Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|700
Gene name
LocationContig_1141:4015..5047
Strand-
Gene length (bp)1032
Transcript length (bp)1032
Coding sequence length (bp)1032
Protein length (aa) 344

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06413 Neugrin Neugrin 1.4E-08 203 261

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D1ZQ10|RRG9_SORMK Required for respiratory growth protein 9, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=RRG9 PE=3 SV=1 1 291 8.0E-47
sp|Q9P5T3|RRG9_NEUCR Required for respiratory growth protein 9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrg9 PE=3 SV=1 1 291 4.0E-45
sp|Q2GNN3|RRG9_CHAGB Required for respiratory growth protein 9, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRG9 PE=3 SV=1 183 301 9.0E-44
sp|A7EJ50|RRG9_SCLS1 Required for respiratory growth protein 9, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrg9 PE=3 SV=1 183 293 2.0E-36
sp|B2W722|RRG9_PYRTR Required for respiratory growth protein 9, mitochondrial OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=rrg9 PE=3 SV=1 153 293 1.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D1ZQ10|RRG9_SORMK Required for respiratory growth protein 9, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=RRG9 PE=3 SV=1 1 291 8.0E-47
sp|Q9P5T3|RRG9_NEUCR Required for respiratory growth protein 9, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrg9 PE=3 SV=1 1 291 4.0E-45
sp|Q2GNN3|RRG9_CHAGB Required for respiratory growth protein 9, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRG9 PE=3 SV=1 183 301 9.0E-44
sp|A7EJ50|RRG9_SCLS1 Required for respiratory growth protein 9, mitochondrial OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrg9 PE=3 SV=1 183 293 2.0E-36
sp|B2W722|RRG9_PYRTR Required for respiratory growth protein 9, mitochondrial OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=rrg9 PE=3 SV=1 153 293 1.0E-33
sp|Q0TY47|RRG9_PHANO Required for respiratory growth protein 9, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRG9 PE=3 SV=1 185 307 1.0E-33
sp|E3REX1|RRG9_PYRTT Required for respiratory growth protein 9, mitochondrial OS=Pyrenophora teres f. teres (strain 0-1) GN=rrg9 PE=3 SV=1 185 293 1.0E-32
sp|Q2UF33|RRG9_ASPOR Required for respiratory growth protein 9, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrg9 PE=3 SV=1 28 285 2.0E-31
sp|B8NHF2|RRG9_ASPFN Required for respiratory growth protein 9, mitochondrial OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=rrg9 PE=3 SV=1 28 285 2.0E-31
sp|Q0CYR5|RRG9_ASPTN Required for respiratory growth protein 9, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrg9 PE=3 SV=1 148 302 1.0E-30
sp|Q5AZJ0|RRG9_EMENI Required for respiratory growth protein 9, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrg9 PE=3 SV=1 174 282 9.0E-29
sp|A2QCR5|RRG9_ASPNC Required for respiratory growth protein 9, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrg9 PE=3 SV=1 184 285 6.0E-28
sp|B6HDT2|RRG9_PENRW Required for respiratory growth protein 9, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=rrg9 PE=3 SV=1 151 282 3.0E-27
sp|C4JXN2|RRG9_UNCRE Required for respiratory growth protein 9, mitochondrial OS=Uncinocarpus reesii (strain UAMH 1704) GN=RRG9 PE=3 SV=1 183 284 2.0E-26
sp|C5JS82|RRG9_AJEDS Required for respiratory growth protein 9, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=RRG9 PE=3 SV=1 184 284 2.0E-25
sp|C5GEF3|RRG9_AJEDR Required for respiratory growth protein 9, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=RRG9 PE=3 SV=1 184 284 2.0E-25
sp|E4UQC3|RRG9_ARTGP Required for respiratory growth protein 9, mitochondrial OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=RRG9 PE=3 SV=1 185 308 7.0E-24
sp|A1C6R8|RRG9_ASPCL Required for respiratory growth protein 9, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrg9 PE=3 SV=1 183 282 2.0E-23
sp|D4DHC4|RRG9_TRIVH Required for respiratory growth protein 9, mitochondrial OS=Trichophyton verrucosum (strain HKI 0517) GN=RRG9 PE=3 SV=1 185 281 4.0E-23
sp|C5PBQ8|RRG9_COCP7 Required for respiratory growth protein 9, mitochondrial OS=Coccidioides posadasii (strain C735) GN=RRG9 PE=3 SV=1 184 285 4.0E-23
sp|D4AKN8|RRG9_ARTBC Required for respiratory growth protein 9, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=RRG9 PE=3 SV=1 185 281 7.0E-23
sp|C0SC25|RRG9_PARBP Required for respiratory growth protein 9, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb03) GN=RRG9 PE=3 SV=2 184 284 7.0E-23
sp|C1GIF2|RRG9_PARBD Required for respiratory growth protein 9, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=RRG9 PE=3 SV=1 184 284 7.0E-23
sp|C5FNG9|RRG9_ARTOC Required for respiratory growth protein 9, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=RRG9 PE=3 SV=1 185 281 1.0E-22
sp|B0XSW5|RRG9_ASPFC Required for respiratory growth protein 9, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=rrg9 PE=3 SV=1 184 285 1.0E-21
sp|A1DHD8|RRG9_NEOFI Required for respiratory growth protein 9, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrg9 PE=3 SV=1 184 285 1.0E-21
sp|Q4X0T4|RRG9_ASPFU Required for respiratory growth protein 9, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrg9 PE=3 SV=1 184 285 1.0E-21
sp|B8MLF7|RRG9_TALSN Required for respiratory growth protein 9, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=rrg9 PE=3 SV=1 178 284 4.0E-21
sp|B6QGW6|RRG9_TALMQ Required for respiratory growth protein 9, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=rrg9 PE=3 SV=1 186 281 8.0E-20
sp|Q75E45|RRG9_ASHGO Required for respiratory growth protein 9, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRG9 PE=3 SV=1 169 294 1.0E-15
sp|E3L408|RRG9_PUCGT Required for respiratory growth protein 9, mitochondrial OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=RRG9 PE=3 SV=2 183 262 3.0E-15
sp|A7TIC4|RRG9_VANPO Required for respiratory growth protein 9, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRG9 PE=3 SV=1 186 271 1.0E-14
sp|C4R331|RRG9_PICPG Required for respiratory growth protein 9, mitochondrial OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=RRG9 PE=3 SV=1 201 270 7.0E-13
sp|Q6FMV8|RRG9_CANGA Required for respiratory growth protein 9, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRG9 PE=3 SV=1 186 279 9.0E-13
sp|C5DD31|RRG9_LACTC Required for respiratory growth protein 9, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=RRG9 PE=3 SV=1 186 271 2.0E-12
sp|C5DTR1|RRG9_ZYGRC Required for respiratory growth protein 9, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=RRG9 PE=3 SV=1 185 268 2.0E-12
sp|P40156|RRG9_YEAST Required for respiratory growth protein 9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRG9 PE=1 SV=1 186 273 4.0E-12
sp|C8ZG19|RRG9_YEAS8 Required for respiratory growth protein 9, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=RRG9 PE=3 SV=1 186 273 4.0E-12
sp|A6ZRM7|RRG9_YEAS7 Required for respiratory growth protein 9, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=RRG9 PE=3 SV=1 186 273 4.0E-12
sp|B5VQJ9|RRG9_YEAS6 Required for respiratory growth protein 9, mitochondrial OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RRG9 PE=3 SV=1 186 273 4.0E-12
sp|C7GPE4|RRG9_YEAS2 Required for respiratory growth protein 9, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=RRG9 PE=3 SV=1 186 273 4.0E-12
sp|B3LP57|RRG9_YEAS1 Required for respiratory growth protein 9, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RRG9 PE=3 SV=1 186 273 4.0E-12
sp|Q6CQ76|RRG9_KLULA Required for respiratory growth protein 9, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRG9 PE=3 SV=1 186 273 2.0E-11
sp|A5DKF1|RRG9_PICGU Required for respiratory growth protein 9, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRG9 PE=3 SV=2 200 257 4.0E-08
sp|A3LTV8|RRG9_PICST Required for respiratory growth protein 9, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRG9 PE=3 SV=2 201 275 6.0E-07
sp|Q6BUM6|RRG9_DEBHA Required for respiratory growth protein 9, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRG9 PE=3 SV=1 186 278 6.0E-07
sp|A5DZ02|RRG9_LODEL Required for respiratory growth protein 9, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRG9 PE=3 SV=1 201 263 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|700
MSCACRILPWSIFVQGLARVHGLEPTSARAAVLAAPTIPRATARGRSLEAPWQRRGFHRTERRPDSGPDTSAVEK
QSVSSEAPEPPASSPQLPPAPIEAAEASLERPRKRAQSRAERREQDSEADAQRRPTSPEQVSEADAQQAVPGRSS
KAPRKAKTKASRLDAAEDGGGPDEPPREKFNMKEAWRVHKDRIKEKFPEGWKPRKRLSPDALAGIRALNAQFPDV
YTTSALATKFKMDPEAIRRVLKSSWQPTAEQEQERQERWHRRGMQVWERKAELGIKPPRKWRKEGIARDPSYHER
RKWASQREKEWEEEEIRKYREERRARLGGGKAAAGEAPSGEKP*
Coding >Hirsu2|700
ATGAGCTGCGCATGCCGCATCTTGCCATGGAGCATCTTCGTTCAAGGCCTGGCTCGGGTTCACGGCCTTGAACCG
ACATCCGCGCGAGCCGCCGTCCTCGCCGCCCCGACCATCCCTCGAGCGACTGCCCGAGGCCGGTCCCTGGAGGCG
CCGTGGCAGCGGCGAGGCTTCCATCGGACCGAGCGTCGACCCGATTCAGGGCCGGACACCAGCGCGGTCGAGAAG
CAGAGCGTGTCGTCGGAGGCACCCGAGCCTCCCGCCTCGTCCCCACAACTGCCGCCGGCGCCGATCGAAGCCGCC
GAGGCCTCGCTGGAAAGGCCGCGGAAGAGGGCGCAAAGCCGAGCCGAACGGCGCGAGCAGGACTCCGAGGCGGAT
GCGCAACGCCGTCCCACATCGCCCGAGCAGGTCTCCGAGGCAGATGCGCAGCAGGCGGTGCCGGGACGAAGCTCC
AAGGCGCCCCGCAAAGCGAAGACGAAGGCGTCTCGGCTAGACGCGGCCGAGGACGGCGGCGGCCCCGACGAGCCG
CCGCGGGAAAAGTTCAACATGAAGGAGGCGTGGCGGGTGCACAAGGATCGGATCAAGGAAAAGTTCCCGGAGGGG
TGGAAGCCGCGCAAGCGCCTGTCGCCGGATGCACTGGCGGGCATCCGCGCCCTCAACGCGCAGTTCCCGGACGTC
TACACGACGTCGGCGCTGGCCACCAAGTTCAAGATGGACCCCGAGGCCATCCGGCGCGTCCTCAAGAGCAGCTGG
CAGCCGACGGCGGAGCAGGAGCAGGAGAGGCAGGAGAGGTGGCACCGCCGGGGCATGCAGGTCTGGGAGCGCAAG
GCGGAACTGGGCATCAAGCCGCCGAGGAAGTGGCGCAAGGAGGGCATCGCGCGCGACCCGAGCTACCACGAGCGG
AGAAAGTGGGCGTCGCAGCGGGAGAAGGAGTGGGAGGAGGAGGAGATTCGCAAGTATCGGGAGGAGCGGCGGGCG
AGGCTGGGCGGCGGCAAGGCGGCGGCCGGAGAGGCGCCGAGCGGAGAGAAGCCGTAA
Transcript >Hirsu2|700
ATGAGCTGCGCATGCCGCATCTTGCCATGGAGCATCTTCGTTCAAGGCCTGGCTCGGGTTCACGGCCTTGAACCG
ACATCCGCGCGAGCCGCCGTCCTCGCCGCCCCGACCATCCCTCGAGCGACTGCCCGAGGCCGGTCCCTGGAGGCG
CCGTGGCAGCGGCGAGGCTTCCATCGGACCGAGCGTCGACCCGATTCAGGGCCGGACACCAGCGCGGTCGAGAAG
CAGAGCGTGTCGTCGGAGGCACCCGAGCCTCCCGCCTCGTCCCCACAACTGCCGCCGGCGCCGATCGAAGCCGCC
GAGGCCTCGCTGGAAAGGCCGCGGAAGAGGGCGCAAAGCCGAGCCGAACGGCGCGAGCAGGACTCCGAGGCGGAT
GCGCAACGCCGTCCCACATCGCCCGAGCAGGTCTCCGAGGCAGATGCGCAGCAGGCGGTGCCGGGACGAAGCTCC
AAGGCGCCCCGCAAAGCGAAGACGAAGGCGTCTCGGCTAGACGCGGCCGAGGACGGCGGCGGCCCCGACGAGCCG
CCGCGGGAAAAGTTCAACATGAAGGAGGCGTGGCGGGTGCACAAGGATCGGATCAAGGAAAAGTTCCCGGAGGGG
TGGAAGCCGCGCAAGCGCCTGTCGCCGGATGCACTGGCGGGCATCCGCGCCCTCAACGCGCAGTTCCCGGACGTC
TACACGACGTCGGCGCTGGCCACCAAGTTCAAGATGGACCCCGAGGCCATCCGGCGCGTCCTCAAGAGCAGCTGG
CAGCCGACGGCGGAGCAGGAGCAGGAGAGGCAGGAGAGGTGGCACCGCCGGGGCATGCAGGTCTGGGAGCGCAAG
GCGGAACTGGGCATCAAGCCGCCGAGGAAGTGGCGCAAGGAGGGCATCGCGCGCGACCCGAGCTACCACGAGCGG
AGAAAGTGGGCGTCGCAGCGGGAGAAGGAGTGGGAGGAGGAGGAGATTCGCAAGTATCGGGAGGAGCGGCGGGCG
AGGCTGGGCGGCGGCAAGGCGGCGGCCGGAGAGGCGCCGAGCGGAGAGAAGCCGTAA
Gene >Hirsu2|700
ATGAGCTGCGCATGCCGCATCTTGCCATGGAGCATCTTCGTTCAAGGCCTGGCTCGGGTTCACGGCCTTGAACCG
ACATCCGCGCGAGCCGCCGTCCTCGCCGCCCCGACCATCCCTCGAGCGACTGCCCGAGGCCGGTCCCTGGAGGCG
CCGTGGCAGCGGCGAGGCTTCCATCGGACCGAGCGTCGACCCGATTCAGGGCCGGACACCAGCGCGGTCGAGAAG
CAGAGCGTGTCGTCGGAGGCACCCGAGCCTCCCGCCTCGTCCCCACAACTGCCGCCGGCGCCGATCGAAGCCGCC
GAGGCCTCGCTGGAAAGGCCGCGGAAGAGGGCGCAAAGCCGAGCCGAACGGCGCGAGCAGGACTCCGAGGCGGAT
GCGCAACGCCGTCCCACATCGCCCGAGCAGGTCTCCGAGGCAGATGCGCAGCAGGCGGTGCCGGGACGAAGCTCC
AAGGCGCCCCGCAAAGCGAAGACGAAGGCGTCTCGGCTAGACGCGGCCGAGGACGGCGGCGGCCCCGACGAGCCG
CCGCGGGAAAAGTTCAACATGAAGGAGGCGTGGCGGGTGCACAAGGATCGGATCAAGGAAAAGTTCCCGGAGGGG
TGGAAGCCGCGCAAGCGCCTGTCGCCGGATGCACTGGCGGGCATCCGCGCCCTCAACGCGCAGTTCCCGGACGTC
TACACGACGTCGGCGCTGGCCACCAAGTTCAAGATGGACCCCGAGGCCATCCGGCGCGTCCTCAAGAGCAGCTGG
CAGCCGACGGCGGAGCAGGAGCAGGAGAGGCAGGAGAGGTGGCACCGCCGGGGCATGCAGGTCTGGGAGCGCAAG
GCGGAACTGGGCATCAAGCCGCCGAGGAAGTGGCGCAAGGAGGGCATCGCGCGCGACCCGAGCTACCACGAGCGG
AGAAAGTGGGCGTCGCAGCGGGAGAAGGAGTGGGAGGAGGAGGAGATTCGCAAGTATCGGGAGGAGCGGCGGGCG
AGGCTGGGCGGCGGCAAGGCGGCGGCCGGAGAGGCGCCGAGCGGAGAGAAGCCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail