Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|7000
Gene name
LocationContig_385:15861..18353
Strand+
Gene length (bp)2492
Transcript length (bp)2286
Coding sequence length (bp)2286
Protein length (aa) 762

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05183 RdRP RNA dependent RNA polymerase 3.6E-111 23 544

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LHH9|SHL2_ORYSJ Probable RNA-dependent RNA polymerase SHL2 OS=Oryza sativa subsp. japonica GN=SHL2 PE=2 SV=1 35 390 1.0E-24
sp|Q9LQV2|RDR1_ARATH RNA-dependent RNA polymerase 1 OS=Arabidopsis thaliana GN=RDR1 PE=2 SV=1 30 403 3.0E-24
sp|Q7XM31|RDR2_ORYSJ Probable RNA-dependent RNA polymerase 2 OS=Oryza sativa subsp. japonica GN=RDR2 PE=2 SV=1 68 398 1.0E-19
sp|Q9SG02|RDR6_ARATH RNA-dependent RNA polymerase 6 OS=Arabidopsis thaliana GN=RDR6 PE=1 SV=1 35 390 1.0E-18
sp|Q0DXS3|RDR1_ORYSJ Probable RNA-dependent RNA polymerase 1 OS=Oryza sativa subsp. japonica GN=RDR1 PE=2 SV=2 35 493 5.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8LHH9|SHL2_ORYSJ Probable RNA-dependent RNA polymerase SHL2 OS=Oryza sativa subsp. japonica GN=SHL2 PE=2 SV=1 35 390 1.0E-24
sp|Q9LQV2|RDR1_ARATH RNA-dependent RNA polymerase 1 OS=Arabidopsis thaliana GN=RDR1 PE=2 SV=1 30 403 3.0E-24
sp|Q7XM31|RDR2_ORYSJ Probable RNA-dependent RNA polymerase 2 OS=Oryza sativa subsp. japonica GN=RDR2 PE=2 SV=1 68 398 1.0E-19
sp|Q9SG02|RDR6_ARATH RNA-dependent RNA polymerase 6 OS=Arabidopsis thaliana GN=RDR6 PE=1 SV=1 35 390 1.0E-18
sp|Q0DXS3|RDR1_ORYSJ Probable RNA-dependent RNA polymerase 1 OS=Oryza sativa subsp. japonica GN=RDR1 PE=2 SV=2 35 493 5.0E-17
sp|O82504|RDR2_ARATH RNA-dependent RNA polymerase 2 OS=Arabidopsis thaliana GN=RDR2 PE=1 SV=1 68 398 3.0E-14
sp|O14227|RDR1_SCHPO RNA-dependent RNA polymerase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdr1 PE=1 SV=1 73 399 7.0E-11
sp|O82188|RDR5_ARATH Probable RNA-dependent RNA polymerase 5 OS=Arabidopsis thaliana GN=RDR5 PE=2 SV=2 242 394 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003968 RNA-directed 5'-3' RNA polymerase activity Yes
GO:0016740 transferase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097747 RNA polymerase activity No
GO:0003824 catalytic activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0034062 5'-3' RNA polymerase activity No
GO:0003674 molecular_function No
GO:0140098 catalytic activity, acting on RNA No
GO:0016779 nucleotidyltransferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4025 0.837 0.2331 0.0509 0.0647 0.0101 0.0271 0.056 0.0285 0.0011

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3623
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4865
Ophiocordyceps australis map64 (Brazil) OphauB2|262
Ophiocordyceps camponoti-floridani Ophcf2|07006
Ophiocordyceps camponoti-rufipedis Ophun1|672
Ophiocordyceps kimflemingae Ophio5|6681
Ophiocordyceps subramaniannii Hirsu2|7000 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|7000
MESVLRPERQKDESGGEEVEQPWALNIQQNHEEPVLKLFARLALSLSRTWATVQLEPDQMYHRERDTGTHKVMND
GVGQMSRRLASEIASCLGLTETPAGYQGRIGCAKGMWIVDVEDDGLDDDIWIETYPSQRKWACDWQDLEHRCFEV
KTWSRQAKPAALNQQFIPLLEAQAISPGQMRETIAEHMRRNLAEELGGQSAALGNPEDLRLWVDRVGQSRTLMPL
HRSIPLLGGLPATDEDLVGLLLDAGFDHLKLKILQGVLYDIGKKKADTLKAKTNVRIPQSTYLLMVADFTGTLEE
GEVQVSFSTKYKVDGFCDTLLEEMDVLVARSPAHLPSDIQRVRAMSYPRLRKLKDVVIFSTKGRTPLADLLSGGD
YDGDLAWVCWDRDIVNNFRNAPLLTAPDQISRNLFDRGYVKKLATKVGEILKEQRTVQAMCDKFVFSGFYFNMQQ
SHLGMITKYKEKLCYHRDSAGSDSAIQLSALLGLLVDQGKQGIIFSGKHWDKFRREVINGPPGLDDPEYFGERPT
NTPTKHGRRHILDYLKFQVAEQAVNDNLTMFQSAISSRGGQEYDADLTKMYNDYELRAENSETCRQLLKCLRADI
DAVKVMWQKVITKSDKEGESDYTTKVNEVYRKWMDIDPPEELQSSDLVQMLKEGWSRDPHSSPWALLKASATFRY
HHKVQSFTWRMAGMQLCYLKSKMAAKTLPAAIVQLGMWACLRADKKSIMARSAQRRESMREGESFAALDLDERME
DDGYGYEIDDT*
Coding >Hirsu2|7000
ATGGAAAGCGTTCTTCGTCCGGAGCGTCAAAAAGACGAGTCAGGCGGCGAAGAAGTTGAACAACCATGGGCATTG
AACATTCAACAAAACCACGAAGAGCCAGTCCTCAAGTTGTTCGCCCGACTTGCGCTGAGTTTGTCCCGAACGTGG
GCGACTGTGCAGCTGGAACCAGATCAAATGTATCACCGAGAAAGGGATACCGGCACCCACAAAGTCATGAACGAT
GGTGTCGGCCAAATGTCCCGGCGCCTGGCCAGCGAGATTGCTTCGTGCTTGGGGCTGACGGAGACACCAGCAGGT
TATCAAGGCCGAATTGGCTGTGCCAAGGGAATGTGGATCGTCGATGTCGAAGATGACGGCCTCGACGACGACATC
TGGATCGAAACGTATCCCTCTCAGAGGAAGTGGGCTTGTGACTGGCAGGATCTCGAGCATCGGTGCTTCGAAGTC
AAGACTTGGTCACGACAGGCAAAGCCAGCAGCACTGAACCAGCAGTTTATACCGCTGCTCGAGGCCCAGGCCATA
AGCCCCGGGCAAATGCGCGAGACAATCGCAGAACATATGAGAAGAAATCTCGCCGAGGAACTCGGCGGCCAGTCG
GCAGCATTGGGCAATCCAGAAGATCTGCGCCTGTGGGTGGATCGAGTCGGGCAGTCGAGAACTCTCATGCCGTTG
CACCGCAGCATCCCCCTTTTGGGCGGGCTTCCCGCAACCGACGAGGATCTTGTTGGCCTCCTGTTGGACGCGGGT
TTCGACCACCTGAAGCTCAAAATACTTCAGGGCGTCTTGTACGACATTGGCAAGAAGAAGGCCGATACTCTGAAA
GCAAAGACAAACGTGAGGATACCGCAGTCGACTTATCTCTTAATGGTGGCCGACTTCACCGGTACATTGGAAGAG
GGAGAAGTGCAGGTTTCGTTCTCGACCAAGTATAAAGTGGACGGATTCTGCGACACTCTTCTCGAAGAAATGGAT
GTCCTCGTGGCAAGATCGCCGGCCCATCTACCGAGCGACATCCAAAGAGTCAGGGCCATGTCATACCCTAGACTA
CGGAAGCTTAAGGATGTCGTCATCTTCTCGACGAAGGGCCGGACGCCACTGGCCGATCTGCTGTCGGGCGGTGAT
TATGATGGAGACCTGGCTTGGGTGTGCTGGGATCGCGATATCGTGAATAACTTTCGGAACGCTCCGCTGTTGACC
GCGCCCGATCAGATATCTCGCAACCTCTTCGATCGTGGCTACGTGAAGAAGCTGGCAACGAAGGTGGGCGAGATT
CTAAAAGAGCAGAGGACTGTCCAAGCGATGTGCGATAAGTTCGTGTTTTCCGGGTTCTACTTCAACATGCAGCAG
TCTCATCTCGGAATGATCACCAAATACAAGGAGAAGCTTTGCTACCACCGGGACTCGGCTGGCAGCGACTCGGCC
ATCCAACTGAGTGCCCTGCTTGGTCTCCTTGTGGATCAGGGCAAGCAGGGCATTATTTTCTCTGGCAAACACTGG
GACAAGTTTCGTCGGGAAGTCATCAATGGACCACCCGGCCTGGATGACCCGGAATATTTCGGAGAAAGGCCAACG
AACACGCCAACGAAGCATGGCAGACGGCATATCCTGGACTATCTGAAGTTCCAAGTGGCCGAACAGGCCGTCAAC
GACAACCTGACCATGTTCCAGAGCGCAATATCCTCACGTGGGGGGCAAGAGTACGACGCAGACTTGACGAAAATG
TATAATGACTATGAGCTGAGGGCAGAGAATTCTGAGACTTGTCGCCAGCTTCTGAAGTGTCTGCGCGCAGACATT
GACGCAGTGAAGGTGATGTGGCAAAAAGTGATAACGAAAAGCGACAAGGAAGGCGAGAGCGACTACACGACCAAG
GTGAACGAGGTTTATCGCAAGTGGATGGATATTGACCCTCCTGAAGAGCTGCAGTCGTCCGACCTTGTGCAAATG
CTCAAGGAAGGCTGGAGCAGAGACCCTCACTCGTCCCCGTGGGCCTTACTCAAAGCCTCGGCGACTTTCAGGTAT
CACCACAAGGTGCAATCTTTCACATGGCGAATGGCGGGCATGCAGCTATGCTACTTAAAGTCTAAAATGGCAGCA
AAGACGCTACCAGCGGCCATTGTGCAGCTGGGCATGTGGGCATGTCTCCGGGCGGACAAGAAGAGCATAATGGCC
CGCAGCGCGCAGCGACGAGAGTCTATGAGGGAGGGCGAAAGCTTCGCAGCACTTGACCTCGACGAGCGAATGGAG
GACGATGGGTATGGCTATGAGATTGATGATACCTGA
Transcript >Hirsu2|7000
ATGGAAAGCGTTCTTCGTCCGGAGCGTCAAAAAGACGAGTCAGGCGGCGAAGAAGTTGAACAACCATGGGCATTG
AACATTCAACAAAACCACGAAGAGCCAGTCCTCAAGTTGTTCGCCCGACTTGCGCTGAGTTTGTCCCGAACGTGG
GCGACTGTGCAGCTGGAACCAGATCAAATGTATCACCGAGAAAGGGATACCGGCACCCACAAAGTCATGAACGAT
GGTGTCGGCCAAATGTCCCGGCGCCTGGCCAGCGAGATTGCTTCGTGCTTGGGGCTGACGGAGACACCAGCAGGT
TATCAAGGCCGAATTGGCTGTGCCAAGGGAATGTGGATCGTCGATGTCGAAGATGACGGCCTCGACGACGACATC
TGGATCGAAACGTATCCCTCTCAGAGGAAGTGGGCTTGTGACTGGCAGGATCTCGAGCATCGGTGCTTCGAAGTC
AAGACTTGGTCACGACAGGCAAAGCCAGCAGCACTGAACCAGCAGTTTATACCGCTGCTCGAGGCCCAGGCCATA
AGCCCCGGGCAAATGCGCGAGACAATCGCAGAACATATGAGAAGAAATCTCGCCGAGGAACTCGGCGGCCAGTCG
GCAGCATTGGGCAATCCAGAAGATCTGCGCCTGTGGGTGGATCGAGTCGGGCAGTCGAGAACTCTCATGCCGTTG
CACCGCAGCATCCCCCTTTTGGGCGGGCTTCCCGCAACCGACGAGGATCTTGTTGGCCTCCTGTTGGACGCGGGT
TTCGACCACCTGAAGCTCAAAATACTTCAGGGCGTCTTGTACGACATTGGCAAGAAGAAGGCCGATACTCTGAAA
GCAAAGACAAACGTGAGGATACCGCAGTCGACTTATCTCTTAATGGTGGCCGACTTCACCGGTACATTGGAAGAG
GGAGAAGTGCAGGTTTCGTTCTCGACCAAGTATAAAGTGGACGGATTCTGCGACACTCTTCTCGAAGAAATGGAT
GTCCTCGTGGCAAGATCGCCGGCCCATCTACCGAGCGACATCCAAAGAGTCAGGGCCATGTCATACCCTAGACTA
CGGAAGCTTAAGGATGTCGTCATCTTCTCGACGAAGGGCCGGACGCCACTGGCCGATCTGCTGTCGGGCGGTGAT
TATGATGGAGACCTGGCTTGGGTGTGCTGGGATCGCGATATCGTGAATAACTTTCGGAACGCTCCGCTGTTGACC
GCGCCCGATCAGATATCTCGCAACCTCTTCGATCGTGGCTACGTGAAGAAGCTGGCAACGAAGGTGGGCGAGATT
CTAAAAGAGCAGAGGACTGTCCAAGCGATGTGCGATAAGTTCGTGTTTTCCGGGTTCTACTTCAACATGCAGCAG
TCTCATCTCGGAATGATCACCAAATACAAGGAGAAGCTTTGCTACCACCGGGACTCGGCTGGCAGCGACTCGGCC
ATCCAACTGAGTGCCCTGCTTGGTCTCCTTGTGGATCAGGGCAAGCAGGGCATTATTTTCTCTGGCAAACACTGG
GACAAGTTTCGTCGGGAAGTCATCAATGGACCACCCGGCCTGGATGACCCGGAATATTTCGGAGAAAGGCCAACG
AACACGCCAACGAAGCATGGCAGACGGCATATCCTGGACTATCTGAAGTTCCAAGTGGCCGAACAGGCCGTCAAC
GACAACCTGACCATGTTCCAGAGCGCAATATCCTCACGTGGGGGGCAAGAGTACGACGCAGACTTGACGAAAATG
TATAATGACTATGAGCTGAGGGCAGAGAATTCTGAGACTTGTCGCCAGCTTCTGAAGTGTCTGCGCGCAGACATT
GACGCAGTGAAGGTGATGTGGCAAAAAGTGATAACGAAAAGCGACAAGGAAGGCGAGAGCGACTACACGACCAAG
GTGAACGAGGTTTATCGCAAGTGGATGGATATTGACCCTCCTGAAGAGCTGCAGTCGTCCGACCTTGTGCAAATG
CTCAAGGAAGGCTGGAGCAGAGACCCTCACTCGTCCCCGTGGGCCTTACTCAAAGCCTCGGCGACTTTCAGGTAT
CACCACAAGGTGCAATCTTTCACATGGCGAATGGCGGGCATGCAGCTATGCTACTTAAAGTCTAAAATGGCAGCA
AAGACGCTACCAGCGGCCATTGTGCAGCTGGGCATGTGGGCATGTCTCCGGGCGGACAAGAAGAGCATAATGGCC
CGCAGCGCGCAGCGACGAGAGTCTATGAGGGAGGGCGAAAGCTTCGCAGCACTTGACCTCGACGAGCGAATGGAG
GACGATGGGTATGGCTATGAGATTGATGATACCTGA
Gene >Hirsu2|7000
ATGGAAAGCGTTCTTCGTCCGGAGCGTCAAAAAGACGAGTCAGGCGGCGAAGAAGTTGAACAACCAGTACTTTCA
AAGGGTTTATTTCTTCGCAACTGATGGCGACACCTTTCGGGTGCCGGCCTCTCGAGACAAAGTCCCGCCTGCCGC
CGAAGCTTCAACGCCTGGAACCCGTACCAAGTTCAGTCGCAGAGACTTCTTGCAGTGGGCATTGAACATTCAACA
AAACCACGAAGAGCCAGTCCTCAAGTTGTTCGCCCGACTTGCGCTGAGTAAGTCACCACCCGTTCAATGTCCAAT
GCCTCTCTGCAAGCTACGTGTACTCATGATCACTCCTAGGTTTGTCCCGAACGTGGGCGACTGTGCAGCTGGAAC
CAGATCAAATGTATCACCGAGAAAGGGATACCGGCACCCACAAAGTCATGAACGATGGTGTCGGCCAAATGTCCC
GGCGCCTGGCCAGCGAGATTGCTTCGTGCTTGGGGCTGACGGAGACACCAGCAGGTTATCAAGGCCGAATTGGCT
GTGCCAAGGGAATGTGGATCGTCGATGTCGAAGATGACGGCCTCGACGACGACATCTGGATCGAAACGTATCCCT
CTCAGAGGAAGTGGGCTTGTGACTGGCAGGATCTCGAGCATCGGTGCTTCGAAGTCAAGACTTGGTCACGACAGG
CAAAGCCAGCAGCACTGAACCAGCAGTTTATACCGCTGCTCGAGGCCCAGGCCATAAGCCCCGGGCAAATGCGCG
AGACAATCGCAGAACATATGAGAAGAAATCTCGCCGAGGAACTCGGCGGCCAGTCGGCAGCATTGGGCAATCCAG
AAGATCTGCGCCTGTGGGTGGATCGAGTCGGGCAGTCGAGAACTCTCATGCCGTTGCACCGCAGCATCCCCCTTT
TGGGCGGGCTTCCCGCAACCGACGAGGATCTTGTTGGCCTCCTGTTGGACGCGGGTTTCGACCACCTGAAGCTCA
AAATACTTCAGGGCGTCTTGTACGACATTGGCAAGAAGAAGGCCGATACTCTGAAAGCAAAGACAAACGTGAGGA
TACCGCAGTCGACTTATCTCTTAATGGTGGCCGACTTCACCGGTACATTGGAAGAGGGAGAAGTGCAGGTTTCGT
TCTCGACCAAGTATAAAGTGGACGGATTCTGCGACACTCTTCTCGAAGAAATGGATGTCCTCGTGGCAAGATCGC
CGGCCCATCTACCGAGCGACATCCAAAGAGTCAGGGCCATGTCATACCCTAGACTACGGAAGCTTAAGGATGTCG
TCATCTTCTCGACGAAGGGCCGGACGCCACTGGCCGATCTGCTGTCGGGCGGTGATTATGATGGAGACCTGGCTT
GGGTGTGCTGGGATCGCGATATCGTGAATAACTTTCGGAACGCTCCGCTGTTGACCGCGCCCGATCAGATATCTC
GCAACCTCTTCGATCGTGGCTACGTGAAGAAGCTGGCAACGAAGGTGGGCGAGATTCTAAAAGAGCAGAGGACTG
TCCAAGCGATGTGCGATAAGTTCGTGTTTTCCGGGTTCTACTTCAACATGCAGCAGTCTCATCTCGGAATGATCA
CCAAATACAAGGAGAAGCTTTGCTACCACCGGGACTCGGCTGGCAGCGACTCGGCCATCCAACTGAGTGCCCTGC
TTGGTCTCCTTGTGGATCAGGGCAAGCAGGGCATTATTTTCTCTGGCAAACACTGGGACAAGTTTCGTCGGGAAG
TCATCAATGGACCACCCGGCCTGGATGACCCGGAATATTTCGGAGAAAGGCCAACGAACACGCCAACGAAGCATG
GCAGACGGCATATCCTGGACTATCTGAAGTTCCAAGTGGCCGAACAGGCCGTCAACGACAACCTGACCATGTTCC
AGAGCGCAATATCCTCACGTGGGGGGCAAGAGTACGACGCAGACTTGACGAAAATGTATAATGACTATGAGCTGA
GGGCAGAGAATTCTGAGACTTGTCGCCAGCTTCTGAAGTGTCTGCGCGCAGACATTGACGCAGTGAAGGTGATGT
GGCAAAAAGTGATAACGAAAAGCGACAAGGAAGGCGAGAGCGACTACACGACCAAGGTGAACGAGGTTTATCGCA
AGTGGATGGATATTGACCCTCCTGAAGAGCTGCAGTCGTCCGACCTTGTGCAAATGCTCAAGGAAGGCTGGAGCA
GAGACCCTCACTCGTCCCCGTGGGCCTTACTCAAAGCCTCGGCGACTTTCAGGTATCACCACAAGGTGCAATCTT
TCACATGGCGAATGGCGGGCATGCAGCTATGCTACTTAAAGTCTAAAATGGCAGCAAAGACGCTACCAGCGGCCA
TTGTGCAGCTGGGCATGTGGGCATGTCTCCGGGCGGACAAGAAGAGCATAATGGCCCGCAGCGCGCAGCGACGAG
AGTCTATGAGGGAGGGCGAAAGCTTCGCAGCACTTGACCTCGACGAGCGAATGGAGGACGATGGGTATGGCTATG
AGATTGATGATACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail