Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7001
Gene name
LocationContig_385:19093..21217
Strand-
Gene length (bp)2124
Transcript length (bp)2124
Coding sequence length (bp)2124
Protein length (aa) 708

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 5.5E-60 63 309
PF00106 adh_short short chain dehydrogenase 4.8E-48 462 654
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 4.0E-37 468 685
PF08659 KR KR domain 1.3E-13 465 644
PF01370 Epimerase NAD dependent epimerase/dehydratase family 4.9E-09 61 274

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 61 434 9.0E-59
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 39 373 1.0E-48
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 459 702 1.0E-45
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 459 702 1.0E-45
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 459 702 5.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 61 434 9.0E-59
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 39 373 1.0E-48
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 459 702 1.0E-45
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 459 702 1.0E-45
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 459 702 5.0E-45
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 459 702 8.0E-45
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 459 702 8.0E-45
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 459 702 1.0E-44
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 459 702 1.0E-44
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 459 702 1.0E-44
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 459 706 2.0E-43
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 459 706 4.0E-43
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 459 702 6.0E-43
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 459 702 4.0E-42
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 462 707 3.0E-41
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 4 357 6.0E-38
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 457 702 2.0E-37
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 457 702 2.0E-37
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 61 357 1.0E-36
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 61 437 7.0E-33
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 61 357 2.0E-32
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 61 357 3.0E-32
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 61 359 5.0E-32
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 458 691 4.0E-30
sp|P69936|YDFG_SALTY NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ydfG PE=3 SV=1 463 702 3.0E-28
sp|P69935|YDFG_SALTI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhi GN=ydfG PE=3 SV=1 463 702 3.0E-28
sp|D2WKD9|SDR1_AEDAE Farnesol dehydrogenase OS=Aedes aegypti GN=SDR-1 PE=1 SV=2 458 702 2.0E-27
sp|P9WGR5|Y484_MYCTU Uncharacterized oxidoreductase Rv0484c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0484c PE=1 SV=1 462 705 3.0E-26
sp|P9WGR4|Y484_MYCTO Uncharacterized oxidoreductase MT0502 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0502 PE=3 SV=1 462 705 3.0E-26
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 58 358 3.0E-24
sp|Q8FHD2|YDFG_ECOL6 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydfG PE=3 SV=2 463 702 3.0E-24
sp|P39831|YDFG_ECOLI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2 463 702 3.0E-24
sp|Q8X505|YDFG_ECO57 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O157:H7 GN=ydfG PE=3 SV=1 463 702 4.0E-24
sp|Q83RE8|YDFG_SHIFL NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Shigella flexneri GN=ydfG PE=3 SV=2 463 702 1.0E-23
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 458 705 3.0E-23
sp|Q9KWN1|SDH_RHIRD Serine 3-dehydrogenase OS=Rhizobium radiobacter GN=sdh PE=1 SV=1 465 707 3.0E-23
sp|Q8U8I2|SDH_AGRFC Serine 3-dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=sdh PE=3 SV=1 465 707 6.0E-23
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 458 702 2.0E-22
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 11 358 3.0E-22
sp|P9WGS7|Y0687_MYCTU Uncharacterized NAD-dependent oxidoreductase Rv0687 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0687 PE=1 SV=1 454 653 4.0E-22
sp|P9WGS6|Y0687_MYCTO Uncharacterized NAD-dependent oxidoreductase MT0715 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0715 PE=3 SV=1 454 653 4.0E-22
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 459 652 1.0E-21
sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 448 652 3.0E-21
sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 448 652 3.0E-21
sp|P45200|Y1430_HAEIN Probable NADP-dependent dehydrogenase HI_1430 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1430 PE=3 SV=1 464 702 4.0E-21
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 450 705 5.0E-21
sp|Q73SC8|Y4146_MYCPA Uncharacterized NAD-dependent oxidoreductase MAP_4146 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4146 PE=1 SV=1 455 653 6.0E-21
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 458 650 1.0E-20
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 459 653 1.0E-20
sp|Q6UWP2|DHR11_HUMAN Dehydrogenase/reductase SDR family member 11 OS=Homo sapiens GN=DHRS11 PE=1 SV=1 452 705 2.0E-20
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 459 683 3.0E-20
sp|P43713|FABG_HAEIN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabG PE=3 SV=1 459 685 3.0E-20
sp|Q3ZBV9|DHR11_BOVIN Dehydrogenase/reductase SDR family member 11 OS=Bos taurus GN=DHRS11 PE=2 SV=1 458 705 4.0E-20
sp|Q9STY7|HSD3_ARATH 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 458 666 5.0E-20
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 456 705 6.0E-20
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 458 691 6.0E-20
sp|Q3U0B3|DHR11_MOUSE Dehydrogenase/reductase SDR family member 11 OS=Mus musculus GN=Dhrs11 PE=1 SV=1 453 705 9.0E-20
sp|Q13268|DHRS2_HUMAN Dehydrogenase/reductase SDR family member 2, mitochondrial OS=Homo sapiens GN=DHRS2 PE=1 SV=4 431 696 1.0E-19
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 452 691 1.0E-19
sp|P00335|RIDH_ENTAE Ribitol 2-dehydrogenase OS=Enterobacter aerogenes GN=rbtD PE=1 SV=1 459 703 1.0E-19
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 448 668 1.0E-19
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 448 668 1.0E-19
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 459 685 2.0E-19
sp|Q8KES3|SPRE_CHLTE Sepiapterin reductase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0609 PE=1 SV=1 463 702 2.0E-19
sp|O86034|BDHA_RHIME D-beta-hydroxybutyrate dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=bdhA PE=1 SV=1 462 653 5.0E-19
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 448 650 7.0E-19
sp|D3U1D9|ISFD_KLEOX Sulfoacetaldehyde reductase OS=Klebsiella oxytoca GN=isfD PE=1 SV=1 462 702 9.0E-19
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 457 650 1.0E-18
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 462 685 3.0E-18
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 462 685 3.0E-18
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 463 687 3.0E-18
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 52 358 3.0E-18
sp|Q8WNV7|DHRS4_PIG Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=2 459 665 3.0E-18
sp|Q06136|KDSR_HUMAN 3-ketodihydrosphingosine reductase OS=Homo sapiens GN=KDSR PE=1 SV=1 459 650 3.0E-18
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 458 691 4.0E-18
sp|Q6GV12|KDSR_MOUSE 3-ketodihydrosphingosine reductase OS=Mus musculus GN=Kdsr PE=1 SV=1 459 650 7.0E-18
sp|Q6AYS8|DHB11_RAT Estradiol 17-beta-dehydrogenase 11 OS=Rattus norvegicus GN=Hsd17b11 PE=2 SV=1 455 653 8.0E-18
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 461 696 9.0E-18
sp|Q2KIJ5|KDSR_BOVIN 3-ketodihydrosphingosine reductase OS=Bos taurus GN=KDSR PE=2 SV=1 459 650 9.0E-18
sp|P0CG22|DR4L1_HUMAN Putative dehydrogenase/reductase SDR family member 4-like 1 OS=Homo sapiens GN=DHRS4L1 PE=5 SV=1 448 668 1.0E-17
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 458 652 1.0E-17
sp|Q49117|Y182_METEA Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 458 650 2.0E-17
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 456 652 2.0E-17
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 457 668 2.0E-17
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 457 668 2.0E-17
sp|Q4JK73|DHB11_MACFA Estradiol 17-beta-dehydrogenase 11 OS=Macaca fascicularis GN=HSD17B11 PE=2 SV=1 455 653 2.0E-17
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 459 668 2.0E-17
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 448 650 3.0E-17
sp|Q48436|BUDC_KLEPN Diacetyl reductase [(S)-acetoin forming] OS=Klebsiella pneumoniae GN=budC PE=1 SV=2 462 670 3.0E-17
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 462 691 3.0E-17
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 462 646 4.0E-17
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 462 646 4.0E-17
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 462 646 4.0E-17
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 462 646 4.0E-17
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 462 646 4.0E-17
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 462 646 4.0E-17
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 456 652 4.0E-17
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 457 653 4.0E-17
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 456 652 5.0E-17
sp|Q9EQ06|DHB11_MOUSE Estradiol 17-beta-dehydrogenase 11 OS=Mus musculus GN=Hsd17b11 PE=1 SV=1 455 653 5.0E-17
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 456 652 5.0E-17
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 445 666 7.0E-17
sp|P14802|YOXD_BACSU Uncharacterized oxidoreductase YoxD OS=Bacillus subtilis (strain 168) GN=yoxD PE=3 SV=2 481 648 7.0E-17
sp|P9WGR7|Y945_MYCTU Uncharacterized oxidoreductase Rv0945 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0945 PE=1 SV=1 465 676 8.0E-17
sp|P9WGR6|Y945_MYCTO Uncharacterized oxidoreductase MT0971 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0971 PE=3 SV=1 465 676 8.0E-17
sp|P9WGS5|Y2750_MYCTU Uncharacterized oxidoreductase Rv2750 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2750 PE=1 SV=1 459 683 8.0E-17
sp|P9WGS4|Y2750_MYCTO Uncharacterized oxidoreductase MT2820 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2820 PE=3 SV=1 459 683 8.0E-17
sp|A0R518|Y6031_MYCS2 Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6031 PE=1 SV=1 457 653 9.0E-17
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 61 293 1.0E-16
sp|P94681|TSAC_COMTE 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 OS=Comamonas testosteroni GN=tsaC1 PE=1 SV=1 458 645 1.0E-16
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 459 652 1.0E-16
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 459 652 1.0E-16
sp|Q5FPE5|GMDH_GLUOX Glucose 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=GOX2015 PE=1 SV=1 458 650 1.0E-16
sp|Q9LUE4|HSD6_ARATH 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 459 652 2.0E-16
sp|Q7TQA3|RDHE2_MOUSE Epidermal retinol dehydrogenase 2 OS=Mus musculus GN=Sdr16c5 PE=2 SV=1 445 691 2.0E-16
sp|Q45219|Y2146_BRADU Probable short-chain type dehydrogenase/reductase blr2146 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr2146 PE=3 SV=2 457 687 2.0E-16
sp|Q5NVG2|DHB11_PONAB Estradiol 17-beta-dehydrogenase 11 OS=Pongo abelii GN=HSD17B11 PE=2 SV=1 455 653 2.0E-16
sp|Q04520|BUDC_RAOTE Diacetyl reductase [(S)-acetoin forming] OS=Raoultella terrigena GN=budC PE=3 SV=1 462 650 3.0E-16
sp|Q56840|HCDR_XANP2 2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3 462 685 3.0E-16
sp|Q9ZW03|TRNH3_ARATH Tropinone reductase homolog At2g29150 OS=Arabidopsis thaliana GN=At2g29150 PE=1 SV=1 459 685 3.0E-16
sp|Q8NBQ5|DHB11_HUMAN Estradiol 17-beta-dehydrogenase 11 OS=Homo sapiens GN=HSD17B11 PE=1 SV=3 455 653 3.0E-16
sp|Q1R183|ISFD_CHRSD Sulfoacetaldehyde reductase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD PE=1 SV=1 466 705 4.0E-16
sp|P50198|LINX_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 458 650 5.0E-16
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 459 677 6.0E-16
sp|P12310|DHG_BACSU Glucose 1-dehydrogenase OS=Bacillus subtilis (strain 168) GN=gdh PE=2 SV=2 459 694 6.0E-16
sp|Q9ZW19|TRNHC_ARATH Tropinone reductase homolog At2g29360 OS=Arabidopsis thaliana GN=SDR PE=1 SV=1 459 688 6.0E-16
sp|Q9X6U2|BDHA_CUPNH D-beta-hydroxybutyrate dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hbdH1 PE=3 SV=2 459 664 6.0E-16
sp|P9WGP9|SADH_MYCTU Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sadH PE=2 SV=1 459 667 7.0E-16
sp|P9WGP8|SADH_MYCTO Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sadH PE=3 SV=1 459 667 7.0E-16
sp|P9WGQ9|Y769_MYCTU Uncharacterized oxidoreductase Rv0769 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0769 PE=1 SV=1 462 664 8.0E-16
sp|P9WGQ8|Y769_MYCTO Uncharacterized oxidoreductase MT0793 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0793 PE=3 SV=1 462 664 8.0E-16
sp|P80869|DHG2_BACSU Glucose 1-dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=ycdF PE=1 SV=2 459 650 8.0E-16
sp|O88451|RDH7_MOUSE Retinol dehydrogenase 7 OS=Mus musculus GN=Rdh7 PE=1 SV=1 453 678 9.0E-16
sp|P9WGT1|HSD_MYCTU 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG3 PE=1 SV=1 456 650 1.0E-15
sp|P69166|HSD_MYCBO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG3 PE=3 SV=1 456 650 1.0E-15
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 458 675 1.0E-15
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 463 690 1.0E-15
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 463 690 1.0E-15
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 463 690 1.0E-15
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 453 663 1.0E-15
sp|Q5M875|DHB13_RAT 17-beta-hydroxysteroid dehydrogenase 13 OS=Rattus norvegicus GN=Hsd17b13 PE=1 SV=1 455 652 2.0E-15
sp|Q6PKH6|DR4L2_HUMAN Dehydrogenase/reductase SDR family member 4-like 2 OS=Homo sapiens GN=DHRS4L2 PE=2 SV=1 448 644 2.0E-15
sp|A5PJF6|HSDL1_BOVIN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Bos taurus GN=HSDL1 PE=2 SV=1 452 652 2.0E-15
sp|Q1QU27|ISFD2_CHRSD Sulfoacetaldehyde reductase 2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD2 PE=1 SV=1 463 705 2.0E-15
sp|Q28IU1|DHB12_XENTR Very-long-chain 3-oxoacyl-CoA reductase OS=Xenopus tropicalis GN=hsd17b12 PE=2 SV=1 454 652 2.0E-15
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 461 685 2.0E-15
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 461 685 2.0E-15
sp|P39483|DHG2_BACME Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 459 650 3.0E-15
sp|Q9SY73|PTALR_ARATH NADPH-dependent pterin aldehyde reductase OS=Arabidopsis thaliana GN=At1g10310 PE=1 SV=1 459 653 3.0E-15
sp|P9WGT0|HSD_MYCTO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG3 PE=3 SV=1 456 650 3.0E-15
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 459 652 3.0E-15
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 60 312 3.0E-15
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 462 650 3.0E-15
sp|Q8XBJ4|UCPA_ECO57 Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 456 668 4.0E-15
sp|P37440|UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 456 668 4.0E-15
sp|Q8T197|DHRS7_DICDI Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 434 650 4.0E-15
sp|O57314|DHB12_ANAPL Very-long-chain 3-oxoacyl-CoA reductase OS=Anas platyrhynchos GN=HSD17B12 PE=2 SV=1 451 656 5.0E-15
sp|P39484|DHG3_BACME Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 459 694 5.0E-15
sp|P55434|Y4EK_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4eK OS=Rhizobium sp. (strain NGR234) GN=NGR_a03840 PE=3 SV=1 462 694 5.0E-15
sp|Q5R7K0|HSDL1_PONAB Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Pongo abelii GN=HSDL1 PE=2 SV=1 452 652 5.0E-15
sp|Q9RA05|LIMC_RHOER (-)-trans-carveol dehydrogenase OS=Rhodococcus erythropolis GN=limC PE=1 SV=1 458 653 5.0E-15
sp|P50164|TRN2_HYONI Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1 458 668 6.0E-15
sp|Q8AVY8|DH12B_XENLA Very-long-chain 3-oxoacyl-CoA reductase-B OS=Xenopus laevis GN=hsd17b12-b PE=2 SV=1 454 652 6.0E-15
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 459 694 6.0E-15
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 459 694 6.0E-15
sp|P39485|DHG4_BACME Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 459 694 6.0E-15
sp|Q9BY49|PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2 457 646 7.0E-15
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 463 690 7.0E-15
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 459 699 7.0E-15
sp|Q56318|Y019_THEMA Uncharacterized oxidoreductase TM_0019 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0019 PE=3 SV=2 459 650 8.0E-15
sp|O34782|YVRD_BACSU Uncharacterized oxidoreductase YvrD OS=Bacillus subtilis (strain 168) GN=yvrD PE=3 SV=1 458 646 9.0E-15
sp|P10528|DHGA_BACME Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 459 694 9.0E-15
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 461 685 1.0E-14
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 461 685 1.0E-14
sp|Q3KPT7|BDH2_XENLA 3-hydroxybutyrate dehydrogenase type 2 OS=Xenopus laevis GN=bdh2 PE=2 SV=1 457 650 1.0E-14
sp|O54438|FABG_PSEAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabG PE=1 SV=1 459 650 1.0E-14
sp|O14756|H17B6_HUMAN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Homo sapiens GN=HSD17B6 PE=1 SV=1 453 664 1.0E-14
sp|P45375|PHBB_ALLVD Acetoacetyl-CoA reductase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=phbB PE=3 SV=2 462 685 1.0E-14
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 455 653 1.0E-14
sp|P66782|Y1385_MYCBO Uncharacterized oxidoreductase Mb1385 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG2 PE=3 SV=1 459 652 1.0E-14
sp|P9WGR9|Y1350_MYCTU Uncharacterized oxidoreductase Rv1350 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG2 PE=1 SV=1 459 652 1.0E-14
sp|P9WGR8|Y1350_MYCTO Uncharacterized oxidoreductase MT1393 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG2 PE=3 SV=1 459 652 1.0E-14
sp|Q5RCH8|PECR_PONAB Peroxisomal trans-2-enoyl-CoA reductase OS=Pongo abelii GN=PECR PE=2 SV=1 457 690 1.0E-14
sp|P50161|AFLM_ASPPA Versicolorin reductase 1 OS=Aspergillus parasiticus GN=ver1 PE=3 SV=2 458 653 2.0E-14
sp|A7DY56|TRN1_COCOF Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 459 688 2.0E-14
sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 459 694 2.0E-14
sp|P55541|Y4LA_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4lA OS=Rhizobium sp. (strain NGR234) GN=NGR_a02730 PE=3 SV=1 458 650 2.0E-14
sp|Q7M3I4|DHI1_RABIT Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Oryctolagus cuniculus GN=HSD11B1 PE=1 SV=2 459 641 2.0E-14
sp|P50163|TRN2_DATST Tropinone reductase 2 OS=Datura stramonium GN=TR2 PE=1 SV=1 458 668 3.0E-14
sp|Q7T2D1|RD10B_DANRE Retinol dehydrogenase 10-B OS=Danio rerio GN=rdh10b PE=2 SV=2 453 653 3.0E-14
sp|Q0WRJ2|TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana GN=TSC10A PE=1 SV=1 464 650 3.0E-14
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 61 294 3.0E-14
sp|F4JZN6|TC10B_ARATH 3-dehydrosphinganine reductase TSC10B OS=Arabidopsis thaliana GN=TSC10B PE=1 SV=1 466 650 4.0E-14
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 462 690 4.0E-14
sp|Q3SXM5|HSDL1_HUMAN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Homo sapiens GN=HSDL1 PE=1 SV=3 452 652 4.0E-14
sp|Q5C9I9|ISPD_MENPI (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial OS=Mentha piperita PE=1 SV=1 458 685 4.0E-14
sp|Q5XG41|DH12A_XENLA Very-long-chain 3-oxoacyl-CoA reductase-A OS=Xenopus laevis GN=hsd17b12-a PE=2 SV=1 454 652 4.0E-14
sp|Q9LBG2|LVR_LEIAQ Levodione reductase OS=Leifsonia aquatica GN=lvr PE=1 SV=1 458 648 4.0E-14
sp|P66780|Y1570_MYCBO Uncharacterized oxidoreductase Mb1570 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1570 PE=3 SV=1 454 657 5.0E-14
sp|P9WGS1|Y1543_MYCTU Uncharacterized oxidoreductase Rv1543 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1543 PE=1 SV=1 454 657 5.0E-14
sp|P9WGS0|Y1543_MYCTO Uncharacterized oxidoreductase MT1595 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1595 PE=3 SV=1 454 657 5.0E-14
sp|P41177|DHKR_STRCM Monensin polyketide synthase putative ketoacyl reductase OS=Streptomyces cinnamonensis PE=3 SV=1 462 650 5.0E-14
sp|Q3T001|H17B6_BOVIN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Bos taurus GN=HSD17B6 PE=2 SV=1 458 673 5.0E-14
sp|P72332|NODG_RHIS3 Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 459 652 6.0E-14
sp|C1C4R8|BDH2_LITCT 3-hydroxybutyrate dehydrogenase type 2 OS=Lithobates catesbeiana GN=bdh2 PE=2 SV=1 457 650 6.0E-14
sp|Q8N3Y7|RDHE2_HUMAN Epidermal retinol dehydrogenase 2 OS=Homo sapiens GN=SDR16C5 PE=2 SV=2 458 676 6.0E-14
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 463 668 6.0E-14
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 458 686 6.0E-14
sp|G5EGA6|DHRS4_CAEEL Dehydrogenase/reductase SDR family member 4 OS=Caenorhabditis elegans GN=dhrs-4 PE=1 SV=1 448 680 6.0E-14
sp|P87219|SOU1_CANAL Sorbose reductase SOU1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU1 PE=1 SV=1 435 669 8.0E-14
sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2 459 668 8.0E-14
sp|Q8CQD2|BUTA_STAES Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=butA PE=3 SV=1 462 646 8.0E-14
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 462 656 8.0E-14
sp|Q8K9J5|FABG_BUCAP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabG PE=3 SV=1 458 685 8.0E-14
sp|Q4R5G7|DHB12_MACFA Very-long-chain 3-oxoacyl-CoA reductase OS=Macaca fascicularis GN=HSD17B12 PE=2 SV=1 461 652 8.0E-14
sp|P87218|SOU2_CANAL Sorbose reductase homolog SOU2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU2 PE=3 SV=2 435 652 9.0E-14
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 463 690 1.0E-13
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 61 293 1.0E-13
sp|Q89AG9|FABG_BUCBP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabG PE=3 SV=1 462 665 1.0E-13
sp|Q9L9F8|NOVJ_STRNV Short-chain reductase protein NovJ OS=Streptomyces niveus GN=novJ PE=1 SV=1 462 650 1.0E-13
sp|B2B3L4|MKAR_PODAN Very-long-chain 3-oxoacyl-CoA reductase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_6_6580 PE=3 SV=2 440 652 1.0E-13
sp|Q8VCR2|DHB13_MOUSE 17-beta-hydroxysteroid dehydrogenase 13 OS=Mus musculus GN=Hsd17b13 PE=1 SV=2 455 652 1.0E-13
sp|Q8JZV9|BDH2_MOUSE 3-hydroxybutyrate dehydrogenase type 2 OS=Mus musculus GN=Bdh2 PE=1 SV=1 457 665 2.0E-13
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 459 652 2.0E-13
sp|P73826|FABG2_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG2 PE=1 SV=1 459 690 2.0E-13
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 463 690 2.0E-13
sp|P15047|ENTA_ECOLI 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Escherichia coli (strain K12) GN=entA PE=1 SV=1 459 701 2.0E-13
sp|Q4V8B7|HSDL1_RAT Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Rattus norvegicus GN=Hsdl1 PE=2 SV=1 428 652 2.0E-13
sp|Q561X9|BDH2_DANRE 3-hydroxybutyrate dehydrogenase type 2 OS=Danio rerio GN=bdh2 PE=2 SV=1 457 650 2.0E-13
sp|Q5HKG6|BUTA_STAEQ Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=butA PE=3 SV=1 462 646 2.0E-13
sp|Q53GQ0|DHB12_HUMAN Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens GN=HSD17B12 PE=1 SV=2 461 652 2.0E-13
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 462 653 2.0E-13
sp|Q8NEX9|DR9C7_HUMAN Short-chain dehydrogenase/reductase family 9C member 7 OS=Homo sapiens GN=SDR9C7 PE=1 SV=1 457 667 2.0E-13
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 457 650 2.0E-13
sp|A1L1W4|RD10A_DANRE Retinol dehydrogenase 10-A OS=Danio rerio GN=rdh10a PE=2 SV=1 453 653 3.0E-13
sp|Q9ZW12|TRNH5_ARATH Tropinone reductase homolog At2g29260, chloroplastic OS=Arabidopsis thaliana GN=At2g29260 PE=2 SV=1 459 699 3.0E-13
sp|Q05A13|S16C6_MOUSE Short-chain dehydrogenase/reductase family 16C member 6 OS=Mus musculus GN=Sdr16c6 PE=2 SV=1 459 653 3.0E-13
sp|Q8L9C4|KCR1_ARATH Very-long-chain 3-oxoacyl-CoA reductase 1 OS=Arabidopsis thaliana GN=KCR1 PE=1 SV=1 454 652 4.0E-13
sp|Q5P5I4|PED_AROAE (S)-1-Phenylethanol dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=ped PE=1 SV=1 458 662 4.0E-13
sp|A4IGM4|DHI1L_XENTR Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Xenopus tropicalis GN=hsd11b1l PE=2 SV=1 459 684 4.0E-13
sp|Q9ZW20|TRNHD_ARATH Tropinone reductase homolog At2g29370 OS=Arabidopsis thaliana GN=At2g29370 PE=3 SV=1 459 688 4.0E-13
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 462 690 4.0E-13
sp|O16881|DHS16_CAEEL 3 beta-hydroxysteroid dehydrogenase dhs-16 OS=Caenorhabditis elegans GN=dhs-16 PE=2 SV=1 460 663 4.0E-13
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 462 690 4.0E-13
sp|B0D8R3|MKAR_LACBS Very-long-chain 3-oxoacyl-CoA reductase OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_192627 PE=3 SV=1 447 629 4.0E-13
sp|Q9ZW13|TRNH6_ARATH Tropinone reductase homolog At2g29290 OS=Arabidopsis thaliana GN=At2g29290 PE=2 SV=1 455 688 5.0E-13
sp|Q82IY9|PTLF_STRAW 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlF PE=1 SV=1 458 687 5.0E-13
sp|P29147|BDH_RAT D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Bdh1 PE=1 SV=2 460 648 5.0E-13
sp|Q6CEE9|SDR_YARLI Probable NADP-dependent mannitol dehydrogenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0B16192g PE=1 SV=1 429 652 6.0E-13
sp|Q8BTX9|HSDL1_MOUSE Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Mus musculus GN=Hsdl1 PE=1 SV=1 428 651 6.0E-13
sp|P50170|RDH2_RAT Retinol dehydrogenase 2 OS=Rattus norvegicus GN=Rdh2 PE=1 SV=1 453 683 6.0E-13
sp|Q9ZW04|TRNH4_ARATH Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1 459 685 6.0E-13
sp|Q5E9H7|DHB12_BOVIN Very-long-chain 3-oxoacyl-CoA reductase OS=Bos taurus GN=HSD17B12 PE=2 SV=1 457 652 6.0E-13
sp|P39071|DHBA_BACSU 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Bacillus subtilis (strain 168) GN=dhbA PE=1 SV=3 459 701 6.0E-13
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 39 290 7.0E-13
sp|P50197|LINC_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linC PE=2 SV=1 459 665 7.0E-13
sp|Q8KWT4|BACC_BACIU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis GN=bacC PE=1 SV=1 458 652 7.0E-13
sp|Q6QLL4|DHI1_CAVPO Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Cavia porcellus GN=HSD11B1 PE=1 SV=3 459 663 7.0E-13
sp|Q988B7|PLDH_RHILO Pyridoxal 4-dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=pldh-t PE=1 SV=1 458 668 7.0E-13
sp|E3VWK2|PENF_STREX 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces exfoliatus GN=penF PE=3 SV=1 458 653 8.0E-13
sp|B2WMJ3|MKAR_PYRTR Very-long-chain 3-oxoacyl-CoA reductase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_11203 PE=3 SV=2 461 652 8.0E-13
sp|Q80XN0|BDH_MOUSE D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Bdh1 PE=1 SV=2 460 648 8.0E-13
sp|P14697|PHBB_CUPNH Acetoacetyl-CoA reductase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbB PE=1 SV=1 459 653 8.0E-13
sp|A6SG70|MKAR_BOTFB Very-long-chain 3-oxoacyl-CoA reductase OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_11561 PE=3 SV=1 461 652 9.0E-13
sp|P71079|FABL_BACSU Enoyl-[acyl-carrier-protein] reductase [NADPH] FabL OS=Bacillus subtilis (strain 168) GN=fabL PE=1 SV=1 461 685 1.0E-12
sp|O70503|DHB12_MOUSE Very-long-chain 3-oxoacyl-CoA reductase OS=Mus musculus GN=Hsd17b12 PE=1 SV=1 461 652 1.0E-12
sp|O80713|SDR3A_ARATH Short-chain dehydrogenase reductase 3a OS=Arabidopsis thaliana GN=SDR3a PE=2 SV=1 458 685 1.0E-12
sp|Q6DCT3|RD10A_XENLA Retinol dehydrogenase 10-A OS=Xenopus laevis GN=rdh10-a PE=2 SV=1 453 653 1.0E-12
sp|D4A1J4|BDH2_RAT 3-hydroxybutyrate dehydrogenase type 2 OS=Rattus norvegicus GN=Bdh2 PE=3 SV=2 457 665 1.0E-12
sp|Q6P7R8|DHB12_RAT Very-long-chain 3-oxoacyl-CoA reductase OS=Rattus norvegicus GN=Hsd17b12 PE=2 SV=1 461 652 1.0E-12
sp|Q9LUF2|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 458 651 2.0E-12
sp|P0DKC7|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 458 651 2.0E-12
sp|Q5ZJG8|HSDL1_CHICK Hydroxysteroid dehydrogenase-like protein 1 OS=Gallus gallus GN=HSDL1 PE=2 SV=1 461 656 2.0E-12
sp|Q7Z5P4|DHB13_HUMAN 17-beta-hydroxysteroid dehydrogenase 13 OS=Homo sapiens GN=HSD17B13 PE=1 SV=1 455 652 2.0E-12
sp|P50169|RDH3_RAT Retinol dehydrogenase 3 OS=Rattus norvegicus GN=Rdh3 PE=1 SV=1 459 673 2.0E-12
sp|P06234|NODG_RHIME Nodulation protein G OS=Rhizobium meliloti (strain 1021) GN=nodG PE=3 SV=1 458 652 2.0E-12
sp|O07575|YHDF_BACSU Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 457 683 2.0E-12
sp|A7F8T1|MKAR_SCLS1 Very-long-chain 3-oxoacyl-CoA reductase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_14012 PE=3 SV=1 461 652 2.0E-12
sp|Q5XGF7|RDH10_XENTR Retinol dehydrogenase 10 OS=Xenopus tropicalis GN=rdh10 PE=2 SV=1 453 653 2.0E-12
sp|Q7RYE5|MKAR_NEUCR Very-long-chain 3-oxoacyl-CoA reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU11297 PE=3 SV=1 447 652 3.0E-12
sp|P0AFP4|YBBO_ECOLI Uncharacterized oxidoreductase YbbO OS=Escherichia coli (strain K12) GN=ybbO PE=3 SV=1 457 650 3.0E-12
sp|P0AFP5|YBBO_ECOL6 Uncharacterized oxidoreductase YbbO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybbO PE=3 SV=1 457 650 3.0E-12
sp|Q0U3N7|MKAR_PHANO Very-long-chain 3-oxoacyl-CoA reductase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_13627 PE=3 SV=1 461 652 3.0E-12
sp|P23102|XYLL_PSEPU 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Pseudomonas putida GN=xylL PE=3 SV=1 458 683 3.0E-12
sp|Q937L4|CPNA_COMTE Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 457 650 3.0E-12
sp|Q8GAV9|CPNA_COMS9 Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 457 650 3.0E-12
sp|Q9R092|H17B6_MOUSE 17-beta-hydroxysteroid dehydrogenase type 6 OS=Mus musculus GN=Hsd17b6 PE=1 SV=1 457 667 3.0E-12
sp|Q9WVK3|PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 457 667 4.0E-12
sp|P23238|PHBB_ZOORA Acetoacetyl-CoA reductase OS=Zoogloea ramigera GN=phbB PE=3 SV=1 462 653 4.0E-12
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 458 685 4.0E-12
sp|F4J2Z7|SDR4_ARATH Short-chain dehydrogenase reductase 4 OS=Arabidopsis thaliana GN=SDR4 PE=2 SV=1 459 685 4.0E-12
sp|Q0CY11|MKAR_ASPTN Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_01423 PE=3 SV=1 461 644 4.0E-12
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 459 663 5.0E-12
sp|P39640|BACC_BACSU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis (strain 168) GN=bacC PE=1 SV=2 458 652 5.0E-12
sp|Q9MA93|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 437 672 5.0E-12
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 61 307 6.0E-12
sp|P70684|PGDH_CAVPO 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Cavia porcellus GN=HPGD PE=2 SV=1 458 694 6.0E-12
sp|B8H1Z0|XDH_CAUCN D-xylose 1-dehydrogenase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=xylB PE=1 SV=1 459 694 7.0E-12
sp|Q46381|BPHB_COMTE Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Comamonas testosteroni GN=bphB PE=1 SV=1 458 657 8.0E-12
sp|Q3T0C2|PGDH_BOVIN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1 458 670 8.0E-12
sp|P50199|GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 459 650 8.0E-12
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 445 653 8.0E-12
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 445 653 8.0E-12
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 445 653 8.0E-12
sp|Q9ZW18|SAG13_ARATH Senescence-associated protein 13 OS=Arabidopsis thaliana GN=SAG13 PE=1 SV=1 459 688 8.0E-12
sp|Q1DNC5|MKAR_COCIM Very-long-chain 3-oxoacyl-CoA reductase OS=Coccidioides immitis (strain RS) GN=CIMG_08188 PE=3 SV=2 447 632 8.0E-12
sp|P05707|SRLD_ECOLI Sorbitol-6-phosphate 2-dehydrogenase OS=Escherichia coli (strain K12) GN=srlD PE=1 SV=2 462 648 9.0E-12
sp|Q3T046|BDH2_BOVIN 3-hydroxybutyrate dehydrogenase type 2 OS=Bos taurus GN=BDH2 PE=2 SV=1 457 650 1.0E-11
sp|P66776|BUTA_STAAW Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MW2) GN=butA PE=3 SV=1 462 653 1.0E-11
sp|Q6GCZ8|BUTA_STAAS Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MSSA476) GN=butA PE=3 SV=1 462 653 1.0E-11
sp|Q6GKH9|BUTA_STAAR Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MRSA252) GN=butA PE=3 SV=1 462 653 1.0E-11
sp|P99120|BUTA_STAAN Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain N315) GN=butA PE=1 SV=1 462 653 1.0E-11
sp|P66775|BUTA_STAAM Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=butA PE=3 SV=1 462 653 1.0E-11
sp|Q5HJP2|BUTA_STAAC Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain COL) GN=butA PE=3 SV=1 462 653 1.0E-11
sp|Q6NRV4|RD10B_XENLA Retinol dehydrogenase 10-B OS=Xenopus laevis GN=rdh10-b PE=2 SV=1 453 653 1.0E-11
sp|O74419|YQ52_SCHPO Uncharacterized protein C162.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.02c PE=2 SV=1 57 293 1.0E-11
sp|P28845|DHI1_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Homo sapiens GN=HSD11B1 PE=1 SV=3 459 650 1.0E-11
sp|Q59787|DHSO_RHOSH Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 458 649 1.0E-11
sp|Q6PUF4|DHI1L_CHICK Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Gallus gallus GN=HSD11B1L PE=2 SV=1 458 664 1.0E-11
sp|P55006|RDH7_RAT Retinol dehydrogenase 7 OS=Rattus norvegicus GN=Rdh7 PE=2 SV=1 459 664 1.0E-11
sp|O31767|YMFI_BACSU Uncharacterized oxidoreductase YmfI OS=Bacillus subtilis (strain 168) GN=ymfI PE=3 SV=2 462 699 1.0E-11
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 57 292 1.0E-11
sp|Q6R0J2|DHI1_MESAU Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mesocricetus auratus GN=HSD11B1 PE=1 SV=3 459 663 1.0E-11
sp|Q12634|T4HR_MAGO7 Tetrahydroxynaphthalene reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_02252 PE=1 SV=2 438 652 2.0E-11
sp|A4QTE3|MKAR_MAGO7 Very-long-chain 3-oxoacyl-CoA reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_05096 PE=3 SV=1 447 640 2.0E-11
sp|O18404|HCD2_DROME 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Drosophila melanogaster GN=scu PE=1 SV=1 463 653 2.0E-11
sp|O32229|YVAG_BACSU Uncharacterized oxidoreductase YvaG OS=Bacillus subtilis (strain 168) GN=yvaG PE=3 SV=1 458 694 2.0E-11
sp|Q556J2|KDSR_DICDI 3-ketodihydrosphingosine reductase OS=Dictyostelium discoideum GN=ksrA-1 PE=3 SV=1 458 650 2.0E-11
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 458 701 2.0E-11
sp|O54753|H17B6_RAT 17-beta-hydroxysteroid dehydrogenase type 6 OS=Rattus norvegicus GN=Hsd17b6 PE=1 SV=2 459 669 2.0E-11
sp|Q68VY7|FABG_RICTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fabG PE=3 SV=1 459 652 2.0E-11
sp|P50204|PHAB_PARDE Acetoacetyl-CoA reductase OS=Paracoccus denitrificans GN=phaB PE=3 SV=1 462 653 2.0E-11
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 462 691 2.0E-11
sp|A6RBW9|MKAR_AJECN Very-long-chain 3-oxoacyl-CoA reductase OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_07127 PE=3 SV=1 447 652 3.0E-11
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 62 292 3.0E-11
sp|A4IFM3|DR9C7_BOVIN Short-chain dehydrogenase/reductase family 9C member 7 OS=Bos taurus GN=SDR9C7 PE=2 SV=1 459 667 3.0E-11
sp|Q8K3P0|DR9C7_MOUSE Short-chain dehydrogenase/reductase family 9C member 7 OS=Mus musculus GN=Sdr9c7 PE=2 SV=1 459 664 4.0E-11
sp|O05730|VDLC_HELPY Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=vdlC PE=3 SV=2 456 705 4.0E-11
sp|Q80ZF7|RDH10_RAT Retinol dehydrogenase 10 OS=Rattus norvegicus GN=Rdh10 PE=1 SV=1 453 653 4.0E-11
sp|F4J300|SDR5_ARATH Short-chain dehydrogenase reductase 5 OS=Arabidopsis thaliana GN=SDR5 PE=3 SV=1 458 694 4.0E-11
sp|O74628|YQ53_SCHPO Uncharacterized oxidoreductase C162.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.03 PE=3 SV=1 465 650 4.0E-11
sp|Q8IZV5|RDH10_HUMAN Retinol dehydrogenase 10 OS=Homo sapiens GN=RDH10 PE=1 SV=1 453 653 5.0E-11
sp|Q8HZT6|RDH10_BOVIN Retinol dehydrogenase 10 OS=Bos taurus GN=RDH10 PE=1 SV=1 453 653 5.0E-11
sp|P87025|THR1_COLOR Trihydroxynaphthalene reductase OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=THR1 PE=3 SV=4 459 652 5.0E-11
sp|P16542|DHK1_STRVN Granaticin polyketide synthase putative ketoacyl reductase 1 OS=Streptomyces violaceoruber GN=gra-orf5 PE=3 SV=1 463 650 5.0E-11
sp|Q8VCH7|RDH10_MOUSE Retinol dehydrogenase 10 OS=Mus musculus GN=Rdh10 PE=1 SV=2 453 653 6.0E-11
sp|Q2H1V7|MKAR_CHAGB Very-long-chain 3-oxoacyl-CoA reductase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_04239 PE=3 SV=1 447 652 6.0E-11
sp|P50165|TRNH_DATST Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1 459 664 7.0E-11
sp|Q8MJY8|PGDH_MACFA 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1 458 667 7.0E-11
sp|Q5B0R9|MKAR_EMENI Very-long-chain 3-oxoacyl-CoA reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5861 PE=3 SV=1 461 644 7.0E-11
sp|P52037|YGFF_ECOLI Uncharacterized oxidoreductase YgfF OS=Escherichia coli (strain K12) GN=ygfF PE=3 SV=2 463 650 7.0E-11
sp|Q9NYR8|RDH8_HUMAN Retinol dehydrogenase 8 OS=Homo sapiens GN=RDH8 PE=1 SV=1 460 654 7.0E-11
sp|P70720|FABG_AGGAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aggregatibacter actinomycetemcomitans GN=fabG PE=3 SV=1 465 687 7.0E-11
sp|P15428|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1 458 667 7.0E-11
sp|P50172|DHI1_MOUSE Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Mus musculus GN=Hsd11b1 PE=1 SV=3 459 664 9.0E-11
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 61 312 9.0E-11
sp|Q29608|DHI1_SAISC Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Saimiri sciureus GN=HSD11B1 PE=2 SV=3 459 650 9.0E-11
sp|A8N6B4|MKAR_COPC7 Very-long-chain 3-oxoacyl-CoA reductase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_02019 PE=3 SV=1 447 644 9.0E-11
sp|Q92506|DHB8_HUMAN Estradiol 17-beta-dehydrogenase 8 OS=Homo sapiens GN=HSD17B8 PE=1 SV=2 456 650 9.0E-11
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 60 290 1.0E-10
sp|P50206|BPHB_PSES1 Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas sp. (strain KKS102) GN=bphB PE=3 SV=1 458 686 1.0E-10
sp|H9BFQ2|TPRL3_ERYCB Tropinone reductase-like 3 OS=Erythroxylum coca PE=2 SV=1 458 685 1.0E-10
sp|Q8VCC1|PGDH_MOUSE 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Mus musculus GN=Hpgd PE=1 SV=1 458 694 1.0E-10
sp|Q7Z9I2|YCP9_SCHPO Uncharacterized oxidoreductase C663.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.09c PE=3 SV=1 461 667 1.0E-10
sp|P0C0Y5|MTDH_DAVTA Probable NADP-dependent mannitol dehydrogenase OS=Davidiella tassiana PE=1 SV=1 456 652 1.0E-10
sp|A8Q1U2|MKAR_MALGO Very-long-chain 3-oxoacyl-CoA reductase OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MGL_1839 PE=3 SV=1 458 683 1.0E-10
sp|Q9ZNN8|BUDC_CORGT L-2,3-butanediol dehydrogenase OS=Corynebacterium glutamicum GN=budC PE=1 SV=1 462 670 1.0E-10
sp|Q8KWS9|BACC_BACAM Dihydroanticapsin 7-dehydrogenase OS=Bacillus amyloliquefaciens GN=bacC PE=1 SV=1 458 652 1.0E-10
sp|F1SWA0|ZERSY_ZINZE Zerumbone synthase OS=Zingiber zerumbet GN=ZSD1 PE=1 SV=1 458 652 2.0E-10
sp|P40580|BZRD_YEAST Benzil reductase ((S)-benzoin forming) IRC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC24 PE=1 SV=1 461 652 2.0E-10
sp|Q5TJF5|DHB8_CANLF Estradiol 17-beta-dehydrogenase 8 OS=Canis lupus familiaris GN=HSD17B8 PE=3 SV=1 458 685 2.0E-10
sp|A4FUZ6|HSDL2_BOVIN Hydroxysteroid dehydrogenase-like protein 2 OS=Bos taurus GN=HSDL2 PE=2 SV=1 457 601 2.0E-10
sp|P57432|FABG_BUCAI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabG PE=3 SV=1 462 652 2.0E-10
sp|Q68ER2|CBR4_XENTR Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 462 690 3.0E-10
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 459 645 3.0E-10
sp|Q94K41|SDR3B_ARATH Short-chain dehydrogenase reductase 3b OS=Arabidopsis thaliana GN=SDR3b PE=2 SV=1 458 694 3.0E-10
sp|Q2UET3|MKAR_ASPOR Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090026000492 PE=3 SV=1 461 644 3.0E-10
sp|H9BFQ1|TPRL2_ERYCB Tropinone reductase-like 2 OS=Erythroxylum coca PE=2 SV=1 458 685 3.0E-10
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 62 292 3.0E-10
sp|P0C622|CMTB_PSEPU 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase OS=Pseudomonas putida GN=cmtB PE=3 SV=1 459 691 3.0E-10
sp|A5W4G5|CMTB_PSEP1 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cmtB PE=3 SV=1 459 691 3.0E-10
sp|F4IKM1|TRNHB_ARATH Tropinone reductase homolog At2g29340 OS=Arabidopsis thaliana GN=At2g29340 PE=2 SV=1 455 688 3.0E-10
sp|Q9SCU0|SDR2A_ARATH Short-chain dehydrogenase reductase 2a OS=Arabidopsis thaliana GN=SDR2a PE=3 SV=1 458 653 3.0E-10
sp|P70385|DHB3_MOUSE Testosterone 17-beta-dehydrogenase 3 OS=Mus musculus GN=Hsd17b3 PE=1 SV=2 458 650 3.0E-10
sp|Q91XV4|DCXR_MESAU L-xylulose reductase OS=Mesocricetus auratus GN=DCXR PE=1 SV=1 459 687 5.0E-10
sp|Q9LHT0|TRNHF_ARATH Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana GN=At5g06060 PE=2 SV=1 455 653 5.0E-10
sp|P40398|YHXD_BACSU Uncharacterized oxidoreductase YhxD OS=Bacillus subtilis (strain 168) GN=yhxD PE=3 SV=2 438 669 5.0E-10
sp|A2QCH3|MKAR_ASPNC Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g03570 PE=3 SV=1 461 644 5.0E-10
sp|A8E5C5|DS7CA_DANRE Dehydrogenase/reductase SDR family member 7C-A OS=Danio rerio GN=dhrs7ca PE=2 SV=1 461 651 5.0E-10
sp|O75452|RDH16_HUMAN Retinol dehydrogenase 16 OS=Homo sapiens GN=RDH16 PE=1 SV=2 453 667 6.0E-10
sp|Q9ZKW1|VDLC_HELPJ Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=vdlC PE=3 SV=1 463 685 6.0E-10
sp|P07772|BEND_ACIAD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benD PE=3 SV=2 458 675 6.0E-10
sp|Q7SYS6|DHI1B_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein B OS=Xenopus laevis GN=hsd11b1l-b PE=2 SV=1 461 691 7.0E-10
sp|O70351|HCD2_RAT 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Rattus norvegicus GN=Hsd17b10 PE=1 SV=3 459 653 7.0E-10
sp|P16543|DHK2_STRVN Granaticin polyketide synthase putative ketoacyl reductase 2 OS=Streptomyces violaceoruber GN=gra-orf6 PE=3 SV=1 463 650 8.0E-10
sp|P19992|HSD_STREX 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Streptomyces exfoliatus PE=1 SV=1 459 646 8.0E-10
sp|Q5RA68|HSDL2_PONAB Hydroxysteroid dehydrogenase-like protein 2 OS=Pongo abelii GN=HSDL2 PE=2 SV=1 457 601 9.0E-10
sp|A5DND6|MKAR_PICGU Very-long-chain 3-oxoacyl-CoA reductase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_04787 PE=3 SV=1 447 653 1.0E-09
sp|Q9FZ42|GRDH1_ARATH Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1 457 666 1.0E-09
sp|P50842|KDUD_BACSU 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Bacillus subtilis (strain 168) GN=kduD PE=2 SV=1 459 650 1.0E-09
sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 443 657 1.0E-09
sp|Q6P7J1|DHI1A_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein A OS=Xenopus laevis GN=hsd11b1l-a PE=2 SV=1 461 691 1.0E-09
sp|Q8P3K4|FUCDH_XANCP 2-keto-3-deoxy-L-fuconate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC4067 PE=1 SV=1 458 685 1.0E-09
sp|Q6YN16|HSDL2_HUMAN Hydroxysteroid dehydrogenase-like protein 2 OS=Homo sapiens GN=HSDL2 PE=1 SV=1 457 601 1.0E-09
sp|O14351|YB45_SCHPO Uncharacterized oxidoreductase C30D10.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC30D10.05c PE=3 SV=1 460 650 1.0E-09
sp|P16232|DHI1_RAT Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Rattus norvegicus GN=Hsd11b1 PE=1 SV=2 459 650 1.0E-09
sp|O80714|SDR3C_ARATH Short-chain dehydrogenase reductase 3c OS=Arabidopsis thaliana GN=SDR3c PE=3 SV=1 458 694 1.0E-09
sp|Q9ZW15|TRNH9_ARATH Tropinone reductase homolog At2g29320 OS=Arabidopsis thaliana GN=At2g29320 PE=2 SV=1 459 688 2.0E-09
sp|A1C6J8|MKAR_ASPCL Very-long-chain 3-oxoacyl-CoA reductase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_070510 PE=3 SV=1 461 644 2.0E-09
sp|A1DH66|MKAR_NEOFI Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_086780 PE=3 SV=1 461 644 2.0E-09
sp|Q42182|TRNH7_ARATH Tropinone reductase homolog At2g29300 OS=Arabidopsis thaliana GN=At2g29300 PE=2 SV=2 455 688 2.0E-09
sp|Q6PUF3|DHI1L_DANRE Hydroxysteroid 11-beta-dehydrogenase 1-like protein OS=Danio rerio GN=hsd11b1l PE=2 SV=1 450 650 2.0E-09
sp|Q66KC4|HSDL2_XENTR Hydroxysteroid dehydrogenase-like protein 2 OS=Xenopus tropicalis GN=hsdl2 PE=2 SV=1 457 601 2.0E-09
sp|Q56841|HCDS_XANP2 2-(S)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecE PE=1 SV=1 462 699 2.0E-09
sp|P31808|YCIK_ECOLI Uncharacterized oxidoreductase YciK OS=Escherichia coli (strain K12) GN=yciK PE=1 SV=3 455 668 2.0E-09
sp|P80873|GS39_BACSU General stress protein 39 OS=Bacillus subtilis (strain 168) GN=ydaD PE=1 SV=3 458 669 2.0E-09
sp|P0AET8|HDHA_ECOLI 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli (strain K12) GN=hdhA PE=1 SV=1 458 685 2.0E-09
sp|P0AET9|HDHA_ECO57 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli O157:H7 GN=hdhA PE=3 SV=1 458 685 2.0E-09
sp|Q2TPA8|HSDL2_MOUSE Hydroxysteroid dehydrogenase-like protein 2 OS=Mus musculus GN=Hsdl2 PE=1 SV=1 457 601 2.0E-09
sp|Q9N126|RDH8_BOVIN Retinol dehydrogenase 8 OS=Bos taurus GN=RDH8 PE=1 SV=1 460 654 2.0E-09
sp|Q9P324|YI78_SCHPO Uncharacterized oxidoreductase C977.08/C1348.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.08 PE=3 SV=1 517 646 2.0E-09
sp|Q8N4T8|CBR4_HUMAN Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3 462 690 2.0E-09
sp|Q6P3L6|DH12A_DANRE Very-long-chain 3-oxoacyl-CoA reductase-A OS=Danio rerio GN=hsd17b12a PE=2 SV=1 461 652 2.0E-09
sp|P50205|PHBB_RHIME Acetoacetyl-CoA reductase OS=Rhizobium meliloti (strain 1021) GN=phbB PE=3 SV=1 462 653 2.0E-09
sp|P72220|BPHB_PSEPU Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas putida GN=bphB PE=3 SV=1 458 657 3.0E-09
sp|Q9URX0|YLX6_SCHPO Uncharacterized oxidoreductase C922.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.06 PE=3 SV=1 459 648 3.0E-09
sp|Q4X117|MKAR_ASPFU Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G11540 PE=3 SV=1 461 644 3.0E-09
sp|B0XSI3|MKAR_ASPFC Very-long-chain 3-oxoacyl-CoA reductase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_027290 PE=3 SV=1 461 644 3.0E-09
sp|P0A9P9|IDNO_ECOLI Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 459 665 4.0E-09
sp|P0A9Q0|IDNO_ECOL6 Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 459 665 4.0E-09
sp|Q02337|BDH_BOVIN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=BDH1 PE=1 SV=2 459 648 4.0E-09
sp|Q1WNP0|DHB1_PANTR Estradiol 17-beta-dehydrogenase 1 OS=Pan troglodytes GN=HSD17B1 PE=3 SV=3 459 685 4.0E-09
sp|Q99714|HCD2_HUMAN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens GN=HSD17B10 PE=1 SV=3 461 653 5.0E-09
sp|Q9ZW16|TRNHA_ARATH Tropinone reductase homolog At2g29330 OS=Arabidopsis thaliana GN=TRI PE=1 SV=1 455 652 5.0E-09
sp|Q02338|BDH_HUMAN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Homo sapiens GN=BDH1 PE=1 SV=3 459 648 5.0E-09
sp|Q9FYL6|KCR2_ARATH Very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470 OS=Arabidopsis thaliana GN=KCR2 PE=2 SV=1 455 653 5.0E-09
sp|P14061|DHB1_HUMAN Estradiol 17-beta-dehydrogenase 1 OS=Homo sapiens GN=HSD17B1 PE=1 SV=3 459 685 6.0E-09
sp|A5PJJ7|S16C6_BOVIN Short-chain dehydrogenase/reductase family 16C member 6 OS=Bos taurus GN=SDR16C6 PE=2 SV=1 459 703 7.0E-09
sp|Q9NUI1|DECR2_HUMAN Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens GN=DECR2 PE=1 SV=1 462 668 8.0E-09
sp|E3VWI6|PNTF_STRAE 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces arenae GN=pntF PE=3 SV=1 462 687 8.0E-09
sp|Q4V8F9|HSDL2_RAT Hydroxysteroid dehydrogenase-like protein 2 OS=Rattus norvegicus GN=Hsdl2 PE=2 SV=1 457 601 9.0E-09
sp|Q5BL28|DS7CB_DANRE Dehydrogenase/reductase SDR family member 7C-B OS=Danio rerio GN=dhrs7cb PE=2 SV=1 461 651 1.0E-08
sp|P47227|BPHB_BURXL Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=bphB PE=1 SV=1 458 657 1.0E-08
sp|P07914|BAIA1_CLOSV Bile acid 7-dehydroxylase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA1 PE=1 SV=3 462 652 1.0E-08
sp|Q6PAY8|HSDL2_XENLA Hydroxysteroid dehydrogenase-like protein 2 OS=Xenopus laevis GN=hsdl2 PE=2 SV=1 457 601 1.0E-08
sp|Q5RBV3|DECR2_PONAB Peroxisomal 2,4-dienoyl-CoA reductase OS=Pongo abelii GN=DECR2 PE=2 SV=1 462 668 1.0E-08
sp|O74470|YQC8_SCHPO Uncharacterized oxidoreductase C1739.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.08c PE=3 SV=1 459 668 1.0E-08
sp|H9BFQ0|TPRL1_ERYCB Tropinone reductase-like 1 OS=Erythroxylum coca PE=2 SV=1 458 685 1.0E-08
sp|Q5BE65|TSC10_EMENI 3-ketodihydrosphingosine reductase tsc10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tsc10 PE=3 SV=2 452 552 2.0E-08
sp|A9UM79|DRS7C_XENTR Dehydrogenase/reductase SDR family member 7C OS=Xenopus tropicalis GN=dhrs7c PE=2 SV=1 459 645 2.0E-08
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 62 292 2.0E-08
sp|P55575|Y4MP_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4mP OS=Rhizobium sp. (strain NGR234) GN=NGR_a02430 PE=3 SV=1 459 685 2.0E-08
sp|P51657|DHB1_RAT Estradiol 17-beta-dehydrogenase 1 OS=Rattus norvegicus GN=Hsd17b1 PE=1 SV=1 463 689 2.0E-08
sp|O42866|FABG_SCHPO 3-oxoacyl-[acyl-carrier-protein] reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oar2 PE=3 SV=1 465 687 2.0E-08
sp|P0AG84|YGHA_ECOLI Uncharacterized oxidoreductase YghA OS=Escherichia coli (strain K12) GN=yghA PE=1 SV=1 457 672 2.0E-08
sp|P0AG85|YGHA_ECO57 Uncharacterized oxidoreductase YghA OS=Escherichia coli O157:H7 GN=yghA PE=3 SV=1 457 672 2.0E-08
sp|Q1JP75|DCXR_BOVIN L-xylulose reductase OS=Bos taurus GN=DCXR PE=2 SV=1 458 650 2.0E-08
sp|Q9VXJ0|DHB4_DROME Peroxisomal multifunctional enzyme type 2 OS=Drosophila melanogaster GN=Mfe2 PE=1 SV=1 458 605 3.0E-08
sp|O02691|HCD2_BOVIN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Bos taurus GN=HSD17B10 PE=1 SV=3 461 653 3.0E-08
sp|Q8NK50|MTDH_HYPJE NADP-dependent mannitol dehydrogenase OS=Hypocrea jecorina GN=lxr1 PE=1 SV=1 459 652 3.0E-08
sp|Q59RQ2|TSC10_CANAL 3-ketodihydrosphingosine reductase TSC10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TSC10 PE=3 SV=1 459 650 3.0E-08
sp|Q9M1K9|ATA1_ARATH Short-chain dehydrogenase reductase ATA1 OS=Arabidopsis thaliana GN=TA1 PE=2 SV=1 458 653 3.0E-08
sp|Q5KTS5|GRDH_DAUCA Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 458 666 3.0E-08
sp|P47230|BPHB_RHOGO Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Rhodococcus globerulus GN=bphB PE=3 SV=1 458 648 4.0E-08
sp|O54939|DHB3_RAT Testosterone 17-beta-dehydrogenase 3 OS=Rattus norvegicus GN=Hsd17b3 PE=2 SV=1 458 650 4.0E-08
sp|Q9JIF5|PECR_CAVPO Peroxisomal trans-2-enoyl-CoA reductase OS=Cavia porcellus GN=PECR PE=1 SV=1 457 690 4.0E-08
sp|P71534|FABG_MYCS2 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabG PE=3 SV=2 450 652 4.0E-08
sp|P51656|DHB1_MOUSE Estradiol 17-beta-dehydrogenase 1 OS=Mus musculus GN=Hsd17b1 PE=2 SV=1 463 686 4.0E-08
sp|P0DKI3|TRNH1_ARATH Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1 448 668 4.0E-08
sp|Q56632|VIBA_VIBCH Vibriobactin-specific 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibA PE=3 SV=1 516 687 5.0E-08
sp|O08756|HCD2_MOUSE 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Mus musculus GN=Hsd17b10 PE=1 SV=4 459 665 5.0E-08
sp|Q6CE86|TSC10_YARLI 3-ketodihydrosphingosine reductase TSC10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TSC10 PE=3 SV=1 459 650 5.0E-08
sp|Q9T0G0|HSD5_ARATH 11-beta-hydroxysteroid dehydrogenase-like 5 OS=Arabidopsis thaliana GN=HSD5 PE=2 SV=1 459 635 5.0E-08
sp|Q9BUT1|BDH2_HUMAN 3-hydroxybutyrate dehydrogenase type 2 OS=Homo sapiens GN=BDH2 PE=1 SV=2 457 672 5.0E-08
sp|Q29529|CBR2_PIG Carbonyl reductase [NADPH] 2 OS=Sus scrofa GN=CBR2 PE=1 SV=1 456 687 6.0E-08
sp|P37058|DHB3_HUMAN Testosterone 17-beta-dehydrogenase 3 OS=Homo sapiens GN=HSD17B3 PE=1 SV=2 458 652 6.0E-08
sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=1 SV=2 433 657 7.0E-08
sp|A2RVM0|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic OS=Arabidopsis thaliana GN=TIC32 PE=2 SV=1 461 652 7.0E-08
sp|Q75A60|MKAR_ASHGO Very-long-chain 3-oxoacyl-CoA reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ADR059C PE=3 SV=2 447 653 7.0E-08
sp|A3LZU7|RM1DH_PICST L-rhamnose-1-dehydrogenase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHG2 PE=1 SV=2 457 685 9.0E-08
sp|Q9ZW14|TRNH8_ARATH Tropinone reductase homolog At2g29310 OS=Arabidopsis thaliana GN=At2g29310 PE=2 SV=1 455 688 9.0E-08
sp|P40397|YHXC_BACSU Uncharacterized oxidoreductase YhxC OS=Bacillus subtilis (strain 168) GN=yhxC PE=3 SV=2 441 666 1.0E-07
sp|O49332|TRNHE_ARATH Tropinone reductase homolog At2g30670 OS=Arabidopsis thaliana GN=At2g30670 PE=3 SV=1 455 652 1.0E-07
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 58 316 1.0E-07
sp|Q01198|LIGD_SPHPI C alpha-dehydrogenase OS=Sphingomonas paucimobilis GN=ligD PE=3 SV=1 462 694 1.0E-07
sp|Q10245|MKAR_SCHPO Very-long-chain 3-oxoacyl-CoA reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.15 PE=3 SV=1 457 640 1.0E-07
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 135 292 1.0E-07
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 62 292 1.0E-07
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 459 666 1.0E-07
sp|Q9C826|ABA2_ARATH Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN=ABA2 PE=1 SV=1 458 652 1.0E-07
sp|P33368|YOHF_ECOLI Uncharacterized oxidoreductase YohF OS=Escherichia coli (strain K12) GN=yohF PE=3 SV=2 462 669 1.0E-07
sp|Q4P622|MKAR_USTMA Very-long-chain 3-oxoacyl-CoA reductase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_04441 PE=3 SV=1 464 664 1.0E-07
sp|Q91VT4|CBR4_MOUSE Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2 462 690 1.0E-07
sp|Q22230|DECR_CAEEL Probable 2,4-dienoyl-CoA reductase 3 OS=Caenorhabditis elegans GN=decr-1.3 PE=3 SV=1 442 650 2.0E-07
sp|A3LXZ3|MKAR_PICST Very-long-chain 3-oxoacyl-CoA reductase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_79198 PE=3 SV=1 447 640 2.0E-07
sp|P39333|BDCA_ECOLI Cyclic-di-GMP-binding biofilm dispersal mediator protein OS=Escherichia coli (strain K12) GN=bdcA PE=1 SV=2 456 668 2.0E-07
sp|Q9S9W2|SDRA_ARATH Short-chain dehydrogenase/reductase SDRA OS=Arabidopsis thaliana GN=SDRA PE=1 SV=1 458 664 2.0E-07
sp|G0RNA2|LXR4_HYPJQ L-xylo-3-hexulose reductase OS=Hypocrea jecorina (strain QM6a) GN=lxr4 PE=1 SV=1 461 646 2.0E-07
sp|P37769|KDUD_ECOLI 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=kduD PE=1 SV=2 459 650 2.0E-07
sp|Q6QA33|DH12B_DANRE Very-long-chain 3-oxoacyl-CoA reductase-B OS=Danio rerio GN=hsd17b12b PE=2 SV=2 461 652 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7001
LAGSPTLDGHLAAVRAARDGHTAAVQADLPAVLRADCALPDDIRVDAGAVAERRLADADVVLLTGTTGYLGAFLL
RAILDRTAARVLCLVRFTEPSAGGDARPAGMARIRKNLVDLGIWDDSLLDRMEIVPGNLARNRLGLSPSAFDDLA
SRVQLIVHAAATVNLVYPYAALRNANVGGTREVLRLAARAGATVHHVSTNGVLPPSAAGAAGWAEDAVLDIDAVP
DKLADGYGQTKWVAEKLVCEAGRRGLPVRVYRPGTISGHSVTGSTNTYDLLNAIIVESLHLGFAPAVDGWRAEMT
PADFVSDAIVALASLPDPDPDRRVYHLGDPRPVTADAVFDNLAALGYPTEKLPWDEWVALWSERRGSRGTGGDDP
FTVDILRGGMPTVDALRCVTVLDDAATRPALDRCGLRRPAIDAALWETYARHFYARGWLPRPPRRLQQPDGILPS
AARAKQGRLAGKVAVVTGASSGMGAAVAAQLAAEGAHVVLAARRQDALEAVRAAIVRSRGTGGGGKILTRPTDVT
SREQVEALMRTTTETLGDIDILVVCAGVMYFTIMANAQADEWERTVDVNCKGLLHCLSSTVPGFVRRGRGHIVAI
SSDAGRKVFPGLGVYSGSKFFIEATLQALRLETAGSGLRVTSVQPGNVDTGLLGLSTDAEALKKYGEPTGAKVLD
ANDVASAIMFALLQPEHVAVNEVLIEPREEPI*
Coding >Hirsu2|7001
CTGGCCGGCAGCCCCACCCTCGACGGCCACCTGGCCGCCGTCCGCGCCGCCCGCGACGGCCACACCGCCGCCGTC
CAGGCCGACCTGCCCGCCGTGCTGCGCGCCGACTGCGCCCTGCCCGACGACATCCGCGTCGACGCCGGCGCCGTC
GCCGAGCGCCGCCTCGCCGACGCCGACGTCGTCCTGCTCACCGGCACCACCGGCTACCTCGGCGCCTTCCTGCTG
CGCGCCATCCTCGACCGCACCGCCGCCCGCGTCCTCTGCCTCGTCCGCTTCACCGAGCCGTCCGCCGGCGGCGAC
GCCCGGCCGGCCGGCATGGCCCGCATCCGCAAGAACCTCGTCGACCTCGGCATCTGGGACGACTCGCTGCTCGAC
CGCATGGAGATCGTGCCCGGCAACCTGGCCCGCAACCGGCTCGGCCTGTCGCCCTCGGCCTTCGACGACCTCGCC
TCGCGCGTCCAGCTCATCGTCCACGCCGCCGCCACCGTCAACCTCGTCTACCCGTACGCCGCCCTGCGCAACGCC
AACGTCGGCGGCACCCGCGAGGTCCTCCGCCTCGCCGCCCGCGCCGGCGCCACCGTCCACCACGTCTCCACCAAC
GGCGTCCTGCCGCCCTCGGCCGCCGGCGCCGCCGGCTGGGCCGAAGACGCCGTGCTCGACATCGACGCCGTGCCC
GACAAGCTGGCCGACGGCTACGGCCAGACCAAGTGGGTGGCCGAGAAGCTCGTCTGTGAGGCCGGCCGCCGCGGC
CTGCCCGTCCGCGTCTACCGCCCGGGCACCATCAGCGGCCACAGCGTCACCGGCTCGACCAACACCTACGACCTG
CTCAACGCCATCATCGTCGAGTCGCTGCACCTGGGCTTCGCCCCGGCCGTCGACGGCTGGCGCGCCGAGATGACG
CCGGCCGACTTCGTCAGCGACGCCATCGTCGCCCTCGCCAGCTTGCCGGACCCGGACCCGGACCGCCGCGTCTAC
CACCTCGGCGACCCCCGCCCCGTCACCGCCGACGCCGTCTTCGACAACCTCGCCGCCCTCGGCTACCCGACCGAG
AAGCTGCCGTGGGACGAGTGGGTGGCGCTGTGGAGCGAGAGGCGCGGCTCGCGCGGCACCGGCGGCGACGACCCC
TTCACCGTCGACATCCTGCGCGGCGGCATGCCCACCGTCGATGCCCTCCGCTGCGTCACCGTCCTCGACGACGCC
GCAACCCGCCCGGCCCTCGACCGCTGCGGCCTCCGCCGGCCCGCGATCGACGCGGCGCTGTGGGAGACGTACGCC
CGCCACTTCTACGCCCGGGGCTGGCTGCCGCGTCCGCCTCGCCGCCTGCAACAGCCCGACGGCATCCTCCCCTCC
GCCGCTCGGGCGAAGCAGGGCCGCCTCGCCGGCAAGGTCGCCGTCGTCACCGGCGCGTCGTCCGGCATGGGCGCC
GCCGTGGCCGCCCAGCTCGCCGCCGAGGGTGCCCACGTCGTGCTGGCCGCTCGCCGCCAGGACGCTCTCGAGGCG
GTGCGCGCCGCCATCGTCCGATCTCGCGGCACCGGCGGCGGCGGCAAGATCTTGACGCGGCCGACCGATGTCACG
AGCCGCGAGCAGGTCGAGGCGCTGATGCGGACGACGACGGAGACGCTGGGGGACATCGACATCCTCGTCGTCTGC
GCTGGCGTCATGTACTTCACCATCATGGCCAATGCCCAGGCCGACGAGTGGGAGCGCACAGTCGACGTCAACTGC
AAGGGCTTGCTGCACTGCCTTTCGTCCACGGTCCCGGGCTTCGTCCGCCGCGGCCGCGGCCACATCGTCGCCATC
TCCTCCGACGCCGGCCGCAAGGTCTTCCCGGGCCTCGGCGTCTATTCCGGCTCCAAGTTTTTCATCGAGGCCACC
CTGCAGGCCCTGCGCCTGGAGACGGCCGGCTCCGGCCTGCGCGTCACCTCGGTCCAGCCCGGCAATGTCGACACC
GGCCTGCTCGGCCTCTCGACCGATGCCGAGGCGCTCAAAAAGTATGGCGAGCCCACCGGAGCCAAGGTCCTCGAC
GCGAACGATGTCGCTTCCGCCATCATGTTTGCCCTGCTGCAACCCGAGCACGTGGCCGTCAACGAAGTCCTCATC
GAGCCTCGTGAGGAGCCTATCTAG
Transcript >Hirsu2|7001
CTGGCCGGCAGCCCCACCCTCGACGGCCACCTGGCCGCCGTCCGCGCCGCCCGCGACGGCCACACCGCCGCCGTC
CAGGCCGACCTGCCCGCCGTGCTGCGCGCCGACTGCGCCCTGCCCGACGACATCCGCGTCGACGCCGGCGCCGTC
GCCGAGCGCCGCCTCGCCGACGCCGACGTCGTCCTGCTCACCGGCACCACCGGCTACCTCGGCGCCTTCCTGCTG
CGCGCCATCCTCGACCGCACCGCCGCCCGCGTCCTCTGCCTCGTCCGCTTCACCGAGCCGTCCGCCGGCGGCGAC
GCCCGGCCGGCCGGCATGGCCCGCATCCGCAAGAACCTCGTCGACCTCGGCATCTGGGACGACTCGCTGCTCGAC
CGCATGGAGATCGTGCCCGGCAACCTGGCCCGCAACCGGCTCGGCCTGTCGCCCTCGGCCTTCGACGACCTCGCC
TCGCGCGTCCAGCTCATCGTCCACGCCGCCGCCACCGTCAACCTCGTCTACCCGTACGCCGCCCTGCGCAACGCC
AACGTCGGCGGCACCCGCGAGGTCCTCCGCCTCGCCGCCCGCGCCGGCGCCACCGTCCACCACGTCTCCACCAAC
GGCGTCCTGCCGCCCTCGGCCGCCGGCGCCGCCGGCTGGGCCGAAGACGCCGTGCTCGACATCGACGCCGTGCCC
GACAAGCTGGCCGACGGCTACGGCCAGACCAAGTGGGTGGCCGAGAAGCTCGTCTGTGAGGCCGGCCGCCGCGGC
CTGCCCGTCCGCGTCTACCGCCCGGGCACCATCAGCGGCCACAGCGTCACCGGCTCGACCAACACCTACGACCTG
CTCAACGCCATCATCGTCGAGTCGCTGCACCTGGGCTTCGCCCCGGCCGTCGACGGCTGGCGCGCCGAGATGACG
CCGGCCGACTTCGTCAGCGACGCCATCGTCGCCCTCGCCAGCTTGCCGGACCCGGACCCGGACCGCCGCGTCTAC
CACCTCGGCGACCCCCGCCCCGTCACCGCCGACGCCGTCTTCGACAACCTCGCCGCCCTCGGCTACCCGACCGAG
AAGCTGCCGTGGGACGAGTGGGTGGCGCTGTGGAGCGAGAGGCGCGGCTCGCGCGGCACCGGCGGCGACGACCCC
TTCACCGTCGACATCCTGCGCGGCGGCATGCCCACCGTCGATGCCCTCCGCTGCGTCACCGTCCTCGACGACGCC
GCAACCCGCCCGGCCCTCGACCGCTGCGGCCTCCGCCGGCCCGCGATCGACGCGGCGCTGTGGGAGACGTACGCC
CGCCACTTCTACGCCCGGGGCTGGCTGCCGCGTCCGCCTCGCCGCCTGCAACAGCCCGACGGCATCCTCCCCTCC
GCCGCTCGGGCGAAGCAGGGCCGCCTCGCCGGCAAGGTCGCCGTCGTCACCGGCGCGTCGTCCGGCATGGGCGCC
GCCGTGGCCGCCCAGCTCGCCGCCGAGGGTGCCCACGTCGTGCTGGCCGCTCGCCGCCAGGACGCTCTCGAGGCG
GTGCGCGCCGCCATCGTCCGATCTCGCGGCACCGGCGGCGGCGGCAAGATCTTGACGCGGCCGACCGATGTCACG
AGCCGCGAGCAGGTCGAGGCGCTGATGCGGACGACGACGGAGACGCTGGGGGACATCGACATCCTCGTCGTCTGC
GCTGGCGTCATGTACTTCACCATCATGGCCAATGCCCAGGCCGACGAGTGGGAGCGCACAGTCGACGTCAACTGC
AAGGGCTTGCTGCACTGCCTTTCGTCCACGGTCCCGGGCTTCGTCCGCCGCGGCCGCGGCCACATCGTCGCCATC
TCCTCCGACGCCGGCCGCAAGGTCTTCCCGGGCCTCGGCGTCTATTCCGGCTCCAAGTTTTTCATCGAGGCCACC
CTGCAGGCCCTGCGCCTGGAGACGGCCGGCTCCGGCCTGCGCGTCACCTCGGTCCAGCCCGGCAATGTCGACACC
GGCCTGCTCGGCCTCTCGACCGATGCCGAGGCGCTCAAAAAGTATGGCGAGCCCACCGGAGCCAAGGTCCTCGAC
GCGAACGATGTCGCTTCCGCCATCATGTTTGCCCTGCTGCAACCCGAGCACGTGGCCGTCAACGAAGTCCTCATC
GAGCCTCGTGAGGAGCCTATCTAG
Gene >Hirsu2|7001
CTGGCCGGCAGCCCCACCCTCGACGGCCACCTGGCCGCCGTCCGCGCCGCCCGCGACGGCCACACCGCCGCCGTC
CAGGCCGACCTGCCCGCCGTGCTGCGCGCCGACTGCGCCCTGCCCGACGACATCCGCGTCGACGCCGGCGCCGTC
GCCGAGCGCCGCCTCGCCGACGCCGACGTCGTCCTGCTCACCGGCACCACCGGCTACCTCGGCGCCTTCCTGCTG
CGCGCCATCCTCGACCGCACCGCCGCCCGCGTCCTCTGCCTCGTCCGCTTCACCGAGCCGTCCGCCGGCGGCGAC
GCCCGGCCGGCCGGCATGGCCCGCATCCGCAAGAACCTCGTCGACCTCGGCATCTGGGACGACTCGCTGCTCGAC
CGCATGGAGATCGTGCCCGGCAACCTGGCCCGCAACCGGCTCGGCCTGTCGCCCTCGGCCTTCGACGACCTCGCC
TCGCGCGTCCAGCTCATCGTCCACGCCGCCGCCACCGTCAACCTCGTCTACCCGTACGCCGCCCTGCGCAACGCC
AACGTCGGCGGCACCCGCGAGGTCCTCCGCCTCGCCGCCCGCGCCGGCGCCACCGTCCACCACGTCTCCACCAAC
GGCGTCCTGCCGCCCTCGGCCGCCGGCGCCGCCGGCTGGGCCGAAGACGCCGTGCTCGACATCGACGCCGTGCCC
GACAAGCTGGCCGACGGCTACGGCCAGACCAAGTGGGTGGCCGAGAAGCTCGTCTGTGAGGCCGGCCGCCGCGGC
CTGCCCGTCCGCGTCTACCGCCCGGGCACCATCAGCGGCCACAGCGTCACCGGCTCGACCAACACCTACGACCTG
CTCAACGCCATCATCGTCGAGTCGCTGCACCTGGGCTTCGCCCCGGCCGTCGACGGCTGGCGCGCCGAGATGACG
CCGGCCGACTTCGTCAGCGACGCCATCGTCGCCCTCGCCAGCTTGCCGGACCCGGACCCGGACCGCCGCGTCTAC
CACCTCGGCGACCCCCGCCCCGTCACCGCCGACGCCGTCTTCGACAACCTCGCCGCCCTCGGCTACCCGACCGAG
AAGCTGCCGTGGGACGAGTGGGTGGCGCTGTGGAGCGAGAGGCGCGGCTCGCGCGGCACCGGCGGCGACGACCCC
TTCACCGTCGACATCCTGCGCGGCGGCATGCCCACCGTCGATGCCCTCCGCTGCGTCACCGTCCTCGACGACGCC
GCAACCCGCCCGGCCCTCGACCGCTGCGGCCTCCGCCGGCCCGCGATCGACGCGGCGCTGTGGGAGACGTACGCC
CGCCACTTCTACGCCCGGGGCTGGCTGCCGCGTCCGCCTCGCCGCCTGCAACAGCCCGACGGCATCCTCCCCTCC
GCCGCTCGGGCGAAGCAGGGCCGCCTCGCCGGCAAGGTCGCCGTCGTCACCGGCGCGTCGTCCGGCATGGGCGCC
GCCGTGGCCGCCCAGCTCGCCGCCGAGGGTGCCCACGTCGTGCTGGCCGCTCGCCGCCAGGACGCTCTCGAGGCG
GTGCGCGCCGCCATCGTCCGATCTCGCGGCACCGGCGGCGGCGGCAAGATCTTGACGCGGCCGACCGATGTCACG
AGCCGCGAGCAGGTCGAGGCGCTGATGCGGACGACGACGGAGACGCTGGGGGACATCGACATCCTCGTCGTCTGC
GCTGGCGTCATGTACTTCACCATCATGGCCAATGCCCAGGCCGACGAGTGGGAGCGCACAGTCGACGTCAACTGC
AAGGGCTTGCTGCACTGCCTTTCGTCCACGGTCCCGGGCTTCGTCCGCCGCGGCCGCGGCCACATCGTCGCCATC
TCCTCCGACGCCGGCCGCAAGGTCTTCCCGGGCCTCGGCGTCTATTCCGGCTCCAAGTTTTTCATCGAGGCCACC
CTGCAGGCCCTGCGCCTGGAGACGGCCGGCTCCGGCCTGCGCGTCACCTCGGTCCAGCCCGGCAATGTCGACACC
GGCCTGCTCGGCCTCTCGACCGATGCCGAGGCGCTCAAAAAGTATGGCGAGCCCACCGGAGCCAAGGTCCTCGAC
GCGAACGATGTCGCTTCCGCCATCATGTTTGCCCTGCTGCAACCCGAGCACGTGGCCGTCAACGAAGTCCTCATC
GAGCCTCGTGAGGAGCCTATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail