Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6987
Gene name
LocationContig_384:2030..3631
Strand-
Gene length (bp)1601
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05653 Mg_trans_NIPA Magnesium transporter NIPA 1.2E-14 15 308

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8RWF4|NIPA8_ARATH Probable magnesium transporter NIPA8 OS=Arabidopsis thaliana GN=At3g26670 PE=2 SV=1 11 305 5.0E-13
sp|Q9LIR9|NIPA1_ARATH Probable magnesium transporter NIPA1 OS=Arabidopsis thaliana GN=At3g23870 PE=2 SV=1 44 308 8.0E-09
sp|B3LFA3|NIPA2_ARATH Probable magnesium transporter NIPA2 OS=Arabidopsis thaliana GN=At4g13800 PE=2 SV=1 59 308 2.0E-08

GO

GO Term Description Terminal node
GO:0015693 magnesium ion transport Yes
GO:0016021 integral component of membrane Yes
GO:0015095 magnesium ion transmembrane transporter activity Yes
GO:0008324 cation transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0046873 metal ion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0072511 divalent inorganic cation transport No
GO:0006812 cation transport No
GO:0070838 divalent metal ion transport No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0006811 ion transport No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0030001 metal ion transport No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 59 81 22
3 86 105 19
4 112 134 22
5 154 176 22
6 227 249 22
7 259 281 22
8 288 310 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6987
MGSLGGISPGGSIALGILVGLMSTSVQSLGLTLQRKSHILEDEKGPHDVRRPPYRRRRWQLGMAMFIIANLLGST
VQISTLPLPVLSTLQAAGLVFNSICATLILSEPFTRWSLCGTVLVTTGAILIAIFGAIPSPAHNLDELLELLARK
PFVAWMILQAFFVVGIAVVVDVVNSMSSLSHNSRFRLVRGIMYGVISGDLSAHALLFAKSAVELIIKTIGGNNQF
SHWASWMIVLALVALALCQLYYLHRGLKLVSTSVLYPLVFCVYNIVAILDGLIYFNQTGLISPLRACLITLGTII
LLSGVLALSWRLSDEQHPPGVGQSTLAPGLGLVEDTEGEEESLLGSEAAVEDDVTPTYQTFPAVDGETTPMTPTR
KKTFRWLERAEIWGELEDQREAATPIGRLRSSTVPGRTELSPLLSSARRAGSGSSETVEAGPSSESTPRRAGRRR
RRSTGFPGLVARKHLRRSSSTSGSLRNMLSLGWWTNRGSRGSVSSFSRSQARDRDPEGDG*
Coding >Hirsu2|6987
ATGGGATCTTTGGGTGGCATCTCCCCCGGCGGGAGCATAGCTCTCGGGATCCTCGTCGGTCTGATGTCGACCAGC
GTCCAGAGCCTCGGCCTGACGCTGCAGCGCAAGTCGCATATCCTCGAAGACGAAAAGGGCCCGCACGACGTGCGC
CGCCCGCCCTACCGACGGCGGCGATGGCAGCTGGGCATGGCCATGTTCATCATTGCCAATCTGCTGGGGAGCACG
GTGCAGATCTCGACGCTGCCGCTGCCCGTCCTCTCCACCCTCCAGGCCGCGGGCCTGGTCTTCAACTCGATATGC
GCCACGCTGATCCTCAGCGAGCCCTTCACACGCTGGTCCCTCTGCGGCACCGTCCTCGTCACGACCGGGGCCATC
CTCATCGCCATCTTCGGCGCCATTCCCTCTCCCGCCCACAACCTGGATGAGCTTCTGGAACTGCTGGCCCGAAAG
CCCTTTGTCGCGTGGATGATTCTCCAGGCGTTCTTCGTCGTCGGCATCGCCGTCGTCGTAGACGTCGTCAACAGC
ATGTCCAGCCTCTCGCACAATTCCCGGTTCCGCCTGGTGCGCGGCATCATGTACGGCGTCATCAGCGGCGACCTG
TCCGCCCACGCGCTGCTCTTCGCCAAATCCGCCGTCGAGCTCATCATCAAGACCATCGGCGGCAACAACCAGTTC
TCCCACTGGGCCTCGTGGATGATCGTCCTGGCGCTCGTCGCCCTGGCGCTGTGCCAGCTATACTACCTCCATCGT
GGCCTGAAACTCGTCTCCACGTCGGTCCTCTACCCCCTCGTGTTCTGCGTCTACAACATCGTCGCCATCCTCGAC
GGCTTAATATACTTCAACCAGACGGGCCTCATATCGCCGCTGCGCGCCTGTCTCATCACGCTCGGGACCATCATC
CTGCTGTCGGGCGTCCTGGCCCTGTCGTGGCGGCTGAGCGACGAGCAGCACCCGCCGGGCGTCGGCCAGTCGACG
CTGGCGCCCGGGCTGGGCCTCGTCGAGGACACGGAGGGGGAGGAAGAATCGCTGCTCGGGTCGGAGGCGGCGGTC
GAGGACGACGTGACGCCGACGTACCAGACGTTTCCGGCCGTCGACGGCGAGACGACGCCGATGACGCCGACGCGC
AAGAAGACGTTCCGCTGGCTCGAACGCGCCGAGATCTGGGGCGAGCTGGAGGACCAACGAGAGGCGGCGACGCCG
ATCGGCAGGCTGCGGTCGAGCACCGTGCCCGGCCGGACCGAGCTCTCGCCCCTGCTGTCGAGCGCGCGGAGAGCG
GGAAGCGGCTCGTCGGAGACGGTCGAGGCGGGACCCAGCTCGGAGTCGACACCCCGGAGGGCCGGCCGGCGGCGG
AGAAGGAGCACCGGATTCCCCGGGCTGGTGGCGCGGAAGCACCTGAGGCGAAGCTCGTCGACGTCGGGCTCGCTG
CGCAACATGCTTTCGCTGGGCTGGTGGACGAACCGAGGCAGCCGTGGGTCGGTCAGCAGCTTCTCACGATCACAG
GCCCGAGATCGCGACCCGGAAGGAGACGGGTAG
Transcript >Hirsu2|6987
ATGGGATCTTTGGGTGGCATCTCCCCCGGCGGGAGCATAGCTCTCGGGATCCTCGTCGGTCTGATGTCGACCAGC
GTCCAGAGCCTCGGCCTGACGCTGCAGCGCAAGTCGCATATCCTCGAAGACGAAAAGGGCCCGCACGACGTGCGC
CGCCCGCCCTACCGACGGCGGCGATGGCAGCTGGGCATGGCCATGTTCATCATTGCCAATCTGCTGGGGAGCACG
GTGCAGATCTCGACGCTGCCGCTGCCCGTCCTCTCCACCCTCCAGGCCGCGGGCCTGGTCTTCAACTCGATATGC
GCCACGCTGATCCTCAGCGAGCCCTTCACACGCTGGTCCCTCTGCGGCACCGTCCTCGTCACGACCGGGGCCATC
CTCATCGCCATCTTCGGCGCCATTCCCTCTCCCGCCCACAACCTGGATGAGCTTCTGGAACTGCTGGCCCGAAAG
CCCTTTGTCGCGTGGATGATTCTCCAGGCGTTCTTCGTCGTCGGCATCGCCGTCGTCGTAGACGTCGTCAACAGC
ATGTCCAGCCTCTCGCACAATTCCCGGTTCCGCCTGGTGCGCGGCATCATGTACGGCGTCATCAGCGGCGACCTG
TCCGCCCACGCGCTGCTCTTCGCCAAATCCGCCGTCGAGCTCATCATCAAGACCATCGGCGGCAACAACCAGTTC
TCCCACTGGGCCTCGTGGATGATCGTCCTGGCGCTCGTCGCCCTGGCGCTGTGCCAGCTATACTACCTCCATCGT
GGCCTGAAACTCGTCTCCACGTCGGTCCTCTACCCCCTCGTGTTCTGCGTCTACAACATCGTCGCCATCCTCGAC
GGCTTAATATACTTCAACCAGACGGGCCTCATATCGCCGCTGCGCGCCTGTCTCATCACGCTCGGGACCATCATC
CTGCTGTCGGGCGTCCTGGCCCTGTCGTGGCGGCTGAGCGACGAGCAGCACCCGCCGGGCGTCGGCCAGTCGACG
CTGGCGCCCGGGCTGGGCCTCGTCGAGGACACGGAGGGGGAGGAAGAATCGCTGCTCGGGTCGGAGGCGGCGGTC
GAGGACGACGTGACGCCGACGTACCAGACGTTTCCGGCCGTCGACGGCGAGACGACGCCGATGACGCCGACGCGC
AAGAAGACGTTCCGCTGGCTCGAACGCGCCGAGATCTGGGGCGAGCTGGAGGACCAACGAGAGGCGGCGACGCCG
ATCGGCAGGCTGCGGTCGAGCACCGTGCCCGGCCGGACCGAGCTCTCGCCCCTGCTGTCGAGCGCGCGGAGAGCG
GGAAGCGGCTCGTCGGAGACGGTCGAGGCGGGACCCAGCTCGGAGTCGACACCCCGGAGGGCCGGCCGGCGGCGG
AGAAGGAGCACCGGATTCCCCGGGCTGGTGGCGCGGAAGCACCTGAGGCGAAGCTCGTCGACGTCGGGCTCGCTG
CGCAACATGCTTTCGCTGGGCTGGTGGACGAACCGAGGCAGCCGTGGGTCGGTCAGCAGCTTCTCACGATCACAG
GCCCGAGATCGCGACCCGGAAGGAGACGGGTAG
Gene >Hirsu2|6987
ATGGGATCTTTGGGTGGCATCTCCCCCGGCGGGAGCATAGCTGTATGCCCCGGCCGCCCGTACCGCGACGCGCGG
CTGCCCGCTCTCTGCTAACGACACGGTCGCGACAGCTCGGGATCCTCGTCGGTCTGATGTCGACCAGCGTCCAGA
GCCTCGGCCTGACGCTGCAGCGCAAGTCGCATATCCTCGAAGACGAAAAGGGCCCGCACGACGTGCGCCGCCCGC
CCTACCGACGGCGGCGATGGCAGCTGGGCATGGCCATGTTCATCATTGCCAATCTGCTGGGGAGCACGGTGCAGA
TCTCGACGCTGCCGCTGCCCGTCCTCTCCACCCTCCAGGCCGCGGGCCTGGTCTTCAACTCGATATGCGCCACGC
TGATCCTCAGCGAGCCCTTCACACGCTGGTCCCTCTGCGGCACCGTCCTCGTCACGACCGGGGCCATCCTCATCG
CCATCTTCGGCGCCATTCCCTCTCCCGCCCACAACCTGGATGAGCTTCTGGAACTGCTGGCCCGAAAGCCCTTTG
TCGCGTGGATGATTCTCCAGGCGTTCTTCGTCGTCGGCATCGCCGTCGTCGTAGACGTCGTCAACAGCATGTCCA
GCCTCTCGCACAATTCCCGGTTCCGCCTGGTGCGCGGCATCATGTACGGCGTCATCAGCGGCGACCTGTCCGCCC
ACGCGCTGCTCTTCGCCAAATCCGCCGTCGAGCTCATCATCAAGACCATCGGCGGCAACAACCAGTTCTCCCACT
GGGCCTCGTGGATGATCGTCCTGGCGCTCGTCGCCCTGGCGCTGTGCCAGCTATACTACCTCCATCGTGGCCTGA
AACTCGTCTCCACGTCGGTCCTCTACCCCCTCGTGTTCTGCGTCTACAACATCGTCGCCATCCTCGACGGCTTAA
TATACTTCAACCAGACGGGCCTCATATCGCCGCTGCGCGCCTGTCTCATCACGCTCGGGACCATCATCCTGCTGT
CGGGCGTCCTGGCCCTGTCGTGGCGGCTGAGCGACGAGCAGCACCCGCCGGGCGTCGGCCAGTCGACGCTGGCGC
CCGGGCTGGGCCTCGTCGAGGACACGGAGGGGGAGGAAGAATCGCTGCTCGGGTCGGAGGCGGCGGTCGAGGACG
ACGTGACGCCGACGTACCAGACGTTTCCGGCCGTCGACGGCGAGACGACGCCGATGACGCCGACGCGCAAGAAGA
CGTTCCGCTGGCTCGAACGCGCCGAGATCTGGGGCGAGCTGGAGGACCAACGAGAGGCGGCGACGCCGATCGGCA
GGCTGCGGTCGAGCACCGTGCCCGGCCGGACCGAGCTCTCGCCCCTGCTGTCGAGCGCGCGGAGAGCGGGAAGCG
GCTCGTCGGAGACGGTCGAGGCGGGACCCAGCTCGGAGTCGACACCCCGGAGGGCCGGCCGGCGGCGGAGAAGGA
GCACCGGATTCCCCGGGCTGGTGGCGCGGAAGCACCTGAGGCGAAGCTCGTCGACGTCGGGCTCGCTGCGCAACA
TGCTTTCGCTGGGCTGGTGGACGAACCGAGGCAGCCGTGGGTCGGTCAGCAGCTTCTCACGATCACAGGCCCGAG
ATCGCGACCCGGAAGGAGACGGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail