Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7001
Gene name
LocationContig_385:19093..21217
Strand-
Gene length (bp)2124
Transcript length (bp)2124
Coding sequence length (bp)2124
Protein length (aa) 708

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 5.5E-60 63 309
PF00106 adh_short short chain dehydrogenase 4.8E-48 462 654
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 4.0E-37 468 685
PF08659 KR KR domain 1.3E-13 465 644
PF01370 Epimerase NAD dependent epimerase/dehydratase family 4.9E-09 61 274

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 61 434 9.0E-59
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 39 373 1.0E-48
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 459 702 1.0E-45
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 459 702 1.0E-45
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 459 702 5.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 61 434 9.0E-59
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 39 373 1.0E-48
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 459 702 1.0E-45
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 459 702 1.0E-45
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 459 702 5.0E-45
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 459 702 8.0E-45
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 459 702 8.0E-45
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 459 702 1.0E-44
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 459 702 1.0E-44
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 459 702 1.0E-44
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 459 706 2.0E-43
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 459 706 4.0E-43
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 459 702 6.0E-43
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 459 702 4.0E-42
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 462 707 3.0E-41
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 4 357 6.0E-38
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 457 702 2.0E-37
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 457 702 2.0E-37
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 61 357 1.0E-36
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 61 437 7.0E-33
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 61 357 2.0E-32
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 61 357 3.0E-32
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 61 359 5.0E-32
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 458 691 4.0E-30
sp|P69936|YDFG_SALTY NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ydfG PE=3 SV=1 463 702 3.0E-28
sp|P69935|YDFG_SALTI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhi GN=ydfG PE=3 SV=1 463 702 3.0E-28
sp|D2WKD9|SDR1_AEDAE Farnesol dehydrogenase OS=Aedes aegypti GN=SDR-1 PE=1 SV=2 458 702 2.0E-27
sp|P9WGR5|Y484_MYCTU Uncharacterized oxidoreductase Rv0484c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0484c PE=1 SV=1 462 705 3.0E-26
sp|P9WGR4|Y484_MYCTO Uncharacterized oxidoreductase MT0502 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0502 PE=3 SV=1 462 705 3.0E-26
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 58 358 3.0E-24
sp|Q8FHD2|YDFG_ECOL6 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydfG PE=3 SV=2 463 702 3.0E-24
sp|P39831|YDFG_ECOLI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2 463 702 3.0E-24
sp|Q8X505|YDFG_ECO57 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O157:H7 GN=ydfG PE=3 SV=1 463 702 4.0E-24
sp|Q83RE8|YDFG_SHIFL NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Shigella flexneri GN=ydfG PE=3 SV=2 463 702 1.0E-23
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 458 705 3.0E-23
sp|Q9KWN1|SDH_RHIRD Serine 3-dehydrogenase OS=Rhizobium radiobacter GN=sdh PE=1 SV=1 465 707 3.0E-23
sp|Q8U8I2|SDH_AGRFC Serine 3-dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=sdh PE=3 SV=1 465 707 6.0E-23
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 458 702 2.0E-22
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 11 358 3.0E-22
sp|P9WGS7|Y0687_MYCTU Uncharacterized NAD-dependent oxidoreductase Rv0687 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0687 PE=1 SV=1 454 653 4.0E-22
sp|P9WGS6|Y0687_MYCTO Uncharacterized NAD-dependent oxidoreductase MT0715 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0715 PE=3 SV=1 454 653 4.0E-22
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 459 652 1.0E-21
sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 448 652 3.0E-21
sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 448 652 3.0E-21
sp|P45200|Y1430_HAEIN Probable NADP-dependent dehydrogenase HI_1430 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1430 PE=3 SV=1 464 702 4.0E-21
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 450 705 5.0E-21
sp|Q73SC8|Y4146_MYCPA Uncharacterized NAD-dependent oxidoreductase MAP_4146 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4146 PE=1 SV=1 455 653 6.0E-21
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 458 650 1.0E-20
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 459 653 1.0E-20
sp|Q6UWP2|DHR11_HUMAN Dehydrogenase/reductase SDR family member 11 OS=Homo sapiens GN=DHRS11 PE=1 SV=1 452 705 2.0E-20
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 459 683 3.0E-20
sp|P43713|FABG_HAEIN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabG PE=3 SV=1 459 685 3.0E-20
sp|Q3ZBV9|DHR11_BOVIN Dehydrogenase/reductase SDR family member 11 OS=Bos taurus GN=DHRS11 PE=2 SV=1 458 705 4.0E-20
sp|Q9STY7|HSD3_ARATH 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 458 666 5.0E-20
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 456 705 6.0E-20
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 458 691 6.0E-20
sp|Q3U0B3|DHR11_MOUSE Dehydrogenase/reductase SDR family member 11 OS=Mus musculus GN=Dhrs11 PE=1 SV=1 453 705 9.0E-20
sp|Q13268|DHRS2_HUMAN Dehydrogenase/reductase SDR family member 2, mitochondrial OS=Homo sapiens GN=DHRS2 PE=1 SV=4 431 696 1.0E-19
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 452 691 1.0E-19
sp|P00335|RIDH_ENTAE Ribitol 2-dehydrogenase OS=Enterobacter aerogenes GN=rbtD PE=1 SV=1 459 703 1.0E-19
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 448 668 1.0E-19
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 448 668 1.0E-19
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 459 685 2.0E-19
sp|Q8KES3|SPRE_CHLTE Sepiapterin reductase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0609 PE=1 SV=1 463 702 2.0E-19
sp|O86034|BDHA_RHIME D-beta-hydroxybutyrate dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=bdhA PE=1 SV=1 462 653 5.0E-19
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 448 650 7.0E-19
sp|D3U1D9|ISFD_KLEOX Sulfoacetaldehyde reductase OS=Klebsiella oxytoca GN=isfD PE=1 SV=1 462 702 9.0E-19
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 457 650 1.0E-18
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 462 685 3.0E-18
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 462 685 3.0E-18
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 463 687 3.0E-18
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 52 358 3.0E-18
sp|Q8WNV7|DHRS4_PIG Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=2 459 665 3.0E-18
sp|Q06136|KDSR_HUMAN 3-ketodihydrosphingosine reductase OS=Homo sapiens GN=KDSR PE=1 SV=1 459 650 3.0E-18
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 458 691 4.0E-18
sp|Q6GV12|KDSR_MOUSE 3-ketodihydrosphingosine reductase OS=Mus musculus GN=Kdsr PE=1 SV=1 459 650 7.0E-18
sp|Q6AYS8|DHB11_RAT Estradiol 17-beta-dehydrogenase 11 OS=Rattus norvegicus GN=Hsd17b11 PE=2 SV=1 455 653 8.0E-18
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 461 696 9.0E-18
sp|Q2KIJ5|KDSR_BOVIN 3-ketodihydrosphingosine reductase OS=Bos taurus GN=KDSR PE=2 SV=1 459 650 9.0E-18
sp|P0CG22|DR4L1_HUMAN Putative dehydrogenase/reductase SDR family member 4-like 1 OS=Homo sapiens GN=DHRS4L1 PE=5 SV=1 448 668 1.0E-17
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 458 652 1.0E-17
sp|Q49117|Y182_METEA Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 458 650 2.0E-17
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 456 652 2.0E-17
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 457 668 2.0E-17
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 457 668 2.0E-17
sp|Q4JK73|DHB11_MACFA Estradiol 17-beta-dehydrogenase 11 OS=Macaca fascicularis GN=HSD17B11 PE=2 SV=1 455 653 2.0E-17
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 459 668 2.0E-17
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 448 650 3.0E-17
sp|Q48436|BUDC_KLEPN Diacetyl reductase [(S)-acetoin forming] OS=Klebsiella pneumoniae GN=budC PE=1 SV=2 462 670 3.0E-17
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 462 691 3.0E-17
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 462 646 4.0E-17
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 462 646 4.0E-17
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 462 646 4.0E-17
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 462 646 4.0E-17
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 462 646 4.0E-17
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 462 646 4.0E-17
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 456 652 4.0E-17
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 457 653 4.0E-17
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 456 652 5.0E-17
sp|Q9EQ06|DHB11_MOUSE Estradiol 17-beta-dehydrogenase 11 OS=Mus musculus GN=Hsd17b11 PE=1 SV=1 455 653 5.0E-17
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 456 652 5.0E-17
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 445 666 7.0E-17
sp|P14802|YOXD_BACSU Uncharacterized oxidoreductase YoxD OS=Bacillus subtilis (strain 168) GN=yoxD PE=3 SV=2 481 648 7.0E-17
sp|P9WGR7|Y945_MYCTU Uncharacterized oxidoreductase Rv0945 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0945 PE=1 SV=1 465 676 8.0E-17
sp|P9WGR6|Y945_MYCTO Uncharacterized oxidoreductase MT0971 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0971 PE=3 SV=1 465 676 8.0E-17
sp|P9WGS5|Y2750_MYCTU Uncharacterized oxidoreductase Rv2750 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2750 PE=1 SV=1 459 683 8.0E-17
sp|P9WGS4|Y2750_MYCTO Uncharacterized oxidoreductase MT2820 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2820 PE=3 SV=1 459 683 8.0E-17
sp|A0R518|Y6031_MYCS2 Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6031 PE=1 SV=1 457 653 9.0E-17
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 61 293 1.0E-16
sp|P94681|TSAC_COMTE 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 OS=Comamonas testosteroni GN=tsaC1 PE=1 SV=1 458 645 1.0E-16
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 459 652 1.0E-16
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 459 652 1.0E-16
sp|Q5FPE5|GMDH_GLUOX Glucose 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=GOX2015 PE=1 SV=1 458 650 1.0E-16
sp|Q9LUE4|HSD6_ARATH 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 459 652 2.0E-16
sp|Q7TQA3|RDHE2_MOUSE Epidermal retinol dehydrogenase 2 OS=Mus musculus GN=Sdr16c5 PE=2 SV=1 445 691 2.0E-16
sp|Q45219|Y2146_BRADU Probable short-chain type dehydrogenase/reductase blr2146 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr2146 PE=3 SV=2 457 687 2.0E-16
sp|Q5NVG2|DHB11_PONAB Estradiol 17-beta-dehydrogenase 11 OS=Pongo abelii GN=HSD17B11 PE=2 SV=1 455 653 2.0E-16
sp|Q04520|BUDC_RAOTE Diacetyl reductase [(S)-acetoin forming] OS=Raoultella terrigena GN=budC PE=3 SV=1 462 650 3.0E-16
sp|Q56840|HCDR_XANP2 2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3 462 685 3.0E-16
sp|Q9ZW03|TRNH3_ARATH Tropinone reductase homolog At2g29150 OS=Arabidopsis thaliana GN=At2g29150 PE=1 SV=1 459 685 3.0E-16
sp|Q8NBQ5|DHB11_HUMAN Estradiol 17-beta-dehydrogenase 11 OS=Homo sapiens GN=HSD17B11 PE=1 SV=3 455 653 3.0E-16
sp|Q1R183|ISFD_CHRSD Sulfoacetaldehyde reductase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD PE=1 SV=1 466 705 4.0E-16
sp|P50198|LINX_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 458 650 5.0E-16
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 459 677 6.0E-16
sp|P12310|DHG_BACSU Glucose 1-dehydrogenase OS=Bacillus subtilis (strain 168) GN=gdh PE=2 SV=2 459 694 6.0E-16
sp|Q9ZW19|TRNHC_ARATH Tropinone reductase homolog At2g29360 OS=Arabidopsis thaliana GN=SDR PE=1 SV=1 459 688 6.0E-16
sp|Q9X6U2|BDHA_CUPNH D-beta-hydroxybutyrate dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hbdH1 PE=3 SV=2 459 664 6.0E-16
sp|P9WGP9|SADH_MYCTU Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sadH PE=2 SV=1 459 667 7.0E-16
sp|P9WGP8|SADH_MYCTO Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sadH PE=3 SV=1 459 667 7.0E-16
sp|P9WGQ9|Y769_MYCTU Uncharacterized oxidoreductase Rv0769 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0769 PE=1 SV=1 462 664 8.0E-16
sp|P9WGQ8|Y769_MYCTO Uncharacterized oxidoreductase MT0793 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0793 PE=3 SV=1 462 664 8.0E-16
sp|P80869|DHG2_BACSU Glucose 1-dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=ycdF PE=1 SV=2 459 650 8.0E-16
sp|O88451|RDH7_MOUSE Retinol dehydrogenase 7 OS=Mus musculus GN=Rdh7 PE=1 SV=1 453 678 9.0E-16
sp|P9WGT1|HSD_MYCTU 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG3 PE=1 SV=1 456 650 1.0E-15
sp|P69166|HSD_MYCBO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG3 PE=3 SV=1 456 650 1.0E-15
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 458 675 1.0E-15
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 463 690 1.0E-15
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 463 690 1.0E-15
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 463 690 1.0E-15
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 453 663 1.0E-15
sp|Q5M875|DHB13_RAT 17-beta-hydroxysteroid dehydrogenase 13 OS=Rattus norvegicus GN=Hsd17b13 PE=1 SV=1 455 652 2.0E-15
sp|Q6PKH6|DR4L2_HUMAN Dehydrogenase/reductase SDR family member 4-like 2 OS=Homo sapiens GN=DHRS4L2 PE=2 SV=1 448 644 2.0E-15
sp|A5PJF6|HSDL1_BOVIN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Bos taurus GN=HSDL1 PE=2 SV=1 452 652 2.0E-15
sp|Q1QU27|ISFD2_CHRSD Sulfoacetaldehyde reductase 2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD2 PE=1 SV=1 463 705 2.0E-15
sp|Q28IU1|DHB12_XENTR Very-long-chain 3-oxoacyl-CoA reductase OS=Xenopus tropicalis GN=hsd17b12 PE=2 SV=1 454 652 2.0E-15
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 461 685 2.0E-15
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 461 685 2.0E-15
sp|P39483|DHG2_BACME Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 459 650 3.0E-15
sp|Q9SY73|PTALR_ARATH NADPH-dependent pterin aldehyde reductase OS=Arabidopsis thaliana GN=At1g10310 PE=1 SV=1 459 653 3.0E-15
sp|P9WGT0|HSD_MYCTO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG3 PE=3 SV=1 456 650 3.0E-15
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 459 652 3.0E-15
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 60 312 3.0E-15
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 462 650 3.0E-15
sp|Q8XBJ4|UCPA_ECO57 Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 456 668 4.0E-15
sp|P37440|UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 456 668 4.0E-15
sp|Q8T197|DHRS7_DICDI Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 434 650 4.0E-15
sp|O57314|DHB12_ANAPL Very-long-chain 3-oxoacyl-CoA reductase OS=Anas platyrhynchos GN=HSD17B12 PE=2 SV=1 451 656 5.0E-15
sp|P39484|DHG3_BACME Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 459 694 5.0E-15
sp|P55434|Y4EK_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4eK OS=Rhizobium sp. (strain NGR234) GN=NGR_a03840 PE=3 SV=1 462 694 5.0E-15
sp|Q5R7K0|HSDL1_PONAB Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Pongo abelii GN=HSDL1 PE=2 SV=1 452 652 5.0E-15
sp|Q9RA05|LIMC_RHOER (-)-trans-carveol dehydrogenase OS=Rhodococcus erythropolis GN=limC PE=1 SV=1 458 653 5.0E-15
sp|P50164|TRN2_HYONI Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1 458 668 6.0E-15
sp|Q8AVY8|DH12B_XENLA Very-long-chain 3-oxoacyl-CoA reductase-B OS=Xenopus laevis GN=hsd17b12-b PE=2 SV=1 454 652 6.0E-15
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 459 694 6.0E-15
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 459 694 6.0E-15
sp|P39485|DHG4_BACME Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 459 694 6.0E-15
sp|Q9BY49|PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2 457 646 7.0E-15
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 463 690 7.0E-15
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 459 699 7.0E-15
sp|Q56318|Y019_THEMA Uncharacterized oxidoreductase TM_0019 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0019 PE=3 SV=2 459 650 8.0E-15
sp|O34782|YVRD_BACSU Uncharacterized oxidoreductase YvrD OS=Bacillus subtilis (strain 168) GN=yvrD PE=3 SV=1 458 646 9.0E-15
sp|P10528|DHGA_BACME Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 459 694 9.0E-15
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 461 685 1.0E-14
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 461 685 1.0E-14
sp|Q3KPT7|BDH2_XENLA 3-hydroxybutyrate dehydrogenase type 2 OS=Xenopus laevis GN=bdh2 PE=2 SV=1 457 650 1.0E-14
sp|O54438|FABG_PSEAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabG PE=1 SV=1 459 650 1.0E-14
sp|O14756|H17B6_HUMAN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Homo sapiens GN=HSD17B6 PE=1 SV=1 453 664 1.0E-14
sp|P45375|PHBB_ALLVD Acetoacetyl-CoA reductase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=phbB PE=3 SV=2 462 685 1.0E-14
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 455 653 1.0E-14
sp|P66782|Y1385_MYCBO Uncharacterized oxidoreductase Mb1385 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG2 PE=3 SV=1 459 652 1.0E-14
sp|P9WGR9|Y1350_MYCTU Uncharacterized oxidoreductase Rv1350 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG2 PE=1 SV=1 459 652 1.0E-14
sp|P9WGR8|Y1350_MYCTO Uncharacterized oxidoreductase MT1393 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG2 PE=3 SV=1 459 652 1.0E-14
sp|Q5RCH8|PECR_PONAB Peroxisomal trans-2-enoyl-CoA reductase OS=Pongo abelii GN=PECR PE=2 SV=1 457 690 1.0E-14
sp|P50161|AFLM_ASPPA Versicolorin reductase 1 OS=Aspergillus parasiticus GN=ver1 PE=3 SV=2 458 653 2.0E-14
sp|A7DY56|TRN1_COCOF Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 459 688 2.0E-14
sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 459 694 2.0E-14
sp|P55541|Y4LA_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4lA OS=Rhizobium sp. (strain NGR234) GN=NGR_a02730 PE=3 SV=1 458 650 2.0E-14
sp|Q7M3I4|DHI1_RABIT Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Oryctolagus cuniculus GN=HSD11B1 PE=1 SV=2 459 641 2.0E-14
sp|P50163|TRN2_DATST Tropinone reductase 2 OS=Datura stramonium GN=TR2 PE=1 SV=1 458 668 3.0E-14
sp|Q7T2D1|RD10B_DANRE Retinol dehydrogenase 10-B OS=Danio rerio GN=rdh10b PE=2 SV=2 453 653 3.0E-14
sp|Q0WRJ2|TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana GN=TSC10A PE=1 SV=1 464 650 3.0E-14
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 61 294 3.0E-14
sp|F4JZN6|TC10B_ARATH 3-dehydrosphinganine reductase TSC10B OS=Arabidopsis thaliana GN=TSC10B PE=1 SV=1 466 650 4.0E-14
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 462 690 4.0E-14
sp|Q3SXM5|HSDL1_HUMAN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Homo sapiens GN=HSDL1 PE=1 SV=3 452 652 4.0E-14
sp|Q5C9I9|ISPD_MENPI (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial OS=Mentha piperita PE=1 SV=1 458 685 4.0E-14
sp|Q5XG41|DH12A_XENLA Very-long-chain 3-oxoacyl-CoA reductase-A OS=Xenopus laevis GN=hsd17b12-a PE=2 SV=1 454 652 4.0E-14
sp|Q9LBG2|LVR_LEIAQ Levodione reductase OS=Leifsonia aquatica GN=lvr PE=1 SV=1 458 648 4.0E-14
sp|P66780|Y1570_MYCBO Uncharacterized oxidoreductase Mb1570 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1570 PE=3 SV=1 454 657 5.0E-14
sp|P9WGS1|Y1543_MYCTU Uncharacterized oxidoreductase Rv1543 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1543 PE=1 SV=1 454 657 5.0E-14
sp|P9WGS0|Y1543_MYCTO Uncharacterized oxidoreductase MT1595 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1595 PE=3 SV=1 454 657 5.0E-14
sp|P41177|DHKR_STRCM Monensin polyketide synthase putative ketoacyl reductase OS=Streptomyces cinnamonensis PE=3 SV=1 462 650 5.0E-14
sp|Q3T001|H17B6_BOVIN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Bos taurus GN=HSD17B6 PE=2 SV=1 458 673 5.0E-14
sp|P72332|NODG_RHIS3 Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 459 652 6.0E-14
sp|C1C4R8|BDH2_LITCT 3-hydroxybutyrate dehydrogenase type 2 OS=Lithobates catesbeiana GN=bdh2 PE=2 SV=1 457 650 6.0E-14
sp|Q8N3Y7|RDHE2_HUMAN Epidermal retinol dehydrogenase 2 OS=Homo sapiens GN=SDR16C5 PE=2 SV=2 458 676 6.0E-14
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 463 668 6.0E-14
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 458 686 6.0E-14
sp|G5EGA6|DHRS4_CAEEL Dehydrogenase/reductase SDR family member 4 OS=Caenorhabditis elegans GN=dhrs-4 PE=1 SV=1 448 680 6.0E-14
sp|P87219|SOU1_CANAL Sorbose reductase SOU1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU1 PE=1 SV=1 435 669 8.0E-14
sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2 459 668 8.0E-14
sp|Q8CQD2|BUTA_STAES Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=butA PE=3 SV=1 462 646 8.0E-14
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 462 656 8.0E-14
sp|Q8K9J5|FABG_BUCAP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabG PE=3 SV=1 458 685 8.0E-14
sp|Q4R5G7|DHB12_MACFA Very-long-chain 3-oxoacyl-CoA reductase OS=Macaca fascicularis GN=HSD17B12 PE=2 SV=1 461 652 8.0E-14
sp|P87218|SOU2_CANAL Sorbose reductase homolog SOU2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU2 PE=3 SV=2 435 652 9.0E-14
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 463 690 1.0E-13
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 61 293 1.0E-13
sp|Q89AG9|FABG_BUCBP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabG PE=3 SV=1 462 665 1.0E-13
sp|Q9L9F8|NOVJ_STRNV Short-chain reductase protein NovJ OS=Streptomyces niveus GN=novJ PE=1 SV=1 462 650 1.0E-13
sp|B2B3L4|MKAR_PODAN Very-long-chain 3-oxoacyl-CoA reductase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_6_6580 PE=3 SV=2 440 652 1.0E-13
sp|Q8VCR2|DHB13_MOUSE 17-beta-hydroxysteroid dehydrogenase 13 OS=Mus musculus GN=Hsd17b13 PE=1 SV=2 455 652 1.0E-13
sp|Q8JZV9|BDH2_MOUSE 3-hydroxybutyrate dehydrogenase type 2 OS=Mus musculus GN=Bdh2 PE=1 SV=1 457 665 2.0E-13
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 459 652 2.0E-13
sp|P73826|FABG2_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG2 PE=1 SV=1 459 690 2.0E-13
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 463 690 2.0E-13
sp|P15047|ENTA_ECOLI 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Escherichia coli (strain K12) GN=entA PE=1 SV=1 459 701 2.0E-13
sp|Q4V8B7|HSDL1_RAT Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Rattus norvegicus GN=Hsdl1 PE=2 SV=1 428 652 2.0E-13
sp|Q561X9|BDH2_DANRE 3-hydroxybutyrate dehydrogenase type 2 OS=Danio rerio GN=bdh2 PE=2 SV=1 457 650 2.0E-13
sp|Q5HKG6|BUTA_STAEQ Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=butA PE=3 SV=1 462 646 2.0E-13
sp|Q53GQ0|DHB12_HUMAN Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens GN=HSD17B12 PE=1 SV=2 461 652 2.0E-13
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 462 653 2.0E-13
sp|Q8NEX9|DR9C7_HUMAN Short-chain dehydrogenase/reductase family 9C member 7 OS=Homo sapiens GN=SDR9C7 PE=1 SV=1 457 667 2.0E-13
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 457 650 2.0E-13
sp|A1L1W4|RD10A_DANRE Retinol dehydrogenase 10-A OS=Danio rerio GN=rdh10a PE=2 SV=1 453 653 3.0E-13
sp|Q9ZW12|TRNH5_ARATH Tropinone reductase homolog At2g29260, chloroplastic OS=Arabidopsis thaliana GN=At2g29260 PE=2 SV=1 459 699 3.0E-13
sp|Q05A13|S16C6_MOUSE Short-chain dehydrogenase/reductase family 16C member 6 OS=Mus musculus GN=Sdr16c6 PE=2 SV=1 459 653 3.0E-13
sp|Q8L9C4|KCR1_ARATH Very-long-chain 3-oxoacyl-CoA reductase 1 OS=Arabidopsis thaliana GN=KCR1 PE=1 SV=1 454 652 4.0E-13
sp|Q5P5I4|PED_AROAE (S)-1-Phenylethanol dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=ped PE=1 SV=1 458 662 4.0E-13
sp|A4IGM4|DHI1L_XENTR Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Xenopus tropicalis GN=hsd11b1l PE=2 SV=1 459 684 4.0E-13
sp|Q9ZW20|TRNHD_ARATH Tropinone reductase homolog At2g29370 OS=Arabidopsis thaliana GN=At2g29370 PE=3 SV=1 459 688 4.0E-13
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 462 690 4.0E-13
sp|O16881|DHS16_CAEEL 3 beta-hydroxysteroid dehydrogenase dhs-16 OS=Caenorhabditis elegans GN=dhs-16 PE=2 SV=1 460 663 4.0E-13
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 462 690 4.0E-13
sp|B0D8R3|MKAR_LACBS Very-long-chain 3-oxoacyl-CoA reductase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_192627 PE=3 SV=1 447 629 4.0E-13
sp|Q9ZW13|TRNH6_ARATH Tropinone reductase homolog At2g29290 OS=Arabidopsis thaliana GN=At2g29290 PE=2 SV=1 455 688 5.0E-13
sp|Q82IY9|PTLF_STRAW 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlF PE=1 SV=1 458 687 5.0E-13
sp|P29147|BDH_RAT D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Bdh1 PE=1 SV=2 460 648 5.0E-13
sp|Q6CEE9|SDR_YARLI Probable NADP-dependent mannitol dehydrogenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0B16192g PE=1 SV=1 429 652 6.0E-13
sp|Q8BTX9|HSDL1_MOUSE Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Mus musculus GN=Hsdl1 PE=1 SV=1 428 651 6.0E-13
sp|P50170|RDH2_RAT Retinol dehydrogenase 2 OS=Rattus norvegicus GN=Rdh2 PE=1 SV=1 453 683 6.0E-13
sp|Q9ZW04|TRNH4_ARATH Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1 459 685 6.0E-13
sp|Q5E9H7|DHB12_BOVIN Very-long-chain 3-oxoacyl-CoA reductase OS=Bos taurus GN=HSD17B12 PE=2 SV=1 457 652 6.0E-13
sp|P39071|DHBA_BACSU 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Bacillus subtilis (strain 168) GN=dhbA PE=1 SV=3 459 701 6.0E-13
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 39 290 7.0E-13
sp|P50197|LINC_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linC PE=2 SV=1 459 665 7.0E-13
sp|Q8KWT4|BACC_BACIU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis GN=bacC PE=1 SV=1 458 652 7.0E-13
sp|Q6QLL4|DHI1_CAVPO Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Cavia porcellus GN=HSD11B1 PE=1 SV=3 459 663 7.0E-13
sp|Q988B7|PLDH_RHILO Pyridoxal 4-dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=pldh-t PE=1 SV=1 458 668 7.0E-13
sp|E3VWK2|PENF_STREX 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces exfoliatus GN=penF PE=3 SV=1 458 653 8.0E-13
sp|B2WMJ3|MKAR_PYRTR Very-long-chain 3-oxoacyl-CoA reductase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_11203 PE=3 SV=2 461 652 8.0E-13
sp|Q80XN0|BDH_MOUSE D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Bdh1 PE=1 SV=2 460 648 8.0E-13
sp|P14697|PHBB_CUPNH Acetoacetyl-CoA reductase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbB PE=1 SV=1 459 653 8.0E-13
sp|A6SG70|MKAR_BOTFB Very-long-chain 3-oxoacyl-CoA reductase OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_11561 PE=3 SV=1 461 652 9.0E-13
sp|P71079|FABL_BACSU Enoyl-[acyl-carrier-protein] reductase [NADPH] FabL OS=Bacillus subtilis (strain 168) GN=fabL PE=1 SV=1 461 685 1.0E-12
sp|O70503|DHB12_MOUSE Very-long-chain 3-oxoacyl-CoA reductase OS=Mus musculus GN=Hsd17b12 PE=1 SV=1 461 652 1.0E-12
sp|O80713|SDR3A_ARATH Short-chain dehydrogenase reductase 3a OS=Arabidopsis thaliana GN=SDR3a PE=2 SV=1 458 685 1.0E-12
sp|Q6DCT3|RD10A_XENLA Retinol dehydrogenase 10-A OS=Xenopus laevis GN=rdh10-a PE=2 SV=1 453 653 1.0E-12
sp|D4A1J4|BDH2_RAT 3-hydroxybutyrate dehydrogenase type 2 OS=Rattus norvegicus GN=Bdh2 PE=3 SV=2 457 665 1.0E-12
sp|Q6P7R8|DHB12_RAT Very-long-chain 3-oxoacyl-CoA reductase OS=Rattus norvegicus GN=Hsd17b12 PE=2 SV=1 461 652 1.0E-12
sp|Q9LUF2|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 458 651 2.0E-12
sp|P0DKC7|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 458 651 2.0E-12
sp|Q5ZJG8|HSDL1_CHICK Hydroxysteroid dehydrogenase-like protein 1 OS=Gallus gallus GN=HSDL1 PE=2 SV=1 461 656 2.0E-12
sp|Q7Z5P4|DHB13_HUMAN 17-beta-hydroxysteroid dehydrogenase 13 OS=Homo sapiens GN=HSD17B13 PE=1 SV=1 455 652 2.0E-12
sp|P50169|RDH3_RAT Retinol dehydrogenase 3 OS=Rattus norvegicus GN=Rdh3 PE=1 SV=1 459 673 2.0E-12
sp|P06234|NODG_RHIME Nodulation protein G OS=Rhizobium meliloti (strain 1021) GN=nodG PE=3 SV=1 458 652 2.0E-12
sp|O07575|YHDF_BACSU Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 457 683 2.0E-12
sp|A7F8T1|MKAR_SCLS1 Very-long-chain 3-oxoacyl-CoA reductase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_14012 PE=3 SV=1 461 652 2.0E-12
sp|Q5XGF7|RDH10_XENTR Retinol dehydrogenase 10 OS=Xenopus tropicalis GN=rdh10 PE=2 SV=1 453 653 2.0E-12
sp|Q7RYE5|MKAR_NEUCR Very-long-chain 3-oxoacyl-CoA reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU11297 PE=3 SV=1 447 652 3.0E-12
sp|P0AFP4|YBBO_ECOLI Uncharacterized oxidoreductase YbbO OS=Escherichia coli (strain K12) GN=ybbO PE=3 SV=1 457 650 3.0E-12
sp|P0AFP5|YBBO_ECOL6 Uncharacterized oxidoreductase YbbO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybbO PE=3 SV=1 457 650 3.0E-12
sp|Q0U3N7|MKAR_PHANO Very-long-chain 3-oxoacyl-CoA reductase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_13627 PE=3 SV=1 461 652 3.0E-12
sp|P23102|XYLL_PSEPU 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Pseudomonas putida GN=xylL PE=3 SV=1 458 683 3.0E-12
sp|Q937L4|CPNA_COMTE Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 457 650 3.0E-12
sp|Q8GAV9|CPNA_COMS9 Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 457 650 3.0E-12
sp|Q9R092|H17B6_MOUSE 17-beta-hydroxysteroid dehydrogenase type 6 OS=Mus musculus GN=Hsd17b6 PE=1 SV=1 457 667 3.0E-12
sp|Q9WVK3|PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 457 667 4.0E-12
sp|P23238|PHBB_ZOORA Acetoacetyl-CoA reductase OS=Zoogloea ramigera GN=phbB PE=3 SV=1 462 653 4.0E-12
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 458 685 4.0E-12
sp|F4J2Z7|SDR4_ARATH Short-chain dehydrogenase reductase 4 OS=Arabidopsis thaliana GN=SDR4 PE=2 SV=1 459 685 4.0E-12
sp|Q0CY11|MKAR_ASPTN Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_01423 PE=3 SV=1 461 644 4.0E-12
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 459 663 5.0E-12
sp|P39640|BACC_BACSU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis (strain 168) GN=bacC PE=1 SV=2 458 652 5.0E-12
sp|Q9MA93|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 437 672 5.0E-12
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 61 307 6.0E-12
sp|P70684|PGDH_CAVPO 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Cavia porcellus GN=HPGD PE=2 SV=1 458 694 6.0E-12
sp|B8H1Z0|XDH_CAUCN D-xylose 1-dehydrogenase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=xylB PE=1 SV=1 459 694 7.0E-12
sp|Q46381|BPHB_COMTE Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Comamonas testosteroni GN=bphB PE=1 SV=1 458 657 8.0E-12
sp|Q3T0C2|PGDH_BOVIN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1 458 670 8.0E-12
sp|P50199|GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 459 650 8.0E-12
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 445 653 8.0E-12
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 445 653 8.0E-12
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 445 653 8.0E-12
sp|Q9ZW18|SAG13_ARATH Senescence-associated protein 13 OS=Arabidopsis thaliana GN=SAG13 PE=1 SV=1 459 688 8.0E-12
sp|Q1DNC5|MKAR_COCIM Very-long-chain 3-oxoacyl-CoA reductase OS=Coccidioides immitis (strain RS) GN=CIMG_08188 PE=3 SV=2 447 632 8.0E-12
sp|P05707|SRLD_ECOLI Sorbitol-6-phosphate 2-dehydrogenase OS=Escherichia coli (strain K12) GN=srlD PE=1 SV=2 462 648 9.0E-12
sp|Q3T046|BDH2_BOVIN 3-hydroxybutyrate dehydrogenase type 2 OS=Bos taurus GN=BDH2 PE=2 SV=1 457 650 1.0E-11
sp|P66776|BUTA_STAAW Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MW2) GN=butA PE=3 SV=1 462 653 1.0E-11
sp|Q6GCZ8|BUTA_STAAS Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MSSA476) GN=butA PE=3 SV=1 462 653 1.0E-11
sp|Q6GKH9|BUTA_STAAR Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MRSA252) GN=butA PE=3 SV=1 462 653 1.0E-11
sp|P99120|BUTA_STAAN Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain N315) GN=butA PE=1 SV=1 462 653 1.0E-11
sp|P66775|BUTA_STAAM Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=butA PE=3 SV=1 462 653 1.0E-11
sp|Q5HJP2|BUTA_STAAC Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain COL) GN=butA PE=3 SV=1 462 653 1.0E-11
sp|Q6NRV4|RD10B_XENLA Retinol dehydrogenase 10-B OS=Xenopus laevis GN=rdh10-b PE=2 SV=1 453 653 1.0E-11
sp|O74419|YQ52_SCHPO Uncharacterized protein C162.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.02c PE=2 SV=1 57 293 1.0E-11
sp|P28845|DHI1_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Homo sapiens GN=HSD11B1 PE=1 SV=3 459 650 1.0E-11
sp|Q59787|DHSO_RHOSH Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 458 649 1.0E-11
sp|Q6PUF4|DHI1L_CHICK Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Gallus gallus GN=HSD11B1L PE=2 SV=1 458 664 1.0E-11
sp|P55006|RDH7_RAT Retinol dehydrogenase 7 OS=Rattus norvegicus GN=Rdh7 PE=2 SV=1 459 664 1.0E-11
sp|O31767|YMFI_BACSU Uncharacterized oxidoreductase YmfI OS=Bacillus subtilis (strain 168) GN=ymfI PE=3 SV=2 462 699 1.0E-11
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 57 292 1.0E-11
sp|Q6R0J2|DHI1_MESAU Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mesocricetus auratus GN=HSD11B1 PE=1 SV=3 459 663 1.0E-11
sp|Q12634|T4HR_MAGO7 Tetrahydroxynaphthalene reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_02252 PE=1 SV=2 438 652 2.0E-11
sp|A4QTE3|MKAR_MAGO7 Very-long-chain 3-oxoacyl-CoA reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05096 PE=3 SV=1 447 640 2.0E-11
sp|O18404|HCD2_DROME 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Drosophila melanogaster GN=scu PE=1 SV=1 463 653 2.0E-11
sp|O32229|YVAG_BACSU Uncharacterized oxidoreductase YvaG OS=Bacillus subtilis (strain 168) GN=yvaG PE=3 SV=1 458 694 2.0E-11
sp|Q556J2|KDSR_DICDI 3-ketodihydrosphingosine reductase OS=Dictyostelium discoideum GN=ksrA-1 PE=3 SV=1 458 650 2.0E-11
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 458 701 2.0E-11
sp|O54753|H17B6_RAT 17-beta-hydroxysteroid dehydrogenase type 6 OS=Rattus norvegicus GN=Hsd17b6 PE=1 SV=2 459 669 2.0E-11
sp|Q68VY7|FABG_RICTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fabG PE=3 SV=1 459 652 2.0E-11
sp|P50204|PHAB_PARDE Acetoacetyl-CoA reductase OS=Paracoccus denitrificans GN=phaB PE=3 SV=1 462 653 2.0E-11
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 462 691 2.0E-11
sp|A6RBW9|MKAR_AJECN Very-long-chain 3-oxoacyl-CoA reductase OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_07127 PE=3 SV=1 447 652 3.0E-11
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 62 292 3.0E-11
sp|A4IFM3|DR9C7_BOVIN Short-chain dehydrogenase/reductase family 9C member 7 OS=Bos taurus GN=SDR9C7 PE=2 SV=1 459 667 3.0E-11
sp|Q8K3P0|DR9C7_MOUSE Short-chain dehydrogenase/reductase family 9C member 7 OS=Mus musculus GN=Sdr9c7 PE=2 SV=1 459 664 4.0E-11
sp|O05730|VDLC_HELPY Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=vdlC PE=3 SV=2 456 705 4.0E-11
sp|Q80ZF7|RDH10_RAT Retinol dehydrogenase 10 OS=Rattus norvegicus GN=Rdh10 PE=1 SV=1 453 653 4.0E-11
sp|F4J300|SDR5_ARATH Short-chain dehydrogenase reductase 5 OS=Arabidopsis thaliana GN=SDR5 PE=3 SV=1 458 694 4.0E-11
sp|O74628|YQ53_SCHPO Uncharacterized oxidoreductase C162.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.03 PE=3 SV=1 465 650 4.0E-11
sp|Q8IZV5|RDH10_HUMAN Retinol dehydrogenase 10 OS=Homo sapiens GN=RDH10 PE=1 SV=1 453 653 5.0E-11
sp|Q8HZT6|RDH10_BOVIN Retinol dehydrogenase 10 OS=Bos taurus GN=RDH10 PE=1 SV=1 453 653 5.0E-11
sp|P87025|THR1_COLOR Trihydroxynaphthalene reductase OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=THR1 PE=3 SV=4 459 652 5.0E-11
sp|P16542|DHK1_STRVN Granaticin polyketide synthase putative ketoacyl reductase 1 OS=Streptomyces violaceoruber GN=gra-orf5 PE=3 SV=1 463 650 5.0E-11
sp|Q8VCH7|RDH10_MOUSE Retinol dehydrogenase 10 OS=Mus musculus GN=Rdh10 PE=1 SV=2 453 653 6.0E-11
sp|Q2H1V7|MKAR_CHAGB Very-long-chain 3-oxoacyl-CoA reductase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_04239 PE=3 SV=1 447 652 6.0E-11
sp|P50165|TRNH_DATST Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1 459 664 7.0E-11
sp|Q8MJY8|PGDH_MACFA 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1 458 667 7.0E-11
sp|Q5B0R9|MKAR_EMENI Very-long-chain 3-oxoacyl-CoA reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5861 PE=3 SV=1 461 644 7.0E-11
sp|P52037|YGFF_ECOLI Uncharacterized oxidoreductase YgfF OS=Escherichia coli (strain K12) GN=ygfF PE=3 SV=2 463 650 7.0E-11
sp|Q9NYR8|RDH8_HUMAN Retinol dehydrogenase 8 OS=Homo sapiens GN=RDH8 PE=1 SV=1 460 654 7.0E-11
sp|P70720|FABG_AGGAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aggregatibacter actinomycetemcomitans GN=fabG PE=3 SV=1 465 687 7.0E-11
sp|P15428|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1 458 667 7.0E-11
sp|P50172|DHI1_MOUSE Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mus musculus GN=Hsd11b1 PE=1 SV=3 459 664 9.0E-11
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 61 312 9.0E-11
sp|Q29608|DHI1_SAISC Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Saimiri sciureus GN=HSD11B1 PE=2 SV=3 459 650 9.0E-11
sp|A8N6B4|MKAR_COPC7 Very-long-chain 3-oxoacyl-CoA reductase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_02019 PE=3 SV=1 447 644 9.0E-11
sp|Q92506|DHB8_HUMAN Estradiol 17-beta-dehydrogenase 8 OS=Homo sapiens GN=HSD17B8 PE=1 SV=2 456 650 9.0E-11
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 60 290 1.0E-10
sp|P50206|BPHB_PSES1 Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas sp. (strain KKS102) GN=bphB PE=3 SV=1 458 686 1.0E-10
sp|H9BFQ2|TPRL3_ERYCB Tropinone reductase-like 3 OS=Erythroxylum coca PE=2 SV=1 458 685 1.0E-10
sp|Q8VCC1|PGDH_MOUSE 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Mus musculus GN=Hpgd PE=1 SV=1 458 694 1.0E-10
sp|Q7Z9I2|YCP9_SCHPO Uncharacterized oxidoreductase C663.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.09c PE=3 SV=1 461 667 1.0E-10
sp|P0C0Y5|MTDH_DAVTA Probable NADP-dependent mannitol dehydrogenase OS=Davidiella tassiana PE=1 SV=1 456 652 1.0E-10
sp|A8Q1U2|MKAR_MALGO Very-long-chain 3-oxoacyl-CoA reductase OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MGL_1839 PE=3 SV=1 458 683 1.0E-10
sp|Q9ZNN8|BUDC_CORGT L-2,3-butanediol dehydrogenase OS=Corynebacterium glutamicum GN=budC PE=1 SV=1 462 670 1.0E-10
sp|Q8KWS9|BACC_BACAM Dihydroanticapsin 7-dehydrogenase OS=Bacillus amyloliquefaciens GN=bacC PE=1 SV=1 458 652 1.0E-10
sp|F1SWA0|ZERSY_ZINZE Zerumbone synthase OS=Zingiber zerumbet GN=ZSD1 PE=1 SV=1 458 652 2.0E-10
sp|P40580|BZRD_YEAST Benzil reductase ((S)-benzoin forming) IRC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC24 PE=1 SV=1 461 652 2.0E-10
sp|Q5TJF5|DHB8_CANLF Estradiol 17-beta-dehydrogenase 8 OS=Canis lupus familiaris GN=HSD17B8 PE=3 SV=1 458 685 2.0E-10
sp|A4FUZ6|HSDL2_BOVIN Hydroxysteroid dehydrogenase-like protein 2 OS=Bos taurus GN=HSDL2 PE=2 SV=1 457 601 2.0E-10
sp|P57432|FABG_BUCAI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabG PE=3 SV=1 462 652 2.0E-10
sp|Q68ER2|CBR4_XENTR Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 462 690 3.0E-10
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 459 645 3.0E-10
sp|Q94K41|SDR3B_ARATH Short-chain dehydrogenase reductase 3b OS=Arabidopsis thaliana GN=SDR3b PE=2 SV=1 458 694 3.0E-10
sp|Q2UET3|MKAR_ASPOR Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090026000492 PE=3 SV=1 461 644 3.0E-10
sp|H9BFQ1|TPRL2_ERYCB Tropinone reductase-like 2 OS=Erythroxylum coca PE=2 SV=1 458 685 3.0E-10
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 62 292 3.0E-10
sp|P0C622|CMTB_PSEPU 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase OS=Pseudomonas putida GN=cmtB PE=3 SV=1 459 691 3.0E-10
sp|A5W4G5|CMTB_PSEP1 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cmtB PE=3 SV=1 459 691 3.0E-10
sp|F4IKM1|TRNHB_ARATH Tropinone reductase homolog At2g29340 OS=Arabidopsis thaliana GN=At2g29340 PE=2 SV=1 455 688 3.0E-10
sp|Q9SCU0|SDR2A_ARATH Short-chain dehydrogenase reductase 2a OS=Arabidopsis thaliana GN=SDR2a PE=3 SV=1 458 653 3.0E-10
sp|P70385|DHB3_MOUSE Testosterone 17-beta-dehydrogenase 3 OS=Mus musculus GN=Hsd17b3 PE=1 SV=2 458 650 3.0E-10
sp|Q91XV4|DCXR_MESAU L-xylulose reductase OS=Mesocricetus auratus GN=DCXR PE=1 SV=1 459 687 5.0E-10
sp|Q9LHT0|TRNHF_ARATH Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana GN=At5g06060 PE=2 SV=1 455 653 5.0E-10
sp|P40398|YHXD_BACSU Uncharacterized oxidoreductase YhxD OS=Bacillus subtilis (strain 168) GN=yhxD PE=3 SV=2 438 669 5.0E-10
sp|A2QCH3|MKAR_ASPNC Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g03570 PE=3 SV=1 461 644 5.0E-10
sp|A8E5C5|DS7CA_DANRE Dehydrogenase/reductase SDR family member 7C-A OS=Danio rerio GN=dhrs7ca PE=2 SV=1 461 651 5.0E-10
sp|O75452|RDH16_HUMAN Retinol dehydrogenase 16 OS=Homo sapiens GN=RDH16 PE=1 SV=2 453 667 6.0E-10
sp|Q9ZKW1|VDLC_HELPJ Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=vdlC PE=3 SV=1 463 685 6.0E-10
sp|P07772|BEND_ACIAD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benD PE=3 SV=2 458 675 6.0E-10
sp|Q7SYS6|DHI1B_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein B OS=Xenopus laevis GN=hsd11b1l-b PE=2 SV=1 461 691 7.0E-10
sp|O70351|HCD2_RAT 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Rattus norvegicus GN=Hsd17b10 PE=1 SV=3 459 653 7.0E-10
sp|P16543|DHK2_STRVN Granaticin polyketide synthase putative ketoacyl reductase 2 OS=Streptomyces violaceoruber GN=gra-orf6 PE=3 SV=1 463 650 8.0E-10
sp|P19992|HSD_STREX 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Streptomyces exfoliatus PE=1 SV=1 459 646 8.0E-10
sp|Q5RA68|HSDL2_PONAB Hydroxysteroid dehydrogenase-like protein 2 OS=Pongo abelii GN=HSDL2 PE=2 SV=1 457 601 9.0E-10
sp|A5DND6|MKAR_PICGU Very-long-chain 3-oxoacyl-CoA reductase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_04787 PE=3 SV=1 447 653 1.0E-09
sp|Q9FZ42|GRDH1_ARATH Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1 457 666 1.0E-09
sp|P50842|KDUD_BACSU 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Bacillus subtilis (strain 168) GN=kduD PE=2 SV=1 459 650 1.0E-09
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 443 657 1.0E-09
sp|Q6P7J1|DHI1A_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein A OS=Xenopus laevis GN=hsd11b1l-a PE=2 SV=1 461 691 1.0E-09
sp|Q8P3K4|FUCDH_XANCP 2-keto-3-deoxy-L-fuconate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC4067 PE=1 SV=1 458 685 1.0E-09
sp|Q6YN16|HSDL2_HUMAN Hydroxysteroid dehydrogenase-like protein 2 OS=Homo sapiens GN=HSDL2 PE=1 SV=1 457 601 1.0E-09
sp|O14351|YB45_SCHPO Uncharacterized oxidoreductase C30D10.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC30D10.05c PE=3 SV=1 460 650 1.0E-09
sp|P16232|DHI1_RAT Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Rattus norvegicus GN=Hsd11b1 PE=1 SV=2 459 650 1.0E-09
sp|O80714|SDR3C_ARATH Short-chain dehydrogenase reductase 3c OS=Arabidopsis thaliana GN=SDR3c PE=3 SV=1 458 694 1.0E-09
sp|Q9ZW15|TRNH9_ARATH Tropinone reductase homolog At2g29320 OS=Arabidopsis thaliana GN=At2g29320 PE=2 SV=1 459 688 2.0E-09
sp|A1C6J8|MKAR_ASPCL Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_070510 PE=3 SV=1 461 644 2.0E-09
sp|A1DH66|MKAR_NEOFI Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_086780 PE=3 SV=1 461 644 2.0E-09
sp|Q42182|TRNH7_ARATH Tropinone reductase homolog At2g29300 OS=Arabidopsis thaliana GN=At2g29300 PE=2 SV=2 455 688 2.0E-09
sp|Q6PUF3|DHI1L_DANRE Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Danio rerio GN=hsd11b1l PE=2 SV=1 450 650 2.0E-09
sp|Q66KC4|HSDL2_XENTR Hydroxysteroid dehydrogenase-like protein 2 OS=Xenopus tropicalis GN=hsdl2 PE=2 SV=1 457 601 2.0E-09
sp|Q56841|HCDS_XANP2 2-(S)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecE PE=1 SV=1 462 699 2.0E-09
sp|P31808|YCIK_ECOLI Uncharacterized oxidoreductase YciK OS=Escherichia coli (strain K12) GN=yciK PE=1 SV=3 455 668 2.0E-09
sp|P80873|GS39_BACSU General stress protein 39 OS=Bacillus subtilis (strain 168) GN=ydaD PE=1 SV=3 458 669 2.0E-09
sp|P0AET8|HDHA_ECOLI 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli (strain K12) GN=hdhA PE=1 SV=1 458 685 2.0E-09
sp|P0AET9|HDHA_ECO57 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli O157:H7 GN=hdhA PE=3 SV=1 458 685 2.0E-09
sp|Q2TPA8|HSDL2_MOUSE Hydroxysteroid dehydrogenase-like protein 2 OS=Mus musculus GN=Hsdl2 PE=1 SV=1 457 601 2.0E-09
sp|Q9N126|RDH8_BOVIN Retinol dehydrogenase 8 OS=Bos taurus GN=RDH8 PE=1 SV=1 460 654 2.0E-09
sp|Q9P324|YI78_SCHPO Uncharacterized oxidoreductase C977.08/C1348.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.08 PE=3 SV=1 517 646 2.0E-09
sp|Q8N4T8|CBR4_HUMAN Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3 462 690 2.0E-09
sp|Q6P3L6|DH12A_DANRE Very-long-chain 3-oxoacyl-CoA reductase-A OS=Danio rerio GN=hsd17b12a PE=2 SV=1 461 652 2.0E-09
sp|P50205|PHBB_RHIME Acetoacetyl-CoA reductase OS=Rhizobium meliloti (strain 1021) GN=phbB PE=3 SV=1 462 653 2.0E-09
sp|P72220|BPHB_PSEPU Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas putida GN=bphB PE=3 SV=1 458 657 3.0E-09
sp|Q9URX0|YLX6_SCHPO Uncharacterized oxidoreductase C922.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.06 PE=3 SV=1 459 648 3.0E-09
sp|Q4X117|MKAR_ASPFU Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G11540 PE=3 SV=1 461 644 3.0E-09
sp|B0XSI3|MKAR_ASPFC Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_027290 PE=3 SV=1 461 644 3.0E-09
sp|P0A9P9|IDNO_ECOLI Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 459 665 4.0E-09
sp|P0A9Q0|IDNO_ECOL6 Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 459 665 4.0E-09
sp|Q02337|BDH_BOVIN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=BDH1 PE=1 SV=2 459 648 4.0E-09
sp|Q1WNP0|DHB1_PANTR Estradiol 17-beta-dehydrogenase 1 OS=Pan troglodytes GN=HSD17B1 PE=3 SV=3 459 685 4.0E-09
sp|Q99714|HCD2_HUMAN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens GN=HSD17B10 PE=1 SV=3 461 653 5.0E-09
sp|Q9ZW16|TRNHA_ARATH Tropinone reductase homolog At2g29330 OS=Arabidopsis thaliana GN=TRI PE=1 SV=1 455 652 5.0E-09
sp|Q02338|BDH_HUMAN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Homo sapiens GN=BDH1 PE=1 SV=3 459 648 5.0E-09
sp|Q9FYL6|KCR2_ARATH Very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470 OS=Arabidopsis thaliana GN=KCR2 PE=2 SV=1 455 653 5.0E-09
sp|P14061|DHB1_HUMAN Estradiol 17-beta-dehydrogenase 1 OS=Homo sapiens GN=HSD17B1 PE=1 SV=3 459 685 6.0E-09
sp|A5PJJ7|S16C6_BOVIN Short-chain dehydrogenase/reductase family 16C member 6 OS=Bos taurus GN=SDR16C6 PE=2 SV=1 459 703 7.0E-09
sp|Q9NUI1|DECR2_HUMAN Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens GN=DECR2 PE=1 SV=1 462 668 8.0E-09
sp|E3VWI6|PNTF_STRAE 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces arenae GN=pntF PE=3 SV=1 462 687 8.0E-09
sp|Q4V8F9|HSDL2_RAT Hydroxysteroid dehydrogenase-like protein 2 OS=Rattus norvegicus GN=Hsdl2 PE=2 SV=1 457 601 9.0E-09
sp|Q5BL28|DS7CB_DANRE Dehydrogenase/reductase SDR family member 7C-B OS=Danio rerio GN=dhrs7cb PE=2 SV=1 461 651 1.0E-08
sp|P47227|BPHB_BURXL Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=bphB PE=1 SV=1 458 657 1.0E-08
sp|P07914|BAIA1_CLOSV Bile acid 7-dehydroxylase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA1 PE=1 SV=3 462 652 1.0E-08
sp|Q6PAY8|HSDL2_XENLA Hydroxysteroid dehydrogenase-like protein 2 OS=Xenopus laevis GN=hsdl2 PE=2 SV=1 457 601 1.0E-08
sp|Q5RBV3|DECR2_PONAB Peroxisomal 2,4-dienoyl-CoA reductase OS=Pongo abelii GN=DECR2 PE=2 SV=1 462 668 1.0E-08
sp|O74470|YQC8_SCHPO Uncharacterized oxidoreductase C1739.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.08c PE=3 SV=1 459 668 1.0E-08
sp|H9BFQ0|TPRL1_ERYCB Tropinone reductase-like 1 OS=Erythroxylum coca PE=2 SV=1 458 685 1.0E-08
sp|Q5BE65|TSC10_EMENI 3-ketodihydrosphingosine reductase tsc10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tsc10 PE=3 SV=2 452 552 2.0E-08
sp|A9UM79|DRS7C_XENTR Dehydrogenase/reductase SDR family member 7C OS=Xenopus tropicalis GN=dhrs7c PE=2 SV=1 459 645 2.0E-08
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 62 292 2.0E-08
sp|P55575|Y4MP_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4mP OS=Rhizobium sp. (strain NGR234) GN=NGR_a02430 PE=3 SV=1 459 685 2.0E-08
sp|P51657|DHB1_RAT Estradiol 17-beta-dehydrogenase 1 OS=Rattus norvegicus GN=Hsd17b1 PE=1 SV=1 463 689 2.0E-08
sp|O42866|FABG_SCHPO 3-oxoacyl-[acyl-carrier-protein] reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oar2 PE=3 SV=1 465 687 2.0E-08
sp|P0AG84|YGHA_ECOLI Uncharacterized oxidoreductase YghA OS=Escherichia coli (strain K12) GN=yghA PE=1 SV=1 457 672 2.0E-08
sp|P0AG85|YGHA_ECO57 Uncharacterized oxidoreductase YghA OS=Escherichia coli O157:H7 GN=yghA PE=3 SV=1 457 672 2.0E-08
sp|Q1JP75|DCXR_BOVIN L-xylulose reductase OS=Bos taurus GN=DCXR PE=2 SV=1 458 650 2.0E-08
sp|Q9VXJ0|DHB4_DROME Peroxisomal multifunctional enzyme type 2 OS=Drosophila melanogaster GN=Mfe2 PE=1 SV=1 458 605 3.0E-08
sp|O02691|HCD2_BOVIN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Bos taurus GN=HSD17B10 PE=1 SV=3 461 653 3.0E-08
sp|Q8NK50|MTDH_HYPJE NADP-dependent mannitol dehydrogenase OS=Hypocrea jecorina GN=lxr1 PE=1 SV=1 459 652 3.0E-08
sp|Q59RQ2|TSC10_CANAL 3-ketodihydrosphingosine reductase TSC10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TSC10 PE=3 SV=1 459 650 3.0E-08
sp|Q9M1K9|ATA1_ARATH Short-chain dehydrogenase reductase ATA1 OS=Arabidopsis thaliana GN=TA1 PE=2 SV=1 458 653 3.0E-08
sp|Q5KTS5|GRDH_DAUCA Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 458 666 3.0E-08
sp|P47230|BPHB_RHOGO Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Rhodococcus globerulus GN=bphB PE=3 SV=1 458 648 4.0E-08
sp|O54939|DHB3_RAT Testosterone 17-beta-dehydrogenase 3 OS=Rattus norvegicus GN=Hsd17b3 PE=2 SV=1 458 650 4.0E-08
sp|Q9JIF5|PECR_CAVPO Peroxisomal trans-2-enoyl-CoA reductase OS=Cavia porcellus GN=PECR PE=1 SV=1 457 690 4.0E-08
sp|P71534|FABG_MYCS2 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabG PE=3 SV=2 450 652 4.0E-08
sp|P51656|DHB1_MOUSE Estradiol 17-beta-dehydrogenase 1 OS=Mus musculus GN=Hsd17b1 PE=2 SV=1 463 686 4.0E-08
sp|P0DKI3|TRNH1_ARATH Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1 448 668 4.0E-08
sp|Q56632|VIBA_VIBCH Vibriobactin-specific 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibA PE=3 SV=1 516 687 5.0E-08
sp|O08756|HCD2_MOUSE 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Mus musculus GN=Hsd17b10 PE=1 SV=4 459 665 5.0E-08
sp|Q6CE86|TSC10_YARLI 3-ketodihydrosphingosine reductase TSC10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TSC10 PE=3 SV=1 459 650 5.0E-08
sp|Q9T0G0|HSD5_ARATH 11-beta-hydroxysteroid dehydrogenase-like 5 OS=Arabidopsis thaliana GN=HSD5 PE=2 SV=1 459 635 5.0E-08
sp|Q9BUT1|BDH2_HUMAN 3-hydroxybutyrate dehydrogenase type 2 OS=Homo sapiens GN=BDH2 PE=1 SV=2 457 672 5.0E-08
sp|Q29529|CBR2_PIG Carbonyl reductase [NADPH] 2 OS=Sus scrofa GN=CBR2 PE=1 SV=1 456 687 6.0E-08
sp|P37058|DHB3_HUMAN Testosterone 17-beta-dehydrogenase 3 OS=Homo sapiens GN=HSD17B3 PE=1 SV=2 458 652 6.0E-08
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 433 657 7.0E-08
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 461 652 7.0E-08
sp|Q75A60|MKAR_ASHGO Very-long-chain 3-oxoacyl-CoA reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ADR059C PE=3 SV=2 447 653 7.0E-08
sp|A3LZU7|RM1DH_PICST L-rhamnose-1-dehydrogenase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHG2 PE=1 SV=2 457 685 9.0E-08
sp|Q9ZW14|TRNH8_ARATH Tropinone reductase homolog At2g29310 OS=Arabidopsis thaliana GN=At2g29310 PE=2 SV=1 455 688 9.0E-08
sp|P40397|YHXC_BACSU Uncharacterized oxidoreductase YhxC OS=Bacillus subtilis (strain 168) GN=yhxC PE=3 SV=2 441 666 1.0E-07
sp|O49332|TRNHE_ARATH Tropinone reductase homolog At2g30670 OS=Arabidopsis thaliana GN=At2g30670 PE=3 SV=1 455 652 1.0E-07
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 58 316 1.0E-07
sp|Q01198|LIGD_SPHPI C alpha-dehydrogenase OS=Sphingomonas paucimobilis GN=ligD PE=3 SV=1 462 694 1.0E-07
sp|Q10245|MKAR_SCHPO Very-long-chain 3-oxoacyl-CoA reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.15 PE=3 SV=1 457 640 1.0E-07
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 135 292 1.0E-07
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 62 292 1.0E-07
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 459 666 1.0E-07
sp|Q9C826|ABA2_ARATH Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN=ABA2 PE=1 SV=1 458 652 1.0E-07
sp|P33368|YOHF_ECOLI Uncharacterized oxidoreductase YohF OS=Escherichia coli (strain K12) GN=yohF PE=3 SV=2 462 669 1.0E-07
sp|Q4P622|MKAR_USTMA Very-long-chain 3-oxoacyl-CoA reductase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_04441 PE=3 SV=1 464 664 1.0E-07
sp|Q91VT4|CBR4_MOUSE Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2 462 690 1.0E-07
sp|Q22230|DECR_CAEEL Probable 2,4-dienoyl-CoA reductase 3 OS=Caenorhabditis elegans GN=decr-1.3 PE=3 SV=1 442 650 2.0E-07
sp|A3LXZ3|MKAR_PICST Very-long-chain 3-oxoacyl-CoA reductase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_79198 PE=3 SV=1 447 640 2.0E-07
sp|P39333|BDCA_ECOLI Cyclic-di-GMP-binding biofilm dispersal mediator protein OS=Escherichia coli (strain K12) GN=bdcA PE=1 SV=2 456 668 2.0E-07
sp|Q9S9W2|SDRA_ARATH Short-chain dehydrogenase/reductase SDRA OS=Arabidopsis thaliana GN=SDRA PE=1 SV=1 458 664 2.0E-07
sp|G0RNA2|LXR4_HYPJQ L-xylo-3-hexulose reductase OS=Hypocrea jecorina (strain QM6a) GN=lxr4 PE=1 SV=1 461 646 2.0E-07
sp|P37769|KDUD_ECOLI 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=kduD PE=1 SV=2 459 650 2.0E-07
sp|Q6QA33|DH12B_DANRE Very-long-chain 3-oxoacyl-CoA reductase-B OS=Danio rerio GN=hsd17b12b PE=2 SV=2 461 652 2.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7141 0.3213 0.1378 0.0694 0.096 0.1298 0.0674 0.1216 0.0454 0.0695

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup216
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4864
Ophiocordyceps australis map64 (Brazil) OphauB2|263
Ophiocordyceps australis map64 (Brazil) OphauB2|352
Ophiocordyceps camponoti-floridani Ophcf2|03985
Ophiocordyceps camponoti-rufipedis Ophun1|1885
Ophiocordyceps kimflemingae Ophio5|1347
Ophiocordyceps kimflemingae Ophio5|1348
Ophiocordyceps kimflemingae Ophio5|7675
Ophiocordyceps subramaniannii Hirsu2|2141
Ophiocordyceps subramaniannii Hirsu2|4799
Ophiocordyceps subramaniannii Hirsu2|7001 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7001
LAGSPTLDGHLAAVRAARDGHTAAVQADLPAVLRADCALPDDIRVDAGAVAERRLADADVVLLTGTTGYLGAFLL
RAILDRTAARVLCLVRFTEPSAGGDARPAGMARIRKNLVDLGIWDDSLLDRMEIVPGNLARNRLGLSPSAFDDLA
SRVQLIVHAAATVNLVYPYAALRNANVGGTREVLRLAARAGATVHHVSTNGVLPPSAAGAAGWAEDAVLDIDAVP
DKLADGYGQTKWVAEKLVCEAGRRGLPVRVYRPGTISGHSVTGSTNTYDLLNAIIVESLHLGFAPAVDGWRAEMT
PADFVSDAIVALASLPDPDPDRRVYHLGDPRPVTADAVFDNLAALGYPTEKLPWDEWVALWSERRGSRGTGGDDP
FTVDILRGGMPTVDALRCVTVLDDAATRPALDRCGLRRPAIDAALWETYARHFYARGWLPRPPRRLQQPDGILPS
AARAKQGRLAGKVAVVTGASSGMGAAVAAQLAAEGAHVVLAARRQDALEAVRAAIVRSRGTGGGGKILTRPTDVT
SREQVEALMRTTTETLGDIDILVVCAGVMYFTIMANAQADEWERTVDVNCKGLLHCLSSTVPGFVRRGRGHIVAI
SSDAGRKVFPGLGVYSGSKFFIEATLQALRLETAGSGLRVTSVQPGNVDTGLLGLSTDAEALKKYGEPTGAKVLD
ANDVASAIMFALLQPEHVAVNEVLIEPREEPI*
Coding >Hirsu2|7001
CTGGCCGGCAGCCCCACCCTCGACGGCCACCTGGCCGCCGTCCGCGCCGCCCGCGACGGCCACACCGCCGCCGTC
CAGGCCGACCTGCCCGCCGTGCTGCGCGCCGACTGCGCCCTGCCCGACGACATCCGCGTCGACGCCGGCGCCGTC
GCCGAGCGCCGCCTCGCCGACGCCGACGTCGTCCTGCTCACCGGCACCACCGGCTACCTCGGCGCCTTCCTGCTG
CGCGCCATCCTCGACCGCACCGCCGCCCGCGTCCTCTGCCTCGTCCGCTTCACCGAGCCGTCCGCCGGCGGCGAC
GCCCGGCCGGCCGGCATGGCCCGCATCCGCAAGAACCTCGTCGACCTCGGCATCTGGGACGACTCGCTGCTCGAC
CGCATGGAGATCGTGCCCGGCAACCTGGCCCGCAACCGGCTCGGCCTGTCGCCCTCGGCCTTCGACGACCTCGCC
TCGCGCGTCCAGCTCATCGTCCACGCCGCCGCCACCGTCAACCTCGTCTACCCGTACGCCGCCCTGCGCAACGCC
AACGTCGGCGGCACCCGCGAGGTCCTCCGCCTCGCCGCCCGCGCCGGCGCCACCGTCCACCACGTCTCCACCAAC
GGCGTCCTGCCGCCCTCGGCCGCCGGCGCCGCCGGCTGGGCCGAAGACGCCGTGCTCGACATCGACGCCGTGCCC
GACAAGCTGGCCGACGGCTACGGCCAGACCAAGTGGGTGGCCGAGAAGCTCGTCTGTGAGGCCGGCCGCCGCGGC
CTGCCCGTCCGCGTCTACCGCCCGGGCACCATCAGCGGCCACAGCGTCACCGGCTCGACCAACACCTACGACCTG
CTCAACGCCATCATCGTCGAGTCGCTGCACCTGGGCTTCGCCCCGGCCGTCGACGGCTGGCGCGCCGAGATGACG
CCGGCCGACTTCGTCAGCGACGCCATCGTCGCCCTCGCCAGCTTGCCGGACCCGGACCCGGACCGCCGCGTCTAC
CACCTCGGCGACCCCCGCCCCGTCACCGCCGACGCCGTCTTCGACAACCTCGCCGCCCTCGGCTACCCGACCGAG
AAGCTGCCGTGGGACGAGTGGGTGGCGCTGTGGAGCGAGAGGCGCGGCTCGCGCGGCACCGGCGGCGACGACCCC
TTCACCGTCGACATCCTGCGCGGCGGCATGCCCACCGTCGATGCCCTCCGCTGCGTCACCGTCCTCGACGACGCC
GCAACCCGCCCGGCCCTCGACCGCTGCGGCCTCCGCCGGCCCGCGATCGACGCGGCGCTGTGGGAGACGTACGCC
CGCCACTTCTACGCCCGGGGCTGGCTGCCGCGTCCGCCTCGCCGCCTGCAACAGCCCGACGGCATCCTCCCCTCC
GCCGCTCGGGCGAAGCAGGGCCGCCTCGCCGGCAAGGTCGCCGTCGTCACCGGCGCGTCGTCCGGCATGGGCGCC
GCCGTGGCCGCCCAGCTCGCCGCCGAGGGTGCCCACGTCGTGCTGGCCGCTCGCCGCCAGGACGCTCTCGAGGCG
GTGCGCGCCGCCATCGTCCGATCTCGCGGCACCGGCGGCGGCGGCAAGATCTTGACGCGGCCGACCGATGTCACG
AGCCGCGAGCAGGTCGAGGCGCTGATGCGGACGACGACGGAGACGCTGGGGGACATCGACATCCTCGTCGTCTGC
GCTGGCGTCATGTACTTCACCATCATGGCCAATGCCCAGGCCGACGAGTGGGAGCGCACAGTCGACGTCAACTGC
AAGGGCTTGCTGCACTGCCTTTCGTCCACGGTCCCGGGCTTCGTCCGCCGCGGCCGCGGCCACATCGTCGCCATC
TCCTCCGACGCCGGCCGCAAGGTCTTCCCGGGCCTCGGCGTCTATTCCGGCTCCAAGTTTTTCATCGAGGCCACC
CTGCAGGCCCTGCGCCTGGAGACGGCCGGCTCCGGCCTGCGCGTCACCTCGGTCCAGCCCGGCAATGTCGACACC
GGCCTGCTCGGCCTCTCGACCGATGCCGAGGCGCTCAAAAAGTATGGCGAGCCCACCGGAGCCAAGGTCCTCGAC
GCGAACGATGTCGCTTCCGCCATCATGTTTGCCCTGCTGCAACCCGAGCACGTGGCCGTCAACGAAGTCCTCATC
GAGCCTCGTGAGGAGCCTATCTAG
Transcript >Hirsu2|7001
CTGGCCGGCAGCCCCACCCTCGACGGCCACCTGGCCGCCGTCCGCGCCGCCCGCGACGGCCACACCGCCGCCGTC
CAGGCCGACCTGCCCGCCGTGCTGCGCGCCGACTGCGCCCTGCCCGACGACATCCGCGTCGACGCCGGCGCCGTC
GCCGAGCGCCGCCTCGCCGACGCCGACGTCGTCCTGCTCACCGGCACCACCGGCTACCTCGGCGCCTTCCTGCTG
CGCGCCATCCTCGACCGCACCGCCGCCCGCGTCCTCTGCCTCGTCCGCTTCACCGAGCCGTCCGCCGGCGGCGAC
GCCCGGCCGGCCGGCATGGCCCGCATCCGCAAGAACCTCGTCGACCTCGGCATCTGGGACGACTCGCTGCTCGAC
CGCATGGAGATCGTGCCCGGCAACCTGGCCCGCAACCGGCTCGGCCTGTCGCCCTCGGCCTTCGACGACCTCGCC
TCGCGCGTCCAGCTCATCGTCCACGCCGCCGCCACCGTCAACCTCGTCTACCCGTACGCCGCCCTGCGCAACGCC
AACGTCGGCGGCACCCGCGAGGTCCTCCGCCTCGCCGCCCGCGCCGGCGCCACCGTCCACCACGTCTCCACCAAC
GGCGTCCTGCCGCCCTCGGCCGCCGGCGCCGCCGGCTGGGCCGAAGACGCCGTGCTCGACATCGACGCCGTGCCC
GACAAGCTGGCCGACGGCTACGGCCAGACCAAGTGGGTGGCCGAGAAGCTCGTCTGTGAGGCCGGCCGCCGCGGC
CTGCCCGTCCGCGTCTACCGCCCGGGCACCATCAGCGGCCACAGCGTCACCGGCTCGACCAACACCTACGACCTG
CTCAACGCCATCATCGTCGAGTCGCTGCACCTGGGCTTCGCCCCGGCCGTCGACGGCTGGCGCGCCGAGATGACG
CCGGCCGACTTCGTCAGCGACGCCATCGTCGCCCTCGCCAGCTTGCCGGACCCGGACCCGGACCGCCGCGTCTAC
CACCTCGGCGACCCCCGCCCCGTCACCGCCGACGCCGTCTTCGACAACCTCGCCGCCCTCGGCTACCCGACCGAG
AAGCTGCCGTGGGACGAGTGGGTGGCGCTGTGGAGCGAGAGGCGCGGCTCGCGCGGCACCGGCGGCGACGACCCC
TTCACCGTCGACATCCTGCGCGGCGGCATGCCCACCGTCGATGCCCTCCGCTGCGTCACCGTCCTCGACGACGCC
GCAACCCGCCCGGCCCTCGACCGCTGCGGCCTCCGCCGGCCCGCGATCGACGCGGCGCTGTGGGAGACGTACGCC
CGCCACTTCTACGCCCGGGGCTGGCTGCCGCGTCCGCCTCGCCGCCTGCAACAGCCCGACGGCATCCTCCCCTCC
GCCGCTCGGGCGAAGCAGGGCCGCCTCGCCGGCAAGGTCGCCGTCGTCACCGGCGCGTCGTCCGGCATGGGCGCC
GCCGTGGCCGCCCAGCTCGCCGCCGAGGGTGCCCACGTCGTGCTGGCCGCTCGCCGCCAGGACGCTCTCGAGGCG
GTGCGCGCCGCCATCGTCCGATCTCGCGGCACCGGCGGCGGCGGCAAGATCTTGACGCGGCCGACCGATGTCACG
AGCCGCGAGCAGGTCGAGGCGCTGATGCGGACGACGACGGAGACGCTGGGGGACATCGACATCCTCGTCGTCTGC
GCTGGCGTCATGTACTTCACCATCATGGCCAATGCCCAGGCCGACGAGTGGGAGCGCACAGTCGACGTCAACTGC
AAGGGCTTGCTGCACTGCCTTTCGTCCACGGTCCCGGGCTTCGTCCGCCGCGGCCGCGGCCACATCGTCGCCATC
TCCTCCGACGCCGGCCGCAAGGTCTTCCCGGGCCTCGGCGTCTATTCCGGCTCCAAGTTTTTCATCGAGGCCACC
CTGCAGGCCCTGCGCCTGGAGACGGCCGGCTCCGGCCTGCGCGTCACCTCGGTCCAGCCCGGCAATGTCGACACC
GGCCTGCTCGGCCTCTCGACCGATGCCGAGGCGCTCAAAAAGTATGGCGAGCCCACCGGAGCCAAGGTCCTCGAC
GCGAACGATGTCGCTTCCGCCATCATGTTTGCCCTGCTGCAACCCGAGCACGTGGCCGTCAACGAAGTCCTCATC
GAGCCTCGTGAGGAGCCTATCTAG
Gene >Hirsu2|7001
CTGGCCGGCAGCCCCACCCTCGACGGCCACCTGGCCGCCGTCCGCGCCGCCCGCGACGGCCACACCGCCGCCGTC
CAGGCCGACCTGCCCGCCGTGCTGCGCGCCGACTGCGCCCTGCCCGACGACATCCGCGTCGACGCCGGCGCCGTC
GCCGAGCGCCGCCTCGCCGACGCCGACGTCGTCCTGCTCACCGGCACCACCGGCTACCTCGGCGCCTTCCTGCTG
CGCGCCATCCTCGACCGCACCGCCGCCCGCGTCCTCTGCCTCGTCCGCTTCACCGAGCCGTCCGCCGGCGGCGAC
GCCCGGCCGGCCGGCATGGCCCGCATCCGCAAGAACCTCGTCGACCTCGGCATCTGGGACGACTCGCTGCTCGAC
CGCATGGAGATCGTGCCCGGCAACCTGGCCCGCAACCGGCTCGGCCTGTCGCCCTCGGCCTTCGACGACCTCGCC
TCGCGCGTCCAGCTCATCGTCCACGCCGCCGCCACCGTCAACCTCGTCTACCCGTACGCCGCCCTGCGCAACGCC
AACGTCGGCGGCACCCGCGAGGTCCTCCGCCTCGCCGCCCGCGCCGGCGCCACCGTCCACCACGTCTCCACCAAC
GGCGTCCTGCCGCCCTCGGCCGCCGGCGCCGCCGGCTGGGCCGAAGACGCCGTGCTCGACATCGACGCCGTGCCC
GACAAGCTGGCCGACGGCTACGGCCAGACCAAGTGGGTGGCCGAGAAGCTCGTCTGTGAGGCCGGCCGCCGCGGC
CTGCCCGTCCGCGTCTACCGCCCGGGCACCATCAGCGGCCACAGCGTCACCGGCTCGACCAACACCTACGACCTG
CTCAACGCCATCATCGTCGAGTCGCTGCACCTGGGCTTCGCCCCGGCCGTCGACGGCTGGCGCGCCGAGATGACG
CCGGCCGACTTCGTCAGCGACGCCATCGTCGCCCTCGCCAGCTTGCCGGACCCGGACCCGGACCGCCGCGTCTAC
CACCTCGGCGACCCCCGCCCCGTCACCGCCGACGCCGTCTTCGACAACCTCGCCGCCCTCGGCTACCCGACCGAG
AAGCTGCCGTGGGACGAGTGGGTGGCGCTGTGGAGCGAGAGGCGCGGCTCGCGCGGCACCGGCGGCGACGACCCC
TTCACCGTCGACATCCTGCGCGGCGGCATGCCCACCGTCGATGCCCTCCGCTGCGTCACCGTCCTCGACGACGCC
GCAACCCGCCCGGCCCTCGACCGCTGCGGCCTCCGCCGGCCCGCGATCGACGCGGCGCTGTGGGAGACGTACGCC
CGCCACTTCTACGCCCGGGGCTGGCTGCCGCGTCCGCCTCGCCGCCTGCAACAGCCCGACGGCATCCTCCCCTCC
GCCGCTCGGGCGAAGCAGGGCCGCCTCGCCGGCAAGGTCGCCGTCGTCACCGGCGCGTCGTCCGGCATGGGCGCC
GCCGTGGCCGCCCAGCTCGCCGCCGAGGGTGCCCACGTCGTGCTGGCCGCTCGCCGCCAGGACGCTCTCGAGGCG
GTGCGCGCCGCCATCGTCCGATCTCGCGGCACCGGCGGCGGCGGCAAGATCTTGACGCGGCCGACCGATGTCACG
AGCCGCGAGCAGGTCGAGGCGCTGATGCGGACGACGACGGAGACGCTGGGGGACATCGACATCCTCGTCGTCTGC
GCTGGCGTCATGTACTTCACCATCATGGCCAATGCCCAGGCCGACGAGTGGGAGCGCACAGTCGACGTCAACTGC
AAGGGCTTGCTGCACTGCCTTTCGTCCACGGTCCCGGGCTTCGTCCGCCGCGGCCGCGGCCACATCGTCGCCATC
TCCTCCGACGCCGGCCGCAAGGTCTTCCCGGGCCTCGGCGTCTATTCCGGCTCCAAGTTTTTCATCGAGGCCACC
CTGCAGGCCCTGCGCCTGGAGACGGCCGGCTCCGGCCTGCGCGTCACCTCGGTCCAGCCCGGCAATGTCGACACC
GGCCTGCTCGGCCTCTCGACCGATGCCGAGGCGCTCAAAAAGTATGGCGAGCCCACCGGAGCCAAGGTCCTCGAC
GCGAACGATGTCGCTTCCGCCATCATGTTTGCCCTGCTGCAACCCGAGCACGTGGCCGTCAACGAAGTCCTCATC
GAGCCTCGTGAGGAGCCTATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail