCGCCCGCTTGCGCCC
GCCCCCTTCTACGAGGGAGAGTACATGCCCGTGTCCGAGGTGCGCGATGACCACCCGGGCGTTCTCCAGGGCACG
AGCGCCGACTACTACAGCCCGTCGATACCGTCCGAGGCCTTCGGCATGGTCACCTCCCCCGACGAAGTCGCCGCC
GCCGGCGTCACCGCCAGCCGCGGAAGCTCCTTCAGATACAACGTGAGGCACATGTTCCGGCGCAAGAGTGGCCGC
GATGCCGCCGTCGAGCCGTGCCCGCCCGCAGCCAGCTCCGGCGACGGGCAACCCGTCCCATCCGCCGCTCCGCAA
GCATTACAAGGCGTGGCCTTGCAGCAAATCACGCCGACGGGGGACCCGGCCGCCGAGCCCTCCGCGCTGTCGCAC
CAGACGAGCCCGCCGCCGGCCGTCGCTTCAGCTGCGCAAACGTCGGCTTCACCATCTCCTCCTCCACCCAGGCCG
CCACCGCAACTTCCCGTCGAACAGCCCGTCAAGGTGTCGTCTCCCTCGCCGCCCGCCCACCCCGCGCCAGGAACG
GTGAATCCGATGGATATCATGCCGGCAAGCACCGAGTCCGAGCTCTGGTACCGAAACGAGCACGAGCTTCTCTCC
GCCTACCGCCATCCAGCCGCCGTGTCACCGGTGCCGGATCATGAAAAGCGCATGAGCAATCCCGACACGGAACGC
GCCCCCTCGGTGGCCCCTCCGACGCCGTCCACGACGGTACCGCACCAGGCCGCCGCCGCCGCCACCGAATCCGCC
ACCCCAACCCAAGCCAAGGGCCAGGACGGGCCACAAGGAGATGATGTACTCATGACGGACGCCCAGCAGCCGCAC
CCTGACCCAAGCCCGCCCGCCGTGCCCGAGCCCGGGCGATACCCCAGCCATACATCCGACCTCTCCACCCTCTTC
CAAGGCCCGGGATCGACCGATCTCTCCTCCCACAACACACCCTCAACACAGCTAGACAGCCCTACGCCGGAGTCT
CTCAACAGCTCCGACTTTCGGCACAGCGTGTCGCCGCAGTCCGGCAACTCGACCCTTAAGATGGGCATCTTCCGC
TGCGATGTGCCCGGCTGCCAACAAGTGTTTGACCAGCCACACAAACTCAAGTAAGCTTCCCACCTCGGCCGTCCG
CTGAGAATGGCAAAAATGGCAAAAAATGGGGAAAAAAAAAGGAATAGAAAAGCTCACAAGTCTCGGCAGGCATCA
CCAGCGCTATCACAGCAAGGACCACAAATGTCCGTACGCGAATTGCGAGAAAGGTTTCGGGACCAAGACGCACCT
GCACCGCCACATCAACGACAGGCATGAGAAGAAGAAGAAATTCCACTGCTCCGTCCCGGGCTGCGACTATTCCCG
GGCCGGCGGCAAGGGCTTTCCCCGCAAAGACAACTGGAAGAGGCACATGATTAAGACTCATCACATGGACCATGC
ACATCTCCCAGAGCCCATCGAAGTAGATCCGGACACGGCCGCGACATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail