Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|699
Gene name
LocationContig_1141:1930..3138
Strand-
Gene length (bp)1208
Transcript length (bp)1128
Coding sequence length (bp)1128
Protein length (aa) 376

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 5.7E-35 95 283
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 5.5E-28 100 294
PF08659 KR KR domain 1.4E-06 96 257

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07530|YD114_YEAST Uncharacterized oxidoreductase YDL114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL114W PE=3 SV=1 97 349 5.0E-31
sp|Q1MTR7|YBPE_SCHPO Uncharacterized oxidoreductase C16H5.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16H5.14c PE=3 SV=1 58 349 8.0E-28
sp|Q05A13|S16C6_MOUSE Short-chain dehydrogenase/reductase family 16C member 6 OS=Mus musculus GN=Sdr16c6 PE=2 SV=1 86 372 9.0E-28
sp|A5PJJ7|S16C6_BOVIN Short-chain dehydrogenase/reductase family 16C member 6 OS=Bos taurus GN=SDR16C6 PE=2 SV=1 90 374 2.0E-26
sp|Q7TQA3|RDHE2_MOUSE Epidermal retinol dehydrogenase 2 OS=Mus musculus GN=Sdr16c5 PE=2 SV=1 85 358 2.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07530|YD114_YEAST Uncharacterized oxidoreductase YDL114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL114W PE=3 SV=1 97 349 5.0E-31
sp|Q1MTR7|YBPE_SCHPO Uncharacterized oxidoreductase C16H5.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16H5.14c PE=3 SV=1 58 349 8.0E-28
sp|Q05A13|S16C6_MOUSE Short-chain dehydrogenase/reductase family 16C member 6 OS=Mus musculus GN=Sdr16c6 PE=2 SV=1 86 372 9.0E-28
sp|A5PJJ7|S16C6_BOVIN Short-chain dehydrogenase/reductase family 16C member 6 OS=Bos taurus GN=SDR16C6 PE=2 SV=1 90 374 2.0E-26
sp|Q7TQA3|RDHE2_MOUSE Epidermal retinol dehydrogenase 2 OS=Mus musculus GN=Sdr16c5 PE=2 SV=1 85 358 2.0E-25
sp|Q7T2D1|RD10B_DANRE Retinol dehydrogenase 10-B OS=Danio rerio GN=rdh10b PE=2 SV=2 85 358 9.0E-25
sp|Q8IZV5|RDH10_HUMAN Retinol dehydrogenase 10 OS=Homo sapiens GN=RDH10 PE=1 SV=1 85 358 1.0E-24
sp|Q8HZT6|RDH10_BOVIN Retinol dehydrogenase 10 OS=Bos taurus GN=RDH10 PE=1 SV=1 85 358 1.0E-24
sp|Q80ZF7|RDH10_RAT Retinol dehydrogenase 10 OS=Rattus norvegicus GN=Rdh10 PE=1 SV=1 85 358 1.0E-24
sp|Q8VCH7|RDH10_MOUSE Retinol dehydrogenase 10 OS=Mus musculus GN=Rdh10 PE=1 SV=2 85 358 2.0E-24
sp|Q8N3Y7|RDHE2_HUMAN Epidermal retinol dehydrogenase 2 OS=Homo sapiens GN=SDR16C5 PE=2 SV=2 85 358 4.0E-24
sp|Q6NRV4|RD10B_XENLA Retinol dehydrogenase 10-B OS=Xenopus laevis GN=rdh10-b PE=2 SV=1 85 358 7.0E-24
sp|Q5XGF7|RDH10_XENTR Retinol dehydrogenase 10 OS=Xenopus tropicalis GN=rdh10 PE=2 SV=1 85 358 1.0E-23
sp|Q6DCT3|RD10A_XENLA Retinol dehydrogenase 10-A OS=Xenopus laevis GN=rdh10-a PE=2 SV=1 85 358 1.0E-23
sp|A1L1W4|RD10A_DANRE Retinol dehydrogenase 10-A OS=Danio rerio GN=rdh10a PE=2 SV=1 58 368 2.0E-22
sp|Q06417|TDA5_YEAST Uncharacterized oxidoreductase TDA5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA5 PE=1 SV=1 88 348 4.0E-21
sp|Q5M875|DHB13_RAT 17-beta-hydroxysteroid dehydrogenase 13 OS=Rattus norvegicus GN=Hsd17b13 PE=1 SV=1 94 310 7.0E-19
sp|P50197|LINC_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linC PE=2 SV=1 88 300 2.0E-18
sp|O88876|DHRS3_MOUSE Short-chain dehydrogenase/reductase 3 OS=Mus musculus GN=Dhrs3 PE=1 SV=2 86 357 4.0E-18
sp|Q8VCR2|DHB13_MOUSE 17-beta-hydroxysteroid dehydrogenase 13 OS=Mus musculus GN=Hsd17b13 PE=1 SV=2 94 310 7.0E-18
sp|Q7Z5P4|DHB13_HUMAN 17-beta-hydroxysteroid dehydrogenase 13 OS=Homo sapiens GN=HSD17B13 PE=1 SV=1 94 310 8.0E-18
sp|Q4JK73|DHB11_MACFA Estradiol 17-beta-dehydrogenase 11 OS=Macaca fascicularis GN=HSD17B11 PE=2 SV=1 94 310 1.0E-17
sp|Q5NVG2|DHB11_PONAB Estradiol 17-beta-dehydrogenase 11 OS=Pongo abelii GN=HSD17B11 PE=2 SV=1 94 310 1.0E-17
sp|Q5C9I9|ISPD_MENPI (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial OS=Mentha piperita PE=1 SV=1 91 313 2.0E-17
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 94 282 2.0E-17
sp|O75911|DHRS3_HUMAN Short-chain dehydrogenase/reductase 3 OS=Homo sapiens GN=DHRS3 PE=1 SV=2 138 357 2.0E-17
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 97 286 3.0E-17
sp|Q92RN6|GALD_RHIME Probable galactose dehydrogenase GalD OS=Rhizobium meliloti (strain 1021) GN=galD PE=3 SV=1 90 280 4.0E-17
sp|Q8NBQ5|DHB11_HUMAN Estradiol 17-beta-dehydrogenase 11 OS=Homo sapiens GN=HSD17B11 PE=1 SV=3 94 310 5.0E-17
sp|O77769|DHRS3_BOVIN Short-chain dehydrogenase/reductase 3 OS=Bos taurus GN=DHRS3 PE=2 SV=1 138 357 6.0E-17
sp|Q9EQ06|DHB11_MOUSE Estradiol 17-beta-dehydrogenase 11 OS=Mus musculus GN=Hsd17b11 PE=1 SV=1 94 310 1.0E-16
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 97 282 1.0E-16
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 93 311 2.0E-16
sp|Q6AYS8|DHB11_RAT Estradiol 17-beta-dehydrogenase 11 OS=Rattus norvegicus GN=Hsd17b11 PE=2 SV=1 94 310 2.0E-16
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 91 310 2.0E-16
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 91 310 6.0E-16
sp|P66782|Y1385_MYCBO Uncharacterized oxidoreductase Mb1385 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG2 PE=3 SV=1 97 282 8.0E-16
sp|P9WGR9|Y1350_MYCTU Uncharacterized oxidoreductase Rv1350 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG2 PE=1 SV=1 97 282 8.0E-16
sp|P9WGR8|Y1350_MYCTO Uncharacterized oxidoreductase MT1393 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG2 PE=3 SV=1 97 282 8.0E-16
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 91 310 8.0E-16
sp|P14802|YOXD_BACSU Uncharacterized oxidoreductase YoxD OS=Bacillus subtilis (strain 168) GN=yoxD PE=3 SV=2 114 310 8.0E-16
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 91 283 1.0E-15
sp|Q8KWT4|BACC_BACIU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis GN=bacC PE=1 SV=1 89 282 1.0E-15
sp|Q91VT4|CBR4_MOUSE Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2 93 282 2.0E-15
sp|P40397|YHXC_BACSU Uncharacterized oxidoreductase YhxC OS=Bacillus subtilis (strain 168) GN=yhxC PE=3 SV=2 97 298 3.0E-15
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 95 310 4.0E-15
sp|Q94K41|SDR3B_ARATH Short-chain dehydrogenase reductase 3b OS=Arabidopsis thaliana GN=SDR3b PE=2 SV=1 94 282 5.0E-15
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 91 282 6.0E-15
sp|P71534|FABG_MYCS2 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabG PE=3 SV=2 84 282 8.0E-15
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 94 276 9.0E-15
sp|P73826|FABG2_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG2 PE=1 SV=1 91 282 9.0E-15
sp|P39484|DHG3_BACME Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 90 282 1.0E-14
sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2 91 287 1.0E-14
sp|Q5TJF5|DHB8_CANLF Estradiol 17-beta-dehydrogenase 8 OS=Canis lupus familiaris GN=HSD17B8 PE=3 SV=1 97 313 1.0E-14
sp|P10528|DHGA_BACME Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 90 282 1.0E-14
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 76 310 1.0E-14
sp|P39485|DHG4_BACME Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 90 282 2.0E-14
sp|P39640|BACC_BACSU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis (strain 168) GN=bacC PE=1 SV=2 89 282 2.0E-14
sp|P16543|DHK2_STRVN Granaticin polyketide synthase putative ketoacyl reductase 2 OS=Streptomyces violaceoruber GN=gra-orf6 PE=3 SV=1 95 300 2.0E-14
sp|P50198|LINX_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 91 304 2.0E-14
sp|Q01198|LIGD_SPHPI C alpha-dehydrogenase OS=Sphingomonas paucimobilis GN=ligD PE=3 SV=1 88 248 3.0E-14
sp|O80714|SDR3C_ARATH Short-chain dehydrogenase reductase 3c OS=Arabidopsis thaliana GN=SDR3c PE=3 SV=1 94 282 4.0E-14
sp|Q8KWS9|BACC_BACAM Dihydroanticapsin 7-dehydrogenase OS=Bacillus amyloliquefaciens GN=bacC PE=1 SV=1 89 282 5.0E-14
sp|Q5P5I4|PED_AROAE (S)-1-Phenylethanol dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=ped PE=1 SV=1 91 261 5.0E-14
sp|Q0WRJ2|TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana GN=TSC10A PE=1 SV=1 85 336 6.0E-14
sp|P55575|Y4MP_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4mP OS=Rhizobium sp. (strain NGR234) GN=NGR_a02430 PE=3 SV=1 97 282 6.0E-14
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 97 307 6.0E-14
sp|Q82IY9|PTLF_STRAW 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlF PE=1 SV=1 97 307 6.0E-14
sp|Q45219|Y2146_BRADU Probable short-chain type dehydrogenase/reductase blr2146 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr2146 PE=3 SV=2 94 336 6.0E-14
sp|Q8JZV9|BDH2_MOUSE 3-hydroxybutyrate dehydrogenase type 2 OS=Mus musculus GN=Bdh2 PE=1 SV=1 91 281 7.0E-14
sp|P39483|DHG2_BACME Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 90 282 8.0E-14
sp|Q59787|DHSO_RHOSH Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 97 287 1.0E-13
sp|Q5KTS5|GRDH_DAUCA Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 94 292 1.0E-13
sp|Q56318|Y019_THEMA Uncharacterized oxidoreductase TM_0019 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0019 PE=3 SV=2 103 280 1.0E-13
sp|Q89AG9|FABG_BUCBP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabG PE=3 SV=1 93 282 1.0E-13
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 97 261 1.0E-13
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 97 261 1.0E-13
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 97 261 1.0E-13
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 97 261 1.0E-13
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 97 261 1.0E-13
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 97 261 1.0E-13
sp|Q3KPT7|BDH2_XENLA 3-hydroxybutyrate dehydrogenase type 2 OS=Xenopus laevis GN=bdh2 PE=2 SV=1 91 281 1.0E-13
sp|Q9URX0|YLX6_SCHPO Uncharacterized oxidoreductase C922.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.06 PE=3 SV=1 95 323 1.0E-13
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 93 282 1.0E-13
sp|Q8N4T8|CBR4_HUMAN Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3 93 307 1.0E-13
sp|Q9MA93|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 94 303 2.0E-13
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 84 280 2.0E-13
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 84 280 2.0E-13
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 84 280 2.0E-13
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 97 261 3.0E-13
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 97 261 3.0E-13
sp|F4JZN6|TC10B_ARATH 3-dehydrosphinganine reductase TSC10B OS=Arabidopsis thaliana GN=TSC10B PE=1 SV=1 85 283 3.0E-13
sp|Q7TS56|CBR4_RAT Carbonyl reductase family member 4 OS=Rattus norvegicus GN=Cbr4 PE=2 SV=1 93 282 3.0E-13
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 94 307 3.0E-13
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 88 300 3.0E-13
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 90 282 4.0E-13
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 91 282 4.0E-13
sp|B8H1Z0|XDH_CAUCN D-xylose 1-dehydrogenase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=xylB PE=1 SV=1 96 290 5.0E-13
sp|Q92506|DHB8_HUMAN Estradiol 17-beta-dehydrogenase 8 OS=Homo sapiens GN=HSD17B8 PE=1 SV=2 97 282 5.0E-13
sp|H9BFQ1|TPRL2_ERYCB Tropinone reductase-like 2 OS=Erythroxylum coca PE=2 SV=1 94 280 6.0E-13
sp|Q3T046|BDH2_BOVIN 3-hydroxybutyrate dehydrogenase type 2 OS=Bos taurus GN=BDH2 PE=2 SV=1 91 281 7.0E-13
sp|O07399|FABG_MYCAV 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium avium GN=fabG PE=3 SV=1 83 282 7.0E-13
sp|P12310|DHG_BACSU Glucose 1-dehydrogenase OS=Bacillus subtilis (strain 168) GN=gdh PE=2 SV=2 90 282 9.0E-13
sp|Q68ER2|CBR4_XENTR Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 94 307 9.0E-13
sp|P55541|Y4LA_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4lA OS=Rhizobium sp. (strain NGR234) GN=NGR_a02730 PE=3 SV=1 94 324 1.0E-12
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 89 282 1.0E-12
sp|P0C0Y4|MTDH_ALTAL Probable NADP-dependent mannitol dehydrogenase OS=Alternaria alternata PE=1 SV=2 88 282 1.0E-12
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 90 282 1.0E-12
sp|Q9FZ42|GRDH1_ARATH Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1 94 282 1.0E-12
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 94 292 2.0E-12
sp|Q10216|YAY8_SCHPO Uncharacterized oxidoreductase C4H3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.08 PE=3 SV=1 91 313 2.0E-12
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 88 282 2.0E-12
sp|Q9ZW03|TRNH3_ARATH Tropinone reductase homolog At2g29150 OS=Arabidopsis thaliana GN=At2g29150 PE=1 SV=1 97 282 2.0E-12
sp|Q9ZW18|SAG13_ARATH Senescence-associated protein 13 OS=Arabidopsis thaliana GN=SAG13 PE=1 SV=1 90 282 2.0E-12
sp|E3VWK2|PENF_STREX 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces exfoliatus GN=penF PE=3 SV=1 97 289 2.0E-12
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 95 282 2.0E-12
sp|P37079|SORD_KLEPN Sorbitol-6-phosphate 2-dehydrogenase OS=Klebsiella pneumoniae GN=sorD PE=3 SV=1 89 289 2.0E-12
sp|A7DY56|TRN1_COCOF Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 97 282 2.0E-12
sp|O07575|YHDF_BACSU Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 94 283 3.0E-12
sp|Q6MGB5|DHB8_RAT Estradiol 17-beta-dehydrogenase 8 OS=Rattus norvegicus GN=Hsd17b8 PE=1 SV=1 119 282 3.0E-12
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 97 282 3.0E-12
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 97 282 3.0E-12
sp|C1C4R8|BDH2_LITCT 3-hydroxybutyrate dehydrogenase type 2 OS=Lithobates catesbeiana GN=bdh2 PE=2 SV=1 91 281 3.0E-12
sp|H9BFQ0|TPRL1_ERYCB Tropinone reductase-like 1 OS=Erythroxylum coca PE=2 SV=1 94 282 3.0E-12
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 94 282 4.0E-12
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 94 282 4.0E-12
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 91 310 4.0E-12
sp|P19992|HSD_STREX 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Streptomyces exfoliatus PE=1 SV=1 90 282 5.0E-12
sp|F4J300|SDR5_ARATH Short-chain dehydrogenase reductase 5 OS=Arabidopsis thaliana GN=SDR5 PE=3 SV=1 94 310 5.0E-12
sp|D4A1J4|BDH2_RAT 3-hydroxybutyrate dehydrogenase type 2 OS=Rattus norvegicus GN=Bdh2 PE=3 SV=2 94 281 5.0E-12
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 94 282 6.0E-12
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 94 282 6.0E-12
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 89 282 8.0E-12
sp|Q9LBG2|LVR_LEIAQ Levodione reductase OS=Leifsonia aquatica GN=lvr PE=1 SV=1 93 282 8.0E-12
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 91 282 8.0E-12
sp|Q9ZW12|TRNH5_ARATH Tropinone reductase homolog At2g29260, chloroplastic OS=Arabidopsis thaliana GN=At2g29260 PE=2 SV=1 97 323 8.0E-12
sp|P9WGT3|FABG_MYCTU 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG1 PE=1 SV=1 96 282 9.0E-12
sp|P9WGT2|FABG_MYCTO 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG1 PE=3 SV=1 96 282 9.0E-12
sp|P0A5Y5|FABG_MYCBO 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG PE=3 SV=1 96 282 9.0E-12
sp|Q8MJY8|PGDH_MACFA 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1 94 307 1.0E-11
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 96 310 1.0E-11
sp|P15428|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1 94 307 1.0E-11
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 88 285 1.0E-11
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 88 285 1.0E-11
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 95 282 2.0E-11
sp|P52037|YGFF_ECOLI Uncharacterized oxidoreductase YgfF OS=Escherichia coli (strain K12) GN=ygfF PE=3 SV=2 95 282 2.0E-11
sp|Q53217|Y4VI_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4vI OS=Rhizobium sp. (strain NGR234) GN=NGR_a01150 PE=3 SV=2 95 282 2.0E-11
sp|P94681|TSAC_COMTE 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 OS=Comamonas testosteroni GN=tsaC1 PE=1 SV=1 89 306 2.0E-11
sp|Q8VCC1|PGDH_MOUSE 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Mus musculus GN=Hpgd PE=1 SV=1 94 307 2.0E-11
sp|P0A9P9|IDNO_ECOLI Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 88 294 2.0E-11
sp|P0A9Q0|IDNO_ECOL6 Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 88 294 2.0E-11
sp|P80873|GS39_BACSU General stress protein 39 OS=Bacillus subtilis (strain 168) GN=ydaD PE=1 SV=3 94 282 3.0E-11
sp|Q8K9J5|FABG_BUCAP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabG PE=3 SV=1 97 282 3.0E-11
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 63 282 3.0E-11
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 63 282 3.0E-11
sp|Q8CQD2|BUTA_STAES Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=butA PE=3 SV=1 97 263 4.0E-11
sp|F4J2Z7|SDR4_ARATH Short-chain dehydrogenase reductase 4 OS=Arabidopsis thaliana GN=SDR4 PE=2 SV=1 94 282 4.0E-11
sp|Q9ZW04|TRNH4_ARATH Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1 91 283 4.0E-11
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 69 300 5.0E-11
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 91 284 5.0E-11
sp|Q9LUF2|HSD4B_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4B OS=Arabidopsis thaliana GN=HSD7 PE=2 SV=2 94 333 5.0E-11
sp|P0DKC7|HSD4A_ARATH 11-beta-hydroxysteroid dehydrogenase-like 4A OS=Arabidopsis thaliana GN=HSD4 PE=2 SV=1 94 333 5.0E-11
sp|Q75KH3|GRDH_ORYSJ Glucose and ribitol dehydrogenase homolog OS=Oryza sativa subsp. japonica GN=Os05g0140800 PE=2 SV=2 91 292 6.0E-11
sp|P70684|PGDH_CAVPO 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Cavia porcellus GN=HPGD PE=2 SV=1 94 307 6.0E-11
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 95 282 6.0E-11
sp|P9WGT1|HSD_MYCTU 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG3 PE=1 SV=1 94 307 6.0E-11
sp|P69166|HSD_MYCBO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG3 PE=3 SV=1 94 307 6.0E-11
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 79 310 8.0E-11
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 97 282 8.0E-11
sp|P05707|SRLD_ECOLI Sorbitol-6-phosphate 2-dehydrogenase OS=Escherichia coli (strain K12) GN=srlD PE=1 SV=2 93 283 9.0E-11
sp|Q04520|BUDC_RAOTE Diacetyl reductase [(S)-acetoin forming] OS=Raoultella terrigena GN=budC PE=3 SV=1 93 283 1.0E-10
sp|Q9SCU0|SDR2A_ARATH Short-chain dehydrogenase reductase 2a OS=Arabidopsis thaliana GN=SDR2a PE=3 SV=1 94 283 1.0E-10
sp|Q5HKG6|BUTA_STAEQ Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=butA PE=3 SV=1 97 263 1.0E-10
sp|Q9ZW13|TRNH6_ARATH Tropinone reductase homolog At2g29290 OS=Arabidopsis thaliana GN=At2g29290 PE=2 SV=1 97 283 1.0E-10
sp|P0DKI3|TRNH1_ARATH Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1 90 282 1.0E-10
sp|P33368|YOHF_ECOLI Uncharacterized oxidoreductase YohF OS=Escherichia coli (strain K12) GN=yohF PE=3 SV=2 94 282 1.0E-10
sp|Q9LUE4|HSD6_ARATH 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 90 282 1.0E-10
sp|O54438|FABG_PSEAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabG PE=1 SV=1 94 282 1.0E-10
sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 90 282 1.0E-10
sp|Q9ZW20|TRNHD_ARATH Tropinone reductase homolog At2g29370 OS=Arabidopsis thaliana GN=At2g29370 PE=3 SV=1 97 281 1.0E-10
sp|Q3T0C2|PGDH_BOVIN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1 94 292 1.0E-10
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 91 282 1.0E-10
sp|Q73SC8|Y4146_MYCPA Uncharacterized NAD-dependent oxidoreductase MAP_4146 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4146 PE=1 SV=1 158 283 2.0E-10
sp|O80713|SDR3A_ARATH Short-chain dehydrogenase reductase 3a OS=Arabidopsis thaliana GN=SDR3a PE=2 SV=1 94 282 2.0E-10
sp|Q93ZA0|NYC1_ARATH Probable chlorophyll(ide) b reductase NYC1, chloroplastic OS=Arabidopsis thaliana GN=NYC1 PE=1 SV=1 66 283 2.0E-10
sp|O74628|YQ53_SCHPO Uncharacterized oxidoreductase C162.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.03 PE=3 SV=1 95 280 2.0E-10
sp|P50205|PHBB_RHIME Acetoacetyl-CoA reductase OS=Rhizobium meliloti (strain 1021) GN=phbB PE=3 SV=1 95 330 2.0E-10
sp|Q48436|BUDC_KLEPN Diacetyl reductase [(S)-acetoin forming] OS=Klebsiella pneumoniae GN=budC PE=1 SV=2 93 283 2.0E-10
sp|P9WGT0|HSD_MYCTO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG3 PE=3 SV=1 94 307 2.0E-10
sp|P43713|FABG_HAEIN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabG PE=3 SV=1 94 282 3.0E-10
sp|Q9ZW19|TRNHC_ARATH Tropinone reductase homolog At2g29360 OS=Arabidopsis thaliana GN=SDR PE=1 SV=1 85 282 3.0E-10
sp|P19871|3BHD_COMTE 3-beta-hydroxysteroid dehydrogenase OS=Comamonas testosteroni PE=1 SV=5 94 283 4.0E-10
sp|P9WGS7|Y0687_MYCTU Uncharacterized NAD-dependent oxidoreductase Rv0687 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0687 PE=1 SV=1 132 283 4.0E-10
sp|P9WGS6|Y0687_MYCTO Uncharacterized NAD-dependent oxidoreductase MT0715 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0715 PE=3 SV=1 132 283 4.0E-10
sp|Q561X9|BDH2_DANRE 3-hydroxybutyrate dehydrogenase type 2 OS=Danio rerio GN=bdh2 PE=2 SV=1 91 281 4.0E-10
sp|O86034|BDHA_RHIME D-beta-hydroxybutyrate dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=bdhA PE=1 SV=1 97 282 5.0E-10
sp|O42866|FABG_SCHPO 3-oxoacyl-[acyl-carrier-protein] reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oar2 PE=3 SV=1 96 283 5.0E-10
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 91 310 5.0E-10
sp|P50204|PHAB_PARDE Acetoacetyl-CoA reductase OS=Paracoccus denitrificans GN=phaB PE=3 SV=1 94 307 5.0E-10
sp|P0C0Y5|MTDH_DAVTA Probable NADP-dependent mannitol dehydrogenase OS=Davidiella tassiana PE=1 SV=1 94 282 6.0E-10
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 92 261 6.0E-10
sp|Q9MYP6|DHB14_BOVIN 17-beta-hydroxysteroid dehydrogenase 14 OS=Bos taurus GN=HSD17B14 PE=2 SV=1 94 283 7.0E-10
sp|Q9M1K9|ATA1_ARATH Short-chain dehydrogenase reductase ATA1 OS=Arabidopsis thaliana GN=TA1 PE=2 SV=1 93 305 7.0E-10
sp|P87218|SOU2_CANAL Sorbose reductase homolog SOU2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU2 PE=3 SV=2 91 282 8.0E-10
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 95 282 8.0E-10
sp|P57432|FABG_BUCAI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabG PE=3 SV=1 173 282 9.0E-10
sp|O02691|HCD2_BOVIN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Bos taurus GN=HSD17B10 PE=1 SV=3 95 283 9.0E-10
sp|P37440|UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 97 300 1.0E-09
sp|Q8XBJ4|UCPA_ECO57 Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 97 300 1.0E-09
sp|Q9X6U2|BDHA_CUPNH D-beta-hydroxybutyrate dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hbdH1 PE=3 SV=2 91 282 1.0E-09
sp|P50206|BPHB_PSES1 Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas sp. (strain KKS102) GN=bphB PE=3 SV=1 89 282 1.0E-09
sp|Q6UWP2|DHR11_HUMAN Dehydrogenase/reductase SDR family member 11 OS=Homo sapiens GN=DHRS11 PE=1 SV=1 85 307 1.0E-09
sp|P0AFP4|YBBO_ECOLI Uncharacterized oxidoreductase YbbO OS=Escherichia coli (strain K12) GN=ybbO PE=3 SV=1 93 299 1.0E-09
sp|P0AFP5|YBBO_ECOL6 Uncharacterized oxidoreductase YbbO OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ybbO PE=3 SV=1 93 299 1.0E-09
sp|Q56840|HCDR_XANP2 2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3 95 282 2.0E-09
sp|Q99714|HCD2_HUMAN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens GN=HSD17B10 PE=1 SV=3 95 283 2.0E-09
sp|Q9RA05|LIMC_RHOER (-)-trans-carveol dehydrogenase OS=Rhodococcus erythropolis GN=limC PE=1 SV=1 94 352 2.0E-09
sp|O49332|TRNHE_ARATH Tropinone reductase homolog At2g30670 OS=Arabidopsis thaliana GN=At2g30670 PE=3 SV=1 97 282 2.0E-09
sp|A0R518|Y6031_MYCS2 Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6031 PE=1 SV=1 94 299 2.0E-09
sp|Q6CEE9|SDR_YARLI Probable NADP-dependent mannitol dehydrogenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0B16192g PE=1 SV=1 91 282 2.0E-09
sp|Q937L4|CPNA_COMTE Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 91 307 2.0E-09
sp|Q8GAV9|CPNA_COMS9 Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 91 307 2.0E-09
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 93 282 2.0E-09
sp|Q56841|HCDS_XANP2 2-(S)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecE PE=1 SV=1 91 279 3.0E-09
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 90 285 3.0E-09
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 90 285 3.0E-09
sp|Q2KIJ5|KDSR_BOVIN 3-ketodihydrosphingosine reductase OS=Bos taurus GN=KDSR PE=2 SV=1 96 319 3.0E-09
sp|A9UM79|DRS7C_XENTR Dehydrogenase/reductase SDR family member 7C OS=Xenopus tropicalis GN=dhrs7c PE=2 SV=1 91 310 3.0E-09
sp|Q9C826|ABA2_ARATH Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN=ABA2 PE=1 SV=1 94 282 3.0E-09
sp|P08074|CBR2_MOUSE Carbonyl reductase [NADPH] 2 OS=Mus musculus GN=Cbr2 PE=1 SV=1 159 261 4.0E-09
sp|P50199|GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 85 282 4.0E-09
sp|O13908|YF3H_SCHPO Uncharacterized oxidoreductase C22A12.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.17c PE=3 SV=1 88 282 5.0E-09
sp|Q1RMJ5|DRS7C_BOVIN Dehydrogenase/reductase SDR family member 7C OS=Bos taurus GN=DHRS7C PE=2 SV=2 94 310 5.0E-09
sp|O00058|MTDH_UROFA Probable NADP-dependent mannitol dehydrogenase OS=Uromyces fabae GN=PIG8 PE=2 SV=1 89 280 5.0E-09
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 91 310 5.0E-09
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 91 310 5.0E-09
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 91 310 5.0E-09
sp|Q05528|KDUD_DICD3 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Dickeya dadantii (strain 3937) GN=kduD PE=1 SV=2 90 280 6.0E-09
sp|P87219|SOU1_CANAL Sorbose reductase SOU1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU1 PE=1 SV=1 88 282 6.0E-09
sp|Q9BPX1|DHB14_HUMAN 17-beta-hydroxysteroid dehydrogenase 14 OS=Homo sapiens GN=HSD17B14 PE=1 SV=1 117 283 7.0E-09
sp|Q9LHT0|TRNHF_ARATH Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana GN=At5g06060 PE=2 SV=1 90 297 7.0E-09
sp|P23238|PHBB_ZOORA Acetoacetyl-CoA reductase OS=Zoogloea ramigera GN=phbB PE=3 SV=1 95 282 7.0E-09
sp|P76633|YGCW_ECOLI Uncharacterized oxidoreductase YgcW OS=Escherichia coli (strain K12) GN=ygcW PE=3 SV=2 88 282 7.0E-09
sp|P50160|TS2_MAIZE Sex determination protein tasselseed-2 OS=Zea mays GN=TS2 PE=2 SV=1 91 283 8.0E-09
sp|Q02207|FOX2_YEAST Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOX2 PE=2 SV=1 86 260 9.0E-09
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 95 287 9.0E-09
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 91 310 1.0E-08
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 89 282 1.0E-08
sp|Q06136|KDSR_HUMAN 3-ketodihydrosphingosine reductase OS=Homo sapiens GN=KDSR PE=1 SV=1 96 372 1.0E-08
sp|O70351|HCD2_RAT 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Rattus norvegicus GN=Hsd17b10 PE=1 SV=3 95 283 1.0E-08
sp|Q3ZBV9|DHR11_BOVIN Dehydrogenase/reductase SDR family member 11 OS=Bos taurus GN=DHRS11 PE=2 SV=1 93 307 1.0E-08
sp|Q6NV34|DECR2_DANRE Peroxisomal 2,4-dienoyl-CoA reductase OS=Danio rerio GN=decr2 PE=2 SV=1 91 279 1.0E-08
sp|E3VWI6|PNTF_STRAE 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces arenae GN=pntF PE=3 SV=1 97 290 1.0E-08
sp|P14697|PHBB_CUPNH Acetoacetyl-CoA reductase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbB PE=1 SV=1 167 287 1.0E-08
sp|Q8RX32|TRNH2_ARATH Tropinone reductase homolog At1g07450 OS=Arabidopsis thaliana GN=At1g07450 PE=2 SV=1 97 282 1.0E-08
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 90 311 1.0E-08
sp|A6NNS2|DRS7C_HUMAN Dehydrogenase/reductase SDR family member 7C OS=Homo sapiens GN=DHRS7C PE=2 SV=3 94 310 1.0E-08
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 91 310 1.0E-08
sp|F1SWA0|ZERSY_ZINZE Zerumbone synthase OS=Zingiber zerumbet GN=ZSD1 PE=1 SV=1 94 282 2.0E-08
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 91 310 2.0E-08
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 91 310 2.0E-08
sp|Q8LEU3|NOL_ARATH Chlorophyll(ide) b reductase NOL, chloroplastic OS=Arabidopsis thaliana GN=NOL PE=1 SV=1 96 307 2.0E-08
sp|Q9N126|RDH8_BOVIN Retinol dehydrogenase 8 OS=Bos taurus GN=RDH8 PE=1 SV=1 96 280 2.0E-08
sp|Q556J2|KDSR_DICDI 3-ketodihydrosphingosine reductase OS=Dictyostelium discoideum GN=ksrA-1 PE=3 SV=1 96 313 2.0E-08
sp|Q7FAE1|MOMAS_ORYSJ Momilactone A synthase OS=Oryza sativa subsp. japonica GN=Os04g0179200 PE=2 SV=1 94 282 2.0E-08
sp|Q29529|CBR2_PIG Carbonyl reductase [NADPH] 2 OS=Sus scrofa GN=CBR2 PE=1 SV=1 168 261 2.0E-08
sp|Q8CHS7|DRS7C_MOUSE Dehydrogenase/reductase SDR family member 7C OS=Mus musculus GN=Dhrs7c PE=1 SV=3 94 310 2.0E-08
sp|P48814|ADH1_CERCA Alcohol dehydrogenase 1 OS=Ceratitis capitata GN=ADH1 PE=3 SV=1 104 306 2.0E-08
sp|Q9SY73|PTALR_ARATH NADPH-dependent pterin aldehyde reductase OS=Arabidopsis thaliana GN=At1g10310 PE=1 SV=1 96 315 2.0E-08
sp|P37769|KDUD_ECOLI 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=kduD PE=1 SV=2 94 280 2.0E-08
sp|P72332|NODG_RHIS3 Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 97 282 3.0E-08
sp|Q9ZW14|TRNH8_ARATH Tropinone reductase homolog At2g29310 OS=Arabidopsis thaliana GN=At2g29310 PE=2 SV=1 97 282 3.0E-08
sp|P23170|25KD_SARPE Development-specific 25 kDa protein OS=Sarcophaga peregrina PE=2 SV=1 88 283 3.0E-08
sp|Q6F7B8|ACR1_ACIAD Fatty acyl-CoA reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=acr1 PE=1 SV=2 94 310 3.0E-08
sp|P50166|ARDH_CANTR D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Candida tropicalis GN=ARD PE=1 SV=1 91 282 3.0E-08
sp|G5DGA8|IDLDH_IPSPI Ipsdienol dehydrogenase OS=Ips pini GN=IDOLDH PE=1 SV=1 88 311 3.0E-08
sp|P43066|ARDH_CANAW D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Candida albicans (strain WO-1) GN=ARD1 PE=3 SV=1 91 282 4.0E-08
sp|Q51576|Y3106_PSEAE Uncharacterized oxidoreductase PA3106 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3106 PE=3 SV=1 94 280 4.0E-08
sp|Q9NYR8|RDH8_HUMAN Retinol dehydrogenase 8 OS=Homo sapiens GN=RDH8 PE=1 SV=1 96 280 5.0E-08
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 88 282 5.0E-08
sp|Q9L9F8|NOVJ_STRNV Short-chain reductase protein NovJ OS=Streptomyces niveus GN=novJ PE=1 SV=1 93 282 5.0E-08
sp|O75452|RDH16_HUMAN Retinol dehydrogenase 16 OS=Homo sapiens GN=RDH16 PE=1 SV=2 85 301 5.0E-08
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 173 304 5.0E-08
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 89 260 5.0E-08
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 95 282 8.0E-08
sp|P16542|DHK1_STRVN Granaticin polyketide synthase putative ketoacyl reductase 1 OS=Streptomyces violaceoruber GN=gra-orf5 PE=3 SV=1 95 282 1.0E-07
sp|Q70UN9|ADH1_CERCO Alcohol dehydrogenase 1 OS=Ceratitis cosyra GN=ADH1 PE=3 SV=1 96 306 1.0E-07
sp|Q02337|BDH_BOVIN D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Bos taurus GN=BDH1 PE=1 SV=2 91 287 1.0E-07
sp|O08756|HCD2_MOUSE 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Mus musculus GN=Hsd17b10 PE=1 SV=4 95 283 1.0E-07
sp|Q9BUT1|BDH2_HUMAN 3-hydroxybutyrate dehydrogenase type 2 OS=Homo sapiens GN=BDH2 PE=1 SV=2 91 281 1.0E-07
sp|Q9ZW16|TRNHA_ARATH Tropinone reductase homolog At2g29330 OS=Arabidopsis thaliana GN=TRI PE=1 SV=1 97 282 1.0E-07
sp|P9WGP9|SADH_MYCTU Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sadH PE=2 SV=1 94 282 1.0E-07
sp|P9WGP8|SADH_MYCTO Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sadH PE=3 SV=1 94 282 1.0E-07
sp|P66776|BUTA_STAAW Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MW2) GN=butA PE=3 SV=1 94 282 2.0E-07
sp|Q6GCZ8|BUTA_STAAS Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MSSA476) GN=butA PE=3 SV=1 94 282 2.0E-07
sp|Q6GKH9|BUTA_STAAR Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MRSA252) GN=butA PE=3 SV=1 94 282 2.0E-07
sp|P99120|BUTA_STAAN Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain N315) GN=butA PE=1 SV=1 94 282 2.0E-07
sp|P66775|BUTA_STAAM Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=butA PE=3 SV=1 94 282 2.0E-07
sp|Q5HJP2|BUTA_STAAC Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain COL) GN=butA PE=3 SV=1 94 282 2.0E-07
sp|Q3U0B3|DHR11_MOUSE Dehydrogenase/reductase SDR family member 11 OS=Mus musculus GN=Dhrs11 PE=1 SV=1 93 307 2.0E-07
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 69 280 2.0E-07
sp|O32184|YUSR_BACSU Short-chain dehydrogenase/reductase homolog YusR OS=Bacillus subtilis (strain 168) GN=yusR PE=5 SV=1 204 311 2.0E-07
sp|P9WGQ5|Y927C_MYCTU Uncharacterized oxidoreductase Rv0927c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0927c PE=1 SV=1 91 307 2.0E-07
sp|P9WGQ4|Y927C_MYCTO Uncharacterized oxidoreductase MT0954 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0954 PE=3 SV=1 91 307 2.0E-07
sp|Q9NAR7|ADH_BACOL Alcohol dehydrogenase OS=Bactrocera oleae GN=ADH PE=2 SV=1 96 292 2.0E-07
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 94 283 3.0E-07
sp|Q5BL28|DS7CB_DANRE Dehydrogenase/reductase SDR family member 7C-B OS=Danio rerio GN=dhrs7cb PE=2 SV=1 58 327 3.0E-07
sp|Q6GV12|KDSR_MOUSE 3-ketodihydrosphingosine reductase OS=Mus musculus GN=Kdsr PE=1 SV=1 96 323 3.0E-07
sp|Q988B7|PLDH_RHILO Pyridoxal 4-dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=pldh-t PE=1 SV=1 91 280 3.0E-07
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 69 280 4.0E-07
sp|O34717|FADH_BACSU Probable 2,4-dienoyl-CoA reductase OS=Bacillus subtilis (strain 168) GN=fadH PE=2 SV=1 93 276 4.0E-07
sp|P50171|DHB8_MOUSE Estradiol 17-beta-dehydrogenase 8 OS=Mus musculus GN=Hsd17b8 PE=1 SV=2 119 282 4.0E-07
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 67 282 5.0E-07
sp|Q8KES3|SPRE_CHLTE Sepiapterin reductase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0609 PE=1 SV=1 93 309 5.0E-07
sp|Q7Z9I3|YCP8_SCHPO Uncharacterized oxidoreductase C663.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.08c PE=3 SV=1 94 280 5.0E-07
sp|O34782|YVRD_BACSU Uncharacterized oxidoreductase YvrD OS=Bacillus subtilis (strain 168) GN=yvrD PE=3 SV=1 89 275 6.0E-07
sp|P9WGQ7|Y1144_MYCTU Uncharacterized oxidoreductase Rv1144 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1144 PE=1 SV=1 93 283 7.0E-07
sp|P9WGQ6|Y1144_MYCTO Uncharacterized oxidoreductase MT1177 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1177 PE=3 SV=1 93 283 7.0E-07
sp|P66780|Y1570_MYCBO Uncharacterized oxidoreductase Mb1570 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1570 PE=3 SV=1 94 310 9.0E-07
sp|P9WGS1|Y1543_MYCTU Uncharacterized oxidoreductase Rv1543 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1543 PE=1 SV=1 94 310 9.0E-07
sp|P9WGS0|Y1543_MYCTO Uncharacterized oxidoreductase MT1595 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1595 PE=3 SV=1 94 310 9.0E-07
sp|F4IKM1|TRNHB_ARATH Tropinone reductase homolog At2g29340 OS=Arabidopsis thaliana GN=At2g29340 PE=2 SV=1 97 282 9.0E-07
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 67 282 1.0E-06
sp|P0AG84|YGHA_ECOLI Uncharacterized oxidoreductase YghA OS=Escherichia coli (strain K12) GN=yghA PE=1 SV=1 91 282 1.0E-06
sp|P0AG85|YGHA_ECO57 Uncharacterized oxidoreductase YghA OS=Escherichia coli O157:H7 GN=yghA PE=3 SV=1 91 282 1.0E-06
sp|Q80XN0|BDH_MOUSE D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Mus musculus GN=Bdh1 PE=1 SV=2 94 278 1.0E-06
sp|Q46381|BPHB_COMTE Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Comamonas testosteroni GN=bphB PE=1 SV=1 94 282 1.0E-06
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 94 282 1.0E-06
sp|Q5ZJZ5|BDH_CHICK D-beta-hydroxybutyrate dehydrogenase, mitochondrial OS=Gallus gallus GN=BDH1 PE=2 SV=1 126 278 1.0E-06
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 88 261 1.0E-06
sp|P72220|BPHB_PSEPU Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas putida GN=bphB PE=3 SV=1 94 282 1.0E-06
sp|P50170|RDH2_RAT Retinol dehydrogenase 2 OS=Rattus norvegicus GN=Rdh2 PE=1 SV=1 64 292 1.0E-06
sp|P80869|DHG2_BACSU Glucose 1-dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=ycdF PE=1 SV=2 90 280 2.0E-06
sp|G0RNA2|LXR4_HYPJQ L-xylo-3-hexulose reductase OS=Hypocrea jecorina (strain QM6a) GN=lxr4 PE=1 SV=1 94 261 2.0E-06
sp|Q5RBV3|DECR2_PONAB Peroxisomal 2,4-dienoyl-CoA reductase OS=Pongo abelii GN=DECR2 PE=2 SV=1 91 279 2.0E-06
sp|P70720|FABG_AGGAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aggregatibacter actinomycetemcomitans GN=fabG PE=3 SV=1 94 283 2.0E-06
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 91 310 2.0E-06
sp|Q84ST4|NOL_ORYSJ Chlorophyll(ide) b reductase NOL, chloroplastic OS=Oryza sativa subsp. japonica GN=NOL PE=1 SV=1 96 350 2.0E-06
sp|A8E5C5|DS7CA_DANRE Dehydrogenase/reductase SDR family member 7C-A OS=Danio rerio GN=dhrs7ca PE=2 SV=1 93 271 3.0E-06
sp|P0AET8|HDHA_ECOLI 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli (strain K12) GN=hdhA PE=1 SV=1 97 289 3.0E-06
sp|P0AET9|HDHA_ECO57 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli O157:H7 GN=hdhA PE=3 SV=1 97 289 3.0E-06
sp|Q9WVK3|PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 91 278 3.0E-06
sp|Q9ZW15|TRNH9_ARATH Tropinone reductase homolog At2g29320 OS=Arabidopsis thaliana GN=At2g29320 PE=2 SV=1 87 260 3.0E-06
sp|Q5XG41|DH12A_XENLA Very-long-chain 3-oxoacyl-CoA reductase-A OS=Xenopus laevis GN=hsd17b12-a PE=2 SV=1 97 272 3.0E-06
sp|Q9XT00|DHB8_PIG Estradiol 17-beta-dehydrogenase 8 OS=Sus scrofa GN=HSD17B8 PE=3 SV=2 119 297 3.0E-06
sp|P06234|NODG_RHIME Nodulation protein G OS=Rhizobium meliloti (strain 1021) GN=nodG PE=3 SV=1 97 282 3.0E-06
sp|P47227|BPHB_BURXL Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=bphB PE=1 SV=1 94 282 3.0E-06
sp|Q9NUI1|DECR2_HUMAN Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens GN=DECR2 PE=1 SV=1 91 279 3.0E-06
sp|P50167|ARDH_PICST D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ARDH PE=2 SV=1 97 282 4.0E-06
sp|Q9S9W2|SDRA_ARATH Short-chain dehydrogenase/reductase SDRA OS=Arabidopsis thaliana GN=SDRA PE=1 SV=1 94 280 5.0E-06
sp|O14756|H17B6_HUMAN 17-beta-hydroxysteroid dehydrogenase type 6 OS=Homo sapiens GN=HSD17B6 PE=1 SV=1 65 282 5.0E-06
sp|P9WGQ9|Y769_MYCTU Uncharacterized oxidoreductase Rv0769 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0769 PE=1 SV=1 93 304 6.0E-06
sp|P9WGQ8|Y769_MYCTO Uncharacterized oxidoreductase MT0793 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0793 PE=3 SV=1 93 304 6.0E-06
sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 84 282 7.0E-06
sp|Q53882|DNRE_STRS5 Aklaviketone reductase DauE OS=Streptomyces sp. (strain C5) GN=dauE PE=1 SV=1 96 280 9.0E-06
sp|P9WGR7|Y945_MYCTU Uncharacterized oxidoreductase Rv0945 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0945 PE=1 SV=1 88 311 9.0E-06
sp|P9WGR6|Y945_MYCTO Uncharacterized oxidoreductase MT0971 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0971 PE=3 SV=1 88 311 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 58 75 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|699
MPDTKNFPRPPQRDSWFAPLSVDLLLRVLNVTLLHPFVCWMIPLCFRAQTVKWEATRMLVSIAWASLVTLAWLAN
RVNQRLAHGRPRLVDLGEEVIVITGGASGLGMLVAEVYGMRGATVAVLDVKDMENGEARGVTYYKCDVSDKAQVV
KAAADIERDLTVPSVCQLGTPTVLINNAAVVVGKPLLDLTLAEIDSSLATNLLGPFYCLKAFLPAIVRSGRGGTI
VNISSVIGHLGAARLTDYAAAKAGLTAMHRSLSAELRDSHPDIRTVLITPGQLSTPLFYGVQTPNSFLAPVVEPV
DVAKEIIAAIDGGSGVTAGMPLYARWVDWYNVLPVGLQVLARKLSGVDRGMTSFIGRRGIEDALKKREKSESKST
*
Coding >Hirsu2|699
ATGCCGGACACGAAAAACTTCCCGCGGCCGCCGCAGCGCGACTCGTGGTTCGCGCCCCTGTCGGTCGACCTGCTG
CTGCGCGTGCTCAACGTCACCTTGCTGCACCCCTTCGTCTGCTGGATGATCCCGCTGTGCTTCCGCGCCCAGACG
GTCAAGTGGGAGGCGACGCGCATGCTCGTCTCCATCGCCTGGGCCTCGCTCGTCACGCTCGCCTGGCTGGCCAAC
CGGGTCAACCAGCGGCTGGCCCACGGCCGGCCCCGGCTGGTGGACCTGGGCGAGGAGGTCATCGTCATCACCGGC
GGCGCCAGCGGTCTGGGCATGCTGGTCGCCGAGGTCTACGGCATGCGCGGCGCCACCGTCGCCGTGCTGGACGTC
AAGGACATGGAGAACGGCGAGGCCCGCGGCGTCACCTACTACAAGTGCGACGTCAGCGACAAGGCCCAGGTCGTC
AAGGCCGCGGCCGACATTGAGAGAGACCTTACCGTGCCGTCCGTCTGCCAGCTCGGGACGCCGACGGTGCTCATC
AACAACGCGGCCGTCGTCGTCGGCAAGCCGTTGCTCGACCTGACCTTGGCCGAGATCGACAGCAGCCTCGCCACC
AACCTGCTCGGGCCCTTCTACTGCCTCAAGGCCTTCCTCCCGGCCATCGTCCGCTCCGGCCGCGGCGGCACCATC
GTCAACATCTCGTCCGTCATCGGCCACCTCGGCGCCGCCCGGCTGACCGACTACGCCGCCGCCAAGGCCGGCCTC
ACCGCCATGCACCGCTCCCTGTCGGCCGAGCTGCGCGACTCCCACCCCGACATCCGCACCGTGCTCATCACCCCG
GGCCAGCTCAGCACCCCGCTCTTCTACGGCGTCCAGACGCCCAACTCCTTCCTGGCGCCCGTCGTCGAGCCGGTC
GACGTGGCCAAGGAGATCATCGCCGCCATCGACGGCGGCTCCGGCGTCACCGCCGGCATGCCCCTGTACGCCCGC
TGGGTCGACTGGTACAACGTGTTGCCCGTCGGCTTGCAGGTCTTGGCCAGGAAGCTGTCCGGCGTCGACCGGGGC
ATGACCTCCTTTATCGGGAGGAGGGGCATCGAGGACGCGCTGAAGAAGAGGGAAAAGTCCGAGTCCAAGTCGACA
TAG
Transcript >Hirsu2|699
ATGCCGGACACGAAAAACTTCCCGCGGCCGCCGCAGCGCGACTCGTGGTTCGCGCCCCTGTCGGTCGACCTGCTG
CTGCGCGTGCTCAACGTCACCTTGCTGCACCCCTTCGTCTGCTGGATGATCCCGCTGTGCTTCCGCGCCCAGACG
GTCAAGTGGGAGGCGACGCGCATGCTCGTCTCCATCGCCTGGGCCTCGCTCGTCACGCTCGCCTGGCTGGCCAAC
CGGGTCAACCAGCGGCTGGCCCACGGCCGGCCCCGGCTGGTGGACCTGGGCGAGGAGGTCATCGTCATCACCGGC
GGCGCCAGCGGTCTGGGCATGCTGGTCGCCGAGGTCTACGGCATGCGCGGCGCCACCGTCGCCGTGCTGGACGTC
AAGGACATGGAGAACGGCGAGGCCCGCGGCGTCACCTACTACAAGTGCGACGTCAGCGACAAGGCCCAGGTCGTC
AAGGCCGCGGCCGACATTGAGAGAGACCTTACCGTGCCGTCCGTCTGCCAGCTCGGGACGCCGACGGTGCTCATC
AACAACGCGGCCGTCGTCGTCGGCAAGCCGTTGCTCGACCTGACCTTGGCCGAGATCGACAGCAGCCTCGCCACC
AACCTGCTCGGGCCCTTCTACTGCCTCAAGGCCTTCCTCCCGGCCATCGTCCGCTCCGGCCGCGGCGGCACCATC
GTCAACATCTCGTCCGTCATCGGCCACCTCGGCGCCGCCCGGCTGACCGACTACGCCGCCGCCAAGGCCGGCCTC
ACCGCCATGCACCGCTCCCTGTCGGCCGAGCTGCGCGACTCCCACCCCGACATCCGCACCGTGCTCATCACCCCG
GGCCAGCTCAGCACCCCGCTCTTCTACGGCGTCCAGACGCCCAACTCCTTCCTGGCGCCCGTCGTCGAGCCGGTC
GACGTGGCCAAGGAGATCATCGCCGCCATCGACGGCGGCTCCGGCGTCACCGCCGGCATGCCCCTGTACGCCCGC
TGGGTCGACTGGTACAACGTGTTGCCCGTCGGCTTGCAGGTCTTGGCCAGGAAGCTGTCCGGCGTCGACCGGGGC
ATGACCTCCTTTATCGGGAGGAGGGGCATCGAGGACGCGCTGAAGAAGAGGGAAAAGTCCGAGTCCAAGTCGACA
TAG
Gene >Hirsu2|699
ATGCCGGACACGAAAAACTTCCCGCGGCCGCCGCAGCGCGACTCGTGGTTCGCGCCCCTGTCGGTCGACCTGCTG
CTGCGCGTGCTCAACGTCACCTTGCTGCACCCCTTCGTCTGCTGGATGATCCCGCTGTGCTTCCGCGCCCAGACG
GTCAAGTGGGAGGCGACGCGCATGCTCGTCTCCATCGCCTGGGCCTCGCTCGTCACGCTCGCCTGGCTGGCCAAC
CGGGTCAACCAGCGGCTGGCCCACGGCCGGCCCCGGCTGGTGGACCTGGGCGAGGAGGTCATCGTCATCACCGGC
GGCGCCAGCGGTCTGGGCATGCTGGTCGCCGAGGTCTACGGCATGCGCGGCGCCACCGTCGCCGTGCTGGACGTC
AAGGACATGGAGAACGGCGAGGCCCGCGGCGTCACCTACTACAAGTGCGACGTCAGCGACAAGGCCCAGGTCGTC
AAGGCCGCGGCCGACATTGAGAGAGACGTGAGTTGCTCAGCCTTCGTCGCACAGCCTCCCCCCCCTCCTCTCCCC
TCTGGCCGCTGCGCCGTGCTCGCGCCGCCAAGCTTACCGTGCCGTCCGTCTGCCAGCTCGGGACGCCGACGGTGC
TCATCAACAACGCGGCCGTCGTCGTCGGCAAGCCGTTGCTCGACCTGACCTTGGCCGAGATCGACAGCAGCCTCG
CCACCAACCTGCTCGGGCCCTTCTACTGCCTCAAGGCCTTCCTCCCGGCCATCGTCCGCTCCGGCCGCGGCGGCA
CCATCGTCAACATCTCGTCCGTCATCGGCCACCTCGGCGCCGCCCGGCTGACCGACTACGCCGCCGCCAAGGCCG
GCCTCACCGCCATGCACCGCTCCCTGTCGGCCGAGCTGCGCGACTCCCACCCCGACATCCGCACCGTGCTCATCA
CCCCGGGCCAGCTCAGCACCCCGCTCTTCTACGGCGTCCAGACGCCCAACTCCTTCCTGGCGCCCGTCGTCGAGC
CGGTCGACGTGGCCAAGGAGATCATCGCCGCCATCGACGGCGGCTCCGGCGTCACCGCCGGCATGCCCCTGTACG
CCCGCTGGGTCGACTGGTACAACGTGTTGCCCGTCGGCTTGCAGGTCTTGGCCAGGAAGCTGTCCGGCGTCGACC
GGGGCATGACCTCCTTTATCGGGAGGAGGGGCATCGAGGACGCGCTGAAGAAGAGGGAAAAGTCCGAGTCCAAGT
CGACATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail