Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6991
Gene name
LocationContig_384:14827..19688
Strand+
Gene length (bp)4861
Transcript length (bp)4638
Coding sequence length (bp)4638
Protein length (aa) 1546

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 3.3E-77 1114 1363
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 1.3E-18 115 164
PF13246 Cation_ATPase Cation transport ATPase (P-type) 8.8E-14 757 843
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 7.8E-08 630 996

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 94 1389 0.0E+00
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 94 1378 0.0E+00
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 94 1374 0.0E+00
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 82 1372 0.0E+00
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 304 1371 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 94 1389 0.0E+00
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 94 1378 0.0E+00
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 94 1374 0.0E+00
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 82 1372 0.0E+00
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 304 1371 0.0E+00
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 311 1374 0.0E+00
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 355 1374 0.0E+00
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 351 1374 0.0E+00
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 311 1363 0.0E+00
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 355 1370 0.0E+00
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 351 1374 0.0E+00
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 353 1374 0.0E+00
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 355 1370 0.0E+00
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 360 1377 0.0E+00
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 360 1377 0.0E+00
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 353 1367 0.0E+00
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 360 1377 0.0E+00
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 355 1363 0.0E+00
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 328 1371 0.0E+00
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 355 1363 0.0E+00
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 360 1356 0.0E+00
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 351 1374 0.0E+00
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 355 1377 0.0E+00
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 359 1356 0.0E+00
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 311 1374 0.0E+00
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 355 1371 0.0E+00
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 360 1356 0.0E+00
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 355 1371 0.0E+00
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 354 1378 0.0E+00
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 323 1367 0.0E+00
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 340 1331 0.0E+00
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 352 1375 5.0E-180
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 361 1349 2.0E-177
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 361 1349 9.0E-171
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 360 1363 1.0E-169
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 351 1363 2.0E-163
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 351 1381 2.0E-161
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 354 1360 1.0E-156
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 354 1360 2.0E-155
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 751 1409 1.0E-136
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 758 1358 5.0E-134
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 759 1409 9.0E-134
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 750 1366 2.0E-130
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 750 1402 2.0E-129
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 760 1360 7.0E-127
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 362 1363 4.0E-101
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 362 1363 2.0E-100
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 363 1363 7.0E-99
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 363 1363 1.0E-98
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 363 1363 7.0E-98
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 674 1376 3.0E-97
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 363 1363 2.0E-96
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 363 1363 3.0E-96
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 361 1363 3.0E-96
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 359 1249 3.0E-94
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 835 1396 2.0E-79
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 855 1374 2.0E-73
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 361 844 9.0E-66
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 321 657 2.0E-63
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 321 657 9.0E-63
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 360 659 6.0E-60
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 360 657 1.0E-59
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 321 766 3.0E-59
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 360 657 4.0E-45
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 361 665 2.0E-37
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 738 847 8.0E-19
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 805 1161 2.0E-18
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 119 199 1.0E-16
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 115 199 1.0E-16
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 115 199 2.0E-16
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 119 199 1.0E-14
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 74 215 4.0E-14
sp|O74431|ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 804 1114 9.0E-14
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 73 234 2.0E-13
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 794 1150 2.0E-13
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 116 207 3.0E-13
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 116 207 4.0E-13
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 73 215 1.0E-12
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 73 215 1.0E-12
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 86 218 1.0E-12
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 86 218 1.0E-12
sp|Q27533|YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans GN=W08D2.5 PE=3 SV=2 801 1191 2.0E-12
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 766 1000 4.0E-12
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 116 201 5.0E-12
sp|Q6Q477|AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 794 989 5.0E-12
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 114 213 9.0E-12
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 116 202 1.0E-11
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 717 1114 1.0E-11
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 92 225 2.0E-11
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 83 213 2.0E-11
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 119 215 2.0E-11
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 113 204 2.0E-11
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 116 204 2.0E-11
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 111 213 2.0E-11
sp|Q12697|YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK9 PE=1 SV=1 615 1114 2.0E-11
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 798 1150 3.0E-11
sp|Q9R0K7|AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 796 987 3.0E-11
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 804 1110 3.0E-11
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 798 987 3.0E-11
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 803 987 3.0E-11
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 796 983 4.0E-11
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 803 968 5.0E-11
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 741 1114 7.0E-11
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 119 228 8.0E-11
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 88 225 8.0E-11
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 67 213 9.0E-11
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 116 231 9.0E-11
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 796 987 9.0E-11
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 116 218 2.0E-10
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 794 966 2.0E-10
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 103 232 3.0E-10
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 115 204 4.0E-10
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 119 202 8.0E-10
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 72 213 1.0E-09
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 741 1114 1.0E-09
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 85 215 2.0E-09
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 766 971 2.0E-09
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 85 198 3.0E-09
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 116 205 5.0E-09
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 794 1150 5.0E-09
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 794 1150 5.0E-09
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 116 213 7.0E-09
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 109 215 9.0E-09
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 116 215 1.0E-08
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 794 1150 1.0E-08
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 794 1150 1.0E-08
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 796 989 1.0E-08
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 804 1110 2.0E-08
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 798 964 3.0E-08
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 114 213 4.0E-08
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 742 1043 6.0E-08
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 114 213 1.0E-07
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 116 208 2.0E-07
sp|P39986|ATC6_YEAST Manganese-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPF1 PE=1 SV=1 804 1105 2.0E-07
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 804 1114 2.0E-07
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 794 989 3.0E-07
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 110 218 4.0E-07
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 110 218 4.0E-07
sp|O14022|CTA5_SCHPO Cation-transporting ATPase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta5 PE=3 SV=1 797 1114 4.0E-07
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 810 986 5.0E-07
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 810 968 7.0E-07
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 85 200 1.0E-06
sp|Q9LT02|PDR2_ARATH Probable manganese-transporting ATPase PDR2 OS=Arabidopsis thaliana GN=PDR2 PE=1 SV=1 797 1105 1.0E-06
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 810 980 2.0E-06
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 810 968 3.0E-06
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 116 199 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 146 180 34
2 521 543 22
3 567 589 22
4 1149 1166 17
5 1176 1198 22
6 1229 1251 22
7 1266 1288 22
8 1295 1317 22
9 1327 1349 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6991
MSSPPRAPLEPGPDQKIEHTQRARWATRKLTVRSGRIKRLSLLNRGQHRRAGSNEKDSGQGDPNEPPLADLPDGG
ESHDIVSDSGDSQDDSTNRTLYFNLPLPDDLLEDGHPIYSFPRNKIRTAKYTPLSFVPKNLWFQFHNVANIFFLF
LVILVIFPIFGGVNPGLNAVPLIFIIVVTAIKDAIEDYRRTILDIELNNAPVHRLHHWNNVNVEEDNVSSWRRFK
KANSTFFGSIWRAIESLWSKKARTARAERKERKLNPPGEEEGRPSVETVRTRRSMREALASPFNRDSFMSANDEI
REEIQMTPVPSPTPPNNAPRIVLPDDSQDVKRAAAVQSMKSDLINYQRGPQGARFKKDAWKSLQVGDFVRIYNDD
ELPADVIILSTSDPDGACYVETKNLDGETNLKVRQALRCGRSLKHARDCERAEFRIESEPPQPNLYKYNGAIRWE
QPVPGYADDDPEEMTEPITIDNLLLRGCNLRNTEWVLGVVIFTGHETKIMMNAGITPSKRARIAREMNFNVICNF
GILLIMCLLSAIVNGVAWARTDASLHFFEFGAIGGSAPVSGFITFWAAIIVFQNLVPISLYITLEIVRTLQAIFI
FSDVEMYYEKIDQPCIPKSWNISDDVGQIEYIFSDKTGTLTQNVMEFKKATINGQPYGEAFTEAQAGMQKRMGVD
IETEGARIRAEIAEAKVRALGGLRKINKNPYLHDDDVTFIAPDFVSDLAGDSGPEQKAANAEFMLALALCHTVIA
ERTPGDPPKMNFKAQSPDEEALVATARDMGFTVLGNSGDGINLNVMGEERHYQILNTIEFNSSRKRMSSIVRMPN
GQIVLYCKGADSVIYARLKRGEQQQLRRETAEHLEMFAREGLRTLCIASKVLTEREYKVWKKEHDAAAAALEHRE
EKLEEVAELIEQDLLLLGGTAIEDRLQDGVPDTIALLGQAGIKLWVLTGDKVETAINIGFSCNLLNNDMELIHLK
VDEDESGETSDDSFLETVGKLLDQHLATFGIAGNDEDLALAKKNHEPPAPTHGLVIDGFTLRWALHDALKQKFLL
LCKQCKSVLCCRVSPAQKAAVVAMVKNGLDVMTLSIGDGANDVAMIQEADVGVGIAGVEGRQAAMSSDYAIAQFR
FLQRLVLVHGRWSYRRLAESISNFFYKNMVWTFSIFWFEIFCDFDITYLFDYTYILMFNLFFTSLPVGIMGVLDQ
DVSDKVSLAVPELYRRGIERLEWTQRKFWLYMIDGVYQSVMVFFIPYLLFIHGRSVSFSGLGLEDRLRFGAYVAH
PAVLTINGYILINTYRWDWLMVLIVVISDLFIFFWTGVYTSFTGSDFFYKAAAQVYGEASFWAIFFIVPIICLFP
RFAIKSLQKVYWPYDVDIIREQEKMGQFAYLNAAAGPEEIKVKSNDEKSQKSSESANKTQHVAYGSVDEDLRPIY
PPSTATRTTHNHTQHGSDSTNYTANRMSIEVAPVNRLSSDAPAHTRPSIDRARPSIDRARPSYDRMRMSMDRCRP
SYEASSDFTTAARLTRIESSQTGAAQGIKARLRGLSLSKNANNQS*
Coding >Hirsu2|6991
ATGTCCTCCCCCCCCCGCGCGCCACTCGAGCCCGGCCCCGACCAGAAGATCGAGCACACGCAGAGGGCACGCTGG
GCCACCCGCAAGCTGACCGTCAGGAGCGGCCGCATCAAGCGCCTGTCGCTCCTCAACCGCGGCCAGCACCGGCGC
GCCGGCTCCAACGAGAAGGACTCGGGCCAAGGCGACCCCAACGAACCGCCCTTGGCCGACCTCCCCGACGGCGGC
GAGAGCCATGACATCGTGTCCGACTCGGGCGATTCGCAAGACGACAGCACCAACCGCACCCTCTACTTCAACCTC
CCCCTGCCCGACGACTTGCTCGAAGACGGCCACCCCATATACTCCTTTCCTCGGAACAAGATCAGGACAGCAAAG
TACACGCCGCTCTCCTTCGTCCCCAAGAACCTGTGGTTCCAGTTCCACAATGTCGCCAACATCTTCTTCCTCTTT
CTCGTCATTCTTGTCATATTCCCCATCTTCGGCGGCGTCAACCCCGGGCTCAATGCCGTCCCCCTCATCTTCATC
ATCGTCGTCACCGCCATCAAAGACGCCATCGAGGACTACCGCCGAACCATACTCGACATCGAGCTCAACAACGCT
CCCGTGCACCGCCTGCACCACTGGAACAATGTCAACGTCGAGGAGGACAACGTGTCTTCGTGGAGGAGGTTCAAG
AAGGCAAACTCCACCTTCTTCGGCTCCATCTGGCGCGCCATCGAGAGCCTGTGGTCCAAGAAGGCCCGGACGGCT
CGCGCCGAGCGCAAGGAACGCAAGCTGAACCCGCCCGGCGAAGAAGAGGGCCGACCCTCGGTAGAGACGGTGCGC
ACCAGGCGCTCGATGCGAGAGGCGCTCGCCTCGCCCTTCAACCGCGACTCCTTCATGTCGGCCAATGACGAGATC
CGCGAAGAGATCCAGATGACGCCCGTGCCGTCGCCCACCCCGCCCAACAACGCGCCTCGCATCGTGCTGCCCGAC
GACAGTCAGGACGTTAAGCGCGCCGCCGCCGTGCAGTCGATGAAGTCGGATCTCATCAACTACCAACGTGGTCCC
CAGGGGGCCCGCTTCAAAAAGGACGCCTGGAAGAGCCTGCAGGTGGGCGACTTCGTCCGAATCTACAACGACGAC
GAGCTGCCCGCAGACGTCATCATCCTCTCCACCTCGGACCCCGACGGCGCCTGTTACGTCGAGACGAAGAACCTG
GACGGCGAGACGAACCTCAAGGTTCGCCAGGCCCTGCGCTGCGGCCGATCCCTCAAGCACGCGCGCGACTGCGAG
CGGGCCGAGTTCCGCATCGAGAGCGAGCCCCCGCAGCCCAACCTCTACAAGTACAACGGCGCCATACGGTGGGAG
CAGCCCGTGCCCGGCTACGCCGACGACGACCCCGAGGAGATGACGGAGCCCATCACCATCGACAACCTCCTGCTC
CGCGGCTGCAACCTGAGGAACACGGAGTGGGTGCTGGGCGTCGTCATCTTCACCGGCCACGAGACCAAGATCATG
ATGAACGCCGGCATCACGCCCAGCAAGCGCGCCAGGATCGCCCGCGAGATGAACTTCAACGTCATCTGCAACTTT
GGCATCCTCCTTATCATGTGCCTGCTCTCGGCCATCGTCAACGGCGTCGCCTGGGCGAGGACCGACGCCTCGCTG
CACTTCTTCGAGTTCGGCGCCATTGGCGGCAGCGCGCCCGTGAGCGGCTTCATCACCTTCTGGGCCGCCATCATC
GTCTTCCAGAACCTGGTGCCCATCTCCCTCTACATCACGCTCGAGATCGTCCGCACGCTCCAGGCCATCTTCATC
TTCAGCGACGTCGAGATGTACTACGAGAAGATCGACCAGCCGTGCATCCCCAAGTCGTGGAACATCTCCGACGAC
GTCGGCCAGATCGAGTACATCTTCTCCGACAAGACCGGCACCCTCACGCAAAACGTCATGGAGTTCAAGAAGGCC
ACCATCAACGGCCAGCCGTACGGCGAGGCCTTCACGGAGGCCCAGGCCGGGATGCAGAAGAGGATGGGCGTCGAC
ATCGAGACCGAGGGCGCCAGGATCCGCGCCGAGATTGCCGAGGCCAAGGTCCGGGCCCTGGGCGGCCTGCGCAAG
ATCAACAAGAACCCCTACCTCCACGACGACGACGTCACCTTCATCGCCCCGGACTTCGTCTCCGACCTCGCCGGC
GACTCCGGGCCCGAGCAGAAGGCGGCCAACGCCGAGTTCATGCTGGCGTTGGCGCTGTGCCACACCGTCATCGCC
GAGAGGACGCCCGGCGATCCTCCCAAGATGAATTTCAAGGCGCAGTCGCCCGACGAGGAAGCCCTCGTCGCCACG
GCCCGGGACATGGGCTTCACCGTCCTGGGCAATTCCGGCGACGGCATCAACCTCAACGTCATGGGCGAGGAGCGC
CACTACCAGATCCTCAACACCATCGAGTTCAACTCGAGCCGGAAGCGGATGAGCTCCATCGTCCGGATGCCAAAC
GGCCAGATCGTCCTCTACTGCAAGGGTGCCGACTCCGTCATCTACGCGCGACTGAAGAGGGGCGAGCAGCAGCAG
CTCAGGCGGGAGACGGCCGAGCATCTCGAGATGTTCGCCCGGGAAGGCCTGCGGACGCTCTGCATCGCGAGCAAG
GTCTTGACGGAGCGCGAGTACAAGGTGTGGAAGAAGGAGCACGACGCTGCCGCCGCGGCGCTCGAGCACCGCGAG
GAGAAGCTGGAGGAGGTGGCGGAGCTCATCGAGCAGGACCTGCTGCTGCTGGGCGGAACGGCCATCGAGGATCGG
CTGCAAGACGGCGTGCCCGACACCATTGCCCTACTGGGCCAGGCCGGCATCAAGCTCTGGGTCCTGACGGGTGAC
AAGGTCGAGACGGCCATCAACATCGGCTTCTCCTGCAACCTGCTCAACAACGACATGGAGCTGATCCACCTCAAG
GTCGACGAGGACGAGTCGGGCGAGACCAGCGACGACAGCTTCCTCGAGACGGTCGGCAAGCTGCTCGACCAACAC
CTGGCGACGTTCGGAATCGCCGGCAACGACGAAGACCTCGCCCTGGCCAAGAAGAACCACGAACCGCCGGCGCCC
ACGCACGGCCTCGTCATCGACGGCTTCACCCTCCGCTGGGCCCTGCACGACGCCCTGAAGCAAAAGTTCCTCCTG
CTGTGCAAGCAGTGCAAGTCCGTGCTGTGCTGCCGCGTGAGCCCCGCGCAGAAGGCGGCCGTCGTGGCCATGGTC
AAGAACGGCCTGGACGTCATGACCCTGTCCATCGGCGACGGGGCCAACGACGTGGCCATGATCCAGGAGGCCGAT
GTTGGCGTGGGCATTGCCGGCGTCGAGGGCCGCCAGGCCGCTATGTCGTCGGACTATGCCATCGCTCAGTTCCGC
TTCCTGCAGAGGCTGGTGCTGGTGCACGGCCGCTGGTCCTACCGCCGTCTGGCCGAGAGCATCAGCAACTTCTTC
TACAAGAACATGGTCTGGACCTTTAGCATCTTCTGGTTCGAGATCTTCTGCGACTTCGACATCACCTACCTCTTC
GACTACACCTACATCCTTATGTTCAACCTCTTCTTCACCTCGCTGCCCGTCGGCATCATGGGCGTGCTCGACCAG
GACGTCTCGGACAAGGTTTCGCTCGCCGTTCCCGAGCTGTACCGACGGGGCATCGAGCGGCTCGAGTGGACCCAG
CGCAAGTTCTGGCTGTACATGATTGACGGCGTCTACCAATCCGTCATGGTCTTCTTCATCCCCTACCTGCTCTTC
ATCCACGGCCGGTCCGTGTCGTTTTCCGGACTGGGCCTCGAGGACAGGCTGCGCTTCGGCGCCTACGTCGCGCAT
CCCGCCGTGCTGACCATCAACGGGTACATCCTGATCAACACGTACCGCTGGGACTGGCTGATGGTCCTCATCGTC
GTCATCAGCGACCTGTTCATCTTCTTCTGGACCGGCGTCTACACCTCCTTCACCGGGTCCGACTTCTTCTACAAG
GCGGCCGCCCAGGTGTACGGCGAGGCCAGCTTCTGGGCCATCTTCTTCATCGTGCCCATCATCTGCCTGTTCCCG
CGGTTCGCCATCAAATCGCTGCAGAAGGTGTACTGGCCGTACGACGTCGACATCATCCGAGAGCAGGAGAAGATG
GGCCAGTTCGCCTACCTCAATGCCGCAGCCGGGCCGGAGGAGATCAAGGTGAAGAGCAACGACGAGAAGAGCCAG
AAGTCGTCGGAAAGCGCCAACAAGACCCAGCACGTGGCCTACGGCAGCGTGGACGAGGACCTGCGTCCCATCTAC
CCGCCGTCGACGGCGACGCGGACGACGCACAACCACACGCAGCACGGCAGCGACTCGACCAACTACACGGCCAAC
CGCATGTCGATCGAGGTGGCGCCGGTCAACCGCCTGTCGTCGGACGCGCCGGCACACACGCGGCCGTCGATCGAT
AGGGCCAGGCCGTCGATCGACAGGGCCAGGCCGTCGTACGACCGGATGCGCATGTCCATGGACCGCTGCCGGCCC
AGCTACGAGGCCAGCAGCGACTTCACGACGGCGGCACGGCTGACGCGCATCGAGTCCAGCCAAACGGGCGCCGCC
CAAGGGATCAAGGCAAGGCTACGAGGCCTGTCGTTGAGCAAGAATGCCAACAACCAGTCGTAA
Transcript >Hirsu2|6991
ATGTCCTCCCCCCCCCGCGCGCCACTCGAGCCCGGCCCCGACCAGAAGATCGAGCACACGCAGAGGGCACGCTGG
GCCACCCGCAAGCTGACCGTCAGGAGCGGCCGCATCAAGCGCCTGTCGCTCCTCAACCGCGGCCAGCACCGGCGC
GCCGGCTCCAACGAGAAGGACTCGGGCCAAGGCGACCCCAACGAACCGCCCTTGGCCGACCTCCCCGACGGCGGC
GAGAGCCATGACATCGTGTCCGACTCGGGCGATTCGCAAGACGACAGCACCAACCGCACCCTCTACTTCAACCTC
CCCCTGCCCGACGACTTGCTCGAAGACGGCCACCCCATATACTCCTTTCCTCGGAACAAGATCAGGACAGCAAAG
TACACGCCGCTCTCCTTCGTCCCCAAGAACCTGTGGTTCCAGTTCCACAATGTCGCCAACATCTTCTTCCTCTTT
CTCGTCATTCTTGTCATATTCCCCATCTTCGGCGGCGTCAACCCCGGGCTCAATGCCGTCCCCCTCATCTTCATC
ATCGTCGTCACCGCCATCAAAGACGCCATCGAGGACTACCGCCGAACCATACTCGACATCGAGCTCAACAACGCT
CCCGTGCACCGCCTGCACCACTGGAACAATGTCAACGTCGAGGAGGACAACGTGTCTTCGTGGAGGAGGTTCAAG
AAGGCAAACTCCACCTTCTTCGGCTCCATCTGGCGCGCCATCGAGAGCCTGTGGTCCAAGAAGGCCCGGACGGCT
CGCGCCGAGCGCAAGGAACGCAAGCTGAACCCGCCCGGCGAAGAAGAGGGCCGACCCTCGGTAGAGACGGTGCGC
ACCAGGCGCTCGATGCGAGAGGCGCTCGCCTCGCCCTTCAACCGCGACTCCTTCATGTCGGCCAATGACGAGATC
CGCGAAGAGATCCAGATGACGCCCGTGCCGTCGCCCACCCCGCCCAACAACGCGCCTCGCATCGTGCTGCCCGAC
GACAGTCAGGACGTTAAGCGCGCCGCCGCCGTGCAGTCGATGAAGTCGGATCTCATCAACTACCAACGTGGTCCC
CAGGGGGCCCGCTTCAAAAAGGACGCCTGGAAGAGCCTGCAGGTGGGCGACTTCGTCCGAATCTACAACGACGAC
GAGCTGCCCGCAGACGTCATCATCCTCTCCACCTCGGACCCCGACGGCGCCTGTTACGTCGAGACGAAGAACCTG
GACGGCGAGACGAACCTCAAGGTTCGCCAGGCCCTGCGCTGCGGCCGATCCCTCAAGCACGCGCGCGACTGCGAG
CGGGCCGAGTTCCGCATCGAGAGCGAGCCCCCGCAGCCCAACCTCTACAAGTACAACGGCGCCATACGGTGGGAG
CAGCCCGTGCCCGGCTACGCCGACGACGACCCCGAGGAGATGACGGAGCCCATCACCATCGACAACCTCCTGCTC
CGCGGCTGCAACCTGAGGAACACGGAGTGGGTGCTGGGCGTCGTCATCTTCACCGGCCACGAGACCAAGATCATG
ATGAACGCCGGCATCACGCCCAGCAAGCGCGCCAGGATCGCCCGCGAGATGAACTTCAACGTCATCTGCAACTTT
GGCATCCTCCTTATCATGTGCCTGCTCTCGGCCATCGTCAACGGCGTCGCCTGGGCGAGGACCGACGCCTCGCTG
CACTTCTTCGAGTTCGGCGCCATTGGCGGCAGCGCGCCCGTGAGCGGCTTCATCACCTTCTGGGCCGCCATCATC
GTCTTCCAGAACCTGGTGCCCATCTCCCTCTACATCACGCTCGAGATCGTCCGCACGCTCCAGGCCATCTTCATC
TTCAGCGACGTCGAGATGTACTACGAGAAGATCGACCAGCCGTGCATCCCCAAGTCGTGGAACATCTCCGACGAC
GTCGGCCAGATCGAGTACATCTTCTCCGACAAGACCGGCACCCTCACGCAAAACGTCATGGAGTTCAAGAAGGCC
ACCATCAACGGCCAGCCGTACGGCGAGGCCTTCACGGAGGCCCAGGCCGGGATGCAGAAGAGGATGGGCGTCGAC
ATCGAGACCGAGGGCGCCAGGATCCGCGCCGAGATTGCCGAGGCCAAGGTCCGGGCCCTGGGCGGCCTGCGCAAG
ATCAACAAGAACCCCTACCTCCACGACGACGACGTCACCTTCATCGCCCCGGACTTCGTCTCCGACCTCGCCGGC
GACTCCGGGCCCGAGCAGAAGGCGGCCAACGCCGAGTTCATGCTGGCGTTGGCGCTGTGCCACACCGTCATCGCC
GAGAGGACGCCCGGCGATCCTCCCAAGATGAATTTCAAGGCGCAGTCGCCCGACGAGGAAGCCCTCGTCGCCACG
GCCCGGGACATGGGCTTCACCGTCCTGGGCAATTCCGGCGACGGCATCAACCTCAACGTCATGGGCGAGGAGCGC
CACTACCAGATCCTCAACACCATCGAGTTCAACTCGAGCCGGAAGCGGATGAGCTCCATCGTCCGGATGCCAAAC
GGCCAGATCGTCCTCTACTGCAAGGGTGCCGACTCCGTCATCTACGCGCGACTGAAGAGGGGCGAGCAGCAGCAG
CTCAGGCGGGAGACGGCCGAGCATCTCGAGATGTTCGCCCGGGAAGGCCTGCGGACGCTCTGCATCGCGAGCAAG
GTCTTGACGGAGCGCGAGTACAAGGTGTGGAAGAAGGAGCACGACGCTGCCGCCGCGGCGCTCGAGCACCGCGAG
GAGAAGCTGGAGGAGGTGGCGGAGCTCATCGAGCAGGACCTGCTGCTGCTGGGCGGAACGGCCATCGAGGATCGG
CTGCAAGACGGCGTGCCCGACACCATTGCCCTACTGGGCCAGGCCGGCATCAAGCTCTGGGTCCTGACGGGTGAC
AAGGTCGAGACGGCCATCAACATCGGCTTCTCCTGCAACCTGCTCAACAACGACATGGAGCTGATCCACCTCAAG
GTCGACGAGGACGAGTCGGGCGAGACCAGCGACGACAGCTTCCTCGAGACGGTCGGCAAGCTGCTCGACCAACAC
CTGGCGACGTTCGGAATCGCCGGCAACGACGAAGACCTCGCCCTGGCCAAGAAGAACCACGAACCGCCGGCGCCC
ACGCACGGCCTCGTCATCGACGGCTTCACCCTCCGCTGGGCCCTGCACGACGCCCTGAAGCAAAAGTTCCTCCTG
CTGTGCAAGCAGTGCAAGTCCGTGCTGTGCTGCCGCGTGAGCCCCGCGCAGAAGGCGGCCGTCGTGGCCATGGTC
AAGAACGGCCTGGACGTCATGACCCTGTCCATCGGCGACGGGGCCAACGACGTGGCCATGATCCAGGAGGCCGAT
GTTGGCGTGGGCATTGCCGGCGTCGAGGGCCGCCAGGCCGCTATGTCGTCGGACTATGCCATCGCTCAGTTCCGC
TTCCTGCAGAGGCTGGTGCTGGTGCACGGCCGCTGGTCCTACCGCCGTCTGGCCGAGAGCATCAGCAACTTCTTC
TACAAGAACATGGTCTGGACCTTTAGCATCTTCTGGTTCGAGATCTTCTGCGACTTCGACATCACCTACCTCTTC
GACTACACCTACATCCTTATGTTCAACCTCTTCTTCACCTCGCTGCCCGTCGGCATCATGGGCGTGCTCGACCAG
GACGTCTCGGACAAGGTTTCGCTCGCCGTTCCCGAGCTGTACCGACGGGGCATCGAGCGGCTCGAGTGGACCCAG
CGCAAGTTCTGGCTGTACATGATTGACGGCGTCTACCAATCCGTCATGGTCTTCTTCATCCCCTACCTGCTCTTC
ATCCACGGCCGGTCCGTGTCGTTTTCCGGACTGGGCCTCGAGGACAGGCTGCGCTTCGGCGCCTACGTCGCGCAT
CCCGCCGTGCTGACCATCAACGGGTACATCCTGATCAACACGTACCGCTGGGACTGGCTGATGGTCCTCATCGTC
GTCATCAGCGACCTGTTCATCTTCTTCTGGACCGGCGTCTACACCTCCTTCACCGGGTCCGACTTCTTCTACAAG
GCGGCCGCCCAGGTGTACGGCGAGGCCAGCTTCTGGGCCATCTTCTTCATCGTGCCCATCATCTGCCTGTTCCCG
CGGTTCGCCATCAAATCGCTGCAGAAGGTGTACTGGCCGTACGACGTCGACATCATCCGAGAGCAGGAGAAGATG
GGCCAGTTCGCCTACCTCAATGCCGCAGCCGGGCCGGAGGAGATCAAGGTGAAGAGCAACGACGAGAAGAGCCAG
AAGTCGTCGGAAAGCGCCAACAAGACCCAGCACGTGGCCTACGGCAGCGTGGACGAGGACCTGCGTCCCATCTAC
CCGCCGTCGACGGCGACGCGGACGACGCACAACCACACGCAGCACGGCAGCGACTCGACCAACTACACGGCCAAC
CGCATGTCGATCGAGGTGGCGCCGGTCAACCGCCTGTCGTCGGACGCGCCGGCACACACGCGGCCGTCGATCGAT
AGGGCCAGGCCGTCGATCGACAGGGCCAGGCCGTCGTACGACCGGATGCGCATGTCCATGGACCGCTGCCGGCCC
AGCTACGAGGCCAGCAGCGACTTCACGACGGCGGCACGGCTGACGCGCATCGAGTCCAGCCAAACGGGCGCCGCC
CAAGGGATCAAGGCAAGGCTACGAGGCCTGTCGTTGAGCAAGAATGCCAACAACCAGTCGTAA
Gene >Hirsu2|6991
ATGTCCTCCCCCCCCCGCGCGCCACTCGAGCCCGGCCCCGACCAGAAGATCGAGCACACGCAGAGGGCACGCTGG
GCCACCCGCAAGCTGACCGTCAGGAGCGGCCGCATCAAGCGCCTGTCGCTCCTCAACCGCGGCCAGCACCGGCGC
GCCGGCTCCAACGAGAAGGACTCGGGCCAAGGCGACCCCAACGAACCGCCCTTGGCCGACCTCCCCGACGGCGGC
GAGAGCCATGACATCGTGTCCGACTCGGGCGATTCGCAAGACGACAGCACCAACCGCACCCTCTACTTCAACCTC
CCCCTGCCCGACGACTTGCTCGAAGACGGCCACCCCATATACTCCTTTCCTCGGAACAAGATCAGGACAGCAAAG
TACACGCCGCTCTCCTTCGTCCCCAAGAACCTGTGGTTCCAGTTCCACAATGTCGCCAACATCTTCTTCCTCTTT
CTCGTCATTCTTGTCGTGAGTAGCCCCGCCCCTCCCTTGGCTTTGCCCCCCCTTTCTCCCCCCTCCCCTTGGCGG
GCGAGCCACCGGCCGCGCGATGGAGGGAACGCCCCGAACGTTAAGCCACGCCCGCCTCGCAGATATTCCCCATCT
TCGGCGGCGTCAACCCCGGGCTCAATGCCGTCCCCCTCATCTTCATCATCGTCGTCACCGCCATCAAAGACGCCA
TCGAGGACTACCGCCGAACCATACTCGACATCGAGCTCAACAACGCTCCCGTGCACCGCCTGCACCACTGGAACA
ATGTCAACGTCGAGGAGGACAACGTGTCTTCGTGGAGGAGGTTCAAGAAGGCAAACTCCACCTTCTTCGGCTCCA
TCTGGCGCGCCATCGAGAGCCTGTGGTCCAAGAAGGCCCGGACGGCTCGCGCCGAGCGCAAGGAACGCAAGCTGA
ACCCGCCCGGCGAAGAAGAGGGCCGACCCTCGGTAGAGACGGTGCGCACCAGGCGCTCGATGCGAGAGGCGCTCG
CCTCGCCCTTCAACCGCGACTCCTTCATGTCGGCCAATGACGAGATCCGCGAAGAGATCCAGATGACGCCCGTGC
CGTCGCCCACCCCGCCCAACAACGCGCCTCGCATCGTGCTGCCCGACGACAGTCAGGACGTTAAGCGCGCCGCCG
CCGTGCAGTCGATGAAGTCGGATCTCATCAACTACCAACGTGGTCCCCAGGGGGCCCGCTTCAAAAAGGACGCCT
GGAAGAGCCTGCAGGTGGGCGACTTCGTCCGAATCTACAACGACGACGAGCTGCCCGCAGACGTCATCATCCTCT
CCACCTCGGACCCCGACGGCGCCTGTTACGTCGAGACGAAGAACCTGGACGGCGAGACGAACCTCAAGGTTCGCC
AGGCCCTGCGCTGCGGCCGATCCCTCAAGCACGCGCGCGACTGCGAGCGGGCCGAGTTCCGCATCGAGAGCGAGC
CCCCGCAGCCCAACCTCTACAAGTACAACGGCGCCATACGGTGGGAGCAGCCCGTGCCCGGCTACGCCGACGACG
ACCCCGAGGAGATGACGGAGCCCATCACCATCGACAACCTCCTGCTCCGCGGCTGCAACCTGAGGAACACGGAGT
GGGTGCTGGGCGTCGTCATCTTCACCGGCCACGAGACCAAGATCATGATGAACGCCGGCATCACGCCCAGCAAGC
GCGCCAGGATCGCCCGCGAGATGAACTTCAACGTCATCTGCAACTTTGGCATCCTCCTTATCATGTGCCTGCTCT
CGGCCATCGTCAACGGCGTCGCCTGGGCGAGGACCGACGCCTCGCTGCACTTCTTCGAGTTCGGCGCCATTGGCG
GCAGCGCGCCCGTGAGCGGCTTCATCACCTTCTGGGCCGCCATCATCGTCTTCCAGAACCTGGTGCCCATCTCCC
TCTACATCACGCTCGAGATCGTCCGCACGCTCCAGGCCATCTTCATCTTCAGCGACGTCGAGATGTACTACGAGA
AGATCGACCAGCCGTGCATCCCCAAGTCGTGGAACATCTCCGACGACGTCGGCCAGATCGAGTACATCTTCTCCG
ACAAGACCGGCACCCTCACGCAAAACGTCATGGAGTTCAAGAAGGCCACCATCAACGGCCAGCCGTACGGCGAGG
CCTTCACGGAGGCCCAGGCCGGGATGCAGAAGAGGATGGGCGTCGACATCGAGACCGAGGGCGCCAGGATCCGCG
CCGAGATTGCCGAGGCCAAGGTCCGGGCCCTGGGCGGCCTGCGCAAGATCAACAAGAACCCCTACCTCCACGACG
ACGACGTCACCTTCATCGCCCCGGACTTCGTCTCCGACCTCGCCGGCGACTCCGGGCCCGAGCAGAAGGCGGCCA
ACGCCGAGTTCATGCTGGCGTTGGCGCTGTGCCACACCGTCATCGCCGAGAGGACGCCCGGCGATCCTCCCAAGA
TGAATTTCAAGGCGCAGTCGCCCGACGAGGAAGCCCTCGTCGCCACGGCCCGGGACATGGGCTTCACCGTCCTGG
GCAATTCCGGCGACGGCATCAACCTCAACGTCATGGGCGAGGAGCGCCACTACCAGATCCTCAACACCATCGAGT
TCAACTCGAGCCGGAAGCGGATGAGCTCCATCGTCCGGATGCCAAACGGCCAGATCGTCCTCTACTGCAAGGGTG
CCGACTCCGTCATCTACGCGCGACTGAAGAGGGGCGAGCAGCAGCAGCTCAGGCGGGAGACGGCCGAGCATCTCG
AGATGTTCGCCCGGGAAGGCCTGCGGACGCTCTGCATCGCGAGCAAGGTCTTGACGGAGCGCGAGTACAAGGTGT
GGAAGAAGGAGCACGACGCTGCCGCCGCGGCGCTCGAGCACCGCGAGGAGAAGCTGGAGGAGGTGGCGGAGCTCA
TCGAGCAGGACCTGCTGCTGCTGGGCGGAACGGCCATCGAGGATCGGCTGCAAGACGGCGTGCCCGACACCATTG
CCCTACTGGGCCAGGCCGGCATCAAGCTCTGGGTCCTGACGGGTGACAAGGTCGAGACGGCCATCAACATCGGCT
TCTCCTGCAACCTGCTCAACAACGACATGGAGCTGATCCACCTCAAGGTCGACGAGGACGAGTCGGGCGAGACCA
GCGACGACAGCTTCCTCGAGACGGTCGGCAAGCTGCTCGACCAACACCTGGCGACGTTCGGAATCGCCGGCAACG
ACGAAGACCTCGCCCTGGCCAAGAAGAACCACGAACCGCCGGCGCCCACGCACGGCCTCGTCATCGACGGCTTCA
CCCTCCGCTGGGCCCTGCACGACGCCCTGAAGCAAAAGTTCCTCCTGCTGTGCAAGCAGTGCAAGTCCGTGCTGT
GCTGCCGCGTGAGCCCCGCGCAGAAGGCGGCCGTCGTGGCCATGGTCAAGAACGGCCTGGACGTCATGACCCTGT
CCATCGGCGACGGGGCCAACGACGTGGCCATGATCCAGGAGGCCGATGTTGGCGTGGGCATTGCCGGCGTCGAGG
GCCGCCAGGCCGCTATGTCGTCGGACTATGCCATCGCTCAGTTCCGCTTCCTGCAGAGGCTGGTGCTGGTGCACG
GCCGCTGGTCCTACCGCCGTCTGGCCGAGAGCATCAGCAACTTCTTCTACAAGAACATGGTCTGGACCTTTAGCA
TCTTCTGGTTCGAGATCTTCTGCGACTTCGACATCACCTACCTCTTCGACTACACCTACATCCTTATGTTCAACC
TCTTCTTCACCTCGCTGCCCGTCGGCATCATGGGCGTGCTCGACCAGGACGTCTCGGACAAGGTTTCGCTCGCCG
TTCCCGAGCTGTACCGACGGGGCATCGAGCGGCTCGAGTGGACCCAGCGCAAGTTCTGGTAAGTCACAGGTTTTT
TTTTTTTTTGCTGCCCATGCCGCGCGCGCACCGCGGATGCGTGTCTGTGGACCGATTGCTGACGAGAGCCTCGCC
GATCCGCAGGCTGTACATGATTGACGGCGTCTACCAATCCGTCATGGTCTTCTTCATCCCCTACCTGCTCTTCAT
CCACGGCCGGTCCGTGTCGTTTTCCGGACTGGGCCTCGAGGACAGGCTGCGCTTCGGCGCCTACGTCGCGCATCC
CGCCGTGCTGACCATCAACGGGTACATCCTGATCAACACGTACCGCTGGGACTGGCTGATGGTCCTCATCGTCGT
CATCAGCGACCTGTTCATCTTCTTCTGGACCGGCGTCTACACCTCCTTCACCGGGTCCGACTTCTTCTACAAGGC
GGCCGCCCAGGTGTACGGCGAGGCCAGCTTCTGGGCCATCTTCTTCATCGTGCCCATCATCTGCCTGTTCCCGCG
GTTCGCCATCAAATCGCTGCAGAAGGTGTACTGGCCGTACGACGTCGACATCATCCGAGAGCAGGAGAAGATGGG
CCAGTTCGCCTACCTCAATGCCGCAGCCGGGCCGGAGGAGATCAAGGTGAAGAGCAACGACGAGAAGAGCCAGAA
GTCGTCGGAAAGCGCCAACAAGACCCAGCACGTGGCCTACGGCAGCGTGGACGAGGACCTGCGTCCCATCTACCC
GCCGTCGACGGCGACGCGGACGACGCACAACCACACGCAGCACGGCAGCGACTCGACCAACTACACGGCCAACCG
CATGTCGATCGAGGTGGCGCCGGTCAACCGCCTGTCGTCGGACGCGCCGGCACACACGCGGCCGTCGATCGATAG
GGCCAGGCCGTCGATCGACAGGGCCAGGCCGTCGTACGACCGGATGCGCATGTCCATGGACCGCTGCCGGCCCAG
CTACGAGGCCAGCAGCGACTTCACGACGGCGGCACGGCTGACGCGCATCGAGTCCAGCCAAACGGGCGCCGCCCA
AGGGATCAAGGCAAGGCTACGAGGCCTGTCGTTGAGCAAGAATGCCAACAACCAGTCGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail