Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6985
Gene name
LocationContig_383:19837..21224
Strand+
Gene length (bp)1387
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.7E-11 118 312

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 101 317 8.0E-30
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 99 317 6.0E-29
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 97 312 1.0E-26
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 101 317 5.0E-26
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 99 312 8.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 101 317 8.0E-30
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 99 317 6.0E-29
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 97 312 1.0E-26
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 101 317 5.0E-26
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 99 312 8.0E-26
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 101 317 8.0E-25
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 100 317 8.0E-22
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 103 317 8.0E-22
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 103 286 6.0E-21
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 98 317 4.0E-17
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 99 321 5.0E-17
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 103 317 2.0E-16
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 101 311 2.0E-16
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 98 317 3.0E-16
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 105 311 4.0E-14
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 99 311 6.0E-12
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 39 317 4.0E-11
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 99 317 5.0E-11
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 101 311 2.0E-10
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 78 300 6.0E-10
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 188 317 6.0E-10
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 99 311 1.0E-08
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 106 311 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 114 133 19
2 153 175 22
3 182 204 22
4 208 230 22
5 242 264 22
6 274 296 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6985
MPTYGGRSPSPLLSRGGAVSPSFAQTGAEFILDDDDDDDDDDDDDEFYDDDDPRSEGGRQDAYEMVASGDRHGTG
ERMAHGRGLKQSAIATVSSRQLYTAEEERAVVKKLDRKLVLFVALLYMLSFLDRSNIGNARIAGMDRDLQTQPPR
DDWYEWALTAFYLSYIAFEWMSLLWRLIPAHVFITALVLSWGLASSLQGVAPSYPVLVALRALLGIGEAGFTGIP
FYLSFFFRREELAFRTAMFISAAPLATSFASALAWAVVRLAQLGPIAPWRLLFLVEGFPSVVASVASWSAIPDCP
RTARFLTERERKAASGRPGSTGGTWQPCWPTRSPGWRP*
Coding >Hirsu2|6985
ATGCCAACCTACGGCGGCCGTTCGCCGAGCCCCCTGCTGAGTCGCGGGGGCGCCGTGTCGCCGTCGTTTGCCCAG
ACGGGGGCCGAGTTTATACTCGATGACGACGATGACGACGACGACGATGACGACGACGACGAGTTTTATGACGAC
GACGACCCGCGCTCCGAAGGCGGCCGGCAGGATGCGTACGAGATGGTCGCGAGCGGCGACCGGCACGGTACTGGC
GAGAGGATGGCCCACGGACGGGGGCTTAAGCAGAGCGCGATCGCGACTGTAAGCTCCCGGCAGCTGTACACGGCC
GAGGAGGAGCGCGCGGTGGTGAAGAAGCTCGATCGCAAGCTGGTGCTCTTTGTGGCGCTGCTGTACATGCTCAGC
TTCCTCGATCGGTCCAACATCGGAAACGCCCGCATAGCCGGCATGGACCGCGACCTCCAGACCCAGCCGCCGCGC
GACGACTGGTACGAGTGGGCGCTGACGGCCTTTTATCTCTCGTACATTGCCTTCGAGTGGATGTCGCTGCTGTGG
AGGCTGATACCCGCCCACGTCTTCATCACGGCCCTCGTCCTGTCGTGGGGCCTCGCCTCCTCGCTACAGGGCGTC
GCGCCGTCGTATCCTGTGCTCGTCGCCCTGCGCGCCCTGCTCGGCATCGGCGAGGCCGGCTTCACCGGCATCCCC
TTCTACCTCAGCTTCTTCTTCAGGAGAGAGGAGCTGGCGTTTCGGACGGCCATGTTCATTTCCGCTGCTCCCTTA
GCCACGAGCTTCGCCTCGGCCCTTGCCTGGGCCGTCGTCCGGCTCGCCCAGCTGGGCCCCATCGCGCCGTGGCGG
CTGCTCTTCCTCGTCGAGGGCTTCCCCTCGGTCGTCGCCTCCGTCGCCTCCTGGTCCGCCATCCCCGACTGCCCC
CGGACGGCGCGCTTCCTGACGGAGCGCGAGAGGAAGGCGGCAAGCGGGCGTCCGGGCTCGACGGGCGGGACGTGG
CAGCCGTGCTGGCCGACCCGGTCGCCTGGCTGGCGGCCGTGA
Transcript >Hirsu2|6985
ATGCCAACCTACGGCGGCCGTTCGCCGAGCCCCCTGCTGAGTCGCGGGGGCGCCGTGTCGCCGTCGTTTGCCCAG
ACGGGGGCCGAGTTTATACTCGATGACGACGATGACGACGACGACGATGACGACGACGACGAGTTTTATGACGAC
GACGACCCGCGCTCCGAAGGCGGCCGGCAGGATGCGTACGAGATGGTCGCGAGCGGCGACCGGCACGGTACTGGC
GAGAGGATGGCCCACGGACGGGGGCTTAAGCAGAGCGCGATCGCGACTGTAAGCTCCCGGCAGCTGTACACGGCC
GAGGAGGAGCGCGCGGTGGTGAAGAAGCTCGATCGCAAGCTGGTGCTCTTTGTGGCGCTGCTGTACATGCTCAGC
TTCCTCGATCGGTCCAACATCGGAAACGCCCGCATAGCCGGCATGGACCGCGACCTCCAGACCCAGCCGCCGCGC
GACGACTGGTACGAGTGGGCGCTGACGGCCTTTTATCTCTCGTACATTGCCTTCGAGTGGATGTCGCTGCTGTGG
AGGCTGATACCCGCCCACGTCTTCATCACGGCCCTCGTCCTGTCGTGGGGCCTCGCCTCCTCGCTACAGGGCGTC
GCGCCGTCGTATCCTGTGCTCGTCGCCCTGCGCGCCCTGCTCGGCATCGGCGAGGCCGGCTTCACCGGCATCCCC
TTCTACCTCAGCTTCTTCTTCAGGAGAGAGGAGCTGGCGTTTCGGACGGCCATGTTCATTTCCGCTGCTCCCTTA
GCCACGAGCTTCGCCTCGGCCCTTGCCTGGGCCGTCGTCCGGCTCGCCCAGCTGGGCCCCATCGCGCCGTGGCGG
CTGCTCTTCCTCGTCGAGGGCTTCCCCTCGGTCGTCGCCTCCGTCGCCTCCTGGTCCGCCATCCCCGACTGCCCC
CGGACGGCGCGCTTCCTGACGGAGCGCGAGAGGAAGGCGGCAAGCGGGCGTCCGGGCTCGACGGGCGGGACGTGG
CAGCCGTGCTGGCCGACCCGGTCGCCTGGCTGGCGGCCGTGA
Gene >Hirsu2|6985
ATGCCAACCTACGGCGGCCGTTCGCCGAGCCCCCTGCTGAGTCGCGGGGGCGCCGTGTCGCCGTCGTTTGCCCAG
ACGGGGGCCGAGTTTATACTCGATGACGACGATGACGACGACGACGATGACGACGACGACGAGTTTTATGACGAC
GACGACCCGCGCTCCGAAGGCGGCCGGCAGGATGCGTACGAGATGGTCGCGAGCGGCGACCGGCACGGTACTGGC
GAGAGGATGGCCCACGGACGGGGGCTTAAGCAGAGCGCGATCGCGACTGTAAGCTCCCGGCAGCTGTACACGGCC
GAGGAGGAGCGCGCGGTGGTGAAGAAGCTCGATCGCAAGCTGGTGCTCTTTGTGGCGCTGCTGTACATGCTCAGC
TTCCTCGATCGGTCCAGTACGTCGTCCTCACCCAGCGTGCCCTTCCCCGACTCCCTTCCCAATCTGTGGACAGAG
AAAGAGACAGAGAGGGAGACAGAGAAAGAGAGGAAGCGCGGGAGAATGCCAGAGGATTTGAGAAGAAAGGAAGAG
GTAGAAGTGTTGCCAGCAGGCGGGAGACTCGCCACGCACAAACCCCATCCAACCTCTCTTCAGCTCTCTAAAACG
TGGAACGAACACCCAGACATCGGAAACGCCCGCATAGCCGGCATGGACCGCGACCTCCAGACCCAGCCGCCGCGC
GACGACTGGTACGAGTGGGCGCTGACGGCCTTTTATCTCTCGTACATTGCCTTCGAGTGGATGTCGCTGCTGTGG
AGGCTGATACCCGCCCACGTCTTCATCACGGCCCTCGTCCTGTCGTGGGGCCTCGCCTCCTCGCTACAGGGCGTC
GCGCCGTCGTATCCTGTGCTCGTCGCCCTGCGCGCCCTGCTCGGCATCGGCGAGGCCGGCTTCACCGGCATCCCC
TTCTACCTCAGCTTCTTCTTCAGGAGAGAGGAGCTGGCGTTTCGGACGGCCATGTTCATTTCCGGTCGGCAACCC
CTGTCCTGTCCCGCTTCTGGCCCGGACGAATCCGGAGAGGAGAGCTGACGTCTGGATTACTCCCCTTTCTCCCTT
CCAACAGCTGCTCCCTTAGCCACGAGCTTCGCCTCGGCCCTTGCCTGGGCCGTCGTCCGGCTCGCCCAGCTGGGC
CCCATCGCGCCGTGGCGGCTGCTCTTCCTCGTCGAGGGCTTCCCCTCGGTCGTCGCCTCCGTCGCCTCCTGGTCC
GCCATCCCCGACTGCCCCCGGACGGCGCGCTTCCTGACGGAGCGCGAGAGGAAGGTGGCCTGGCTGCGGCTCCGA
GGCGGCTCCGAGGCGGCTCCGGCGGCCTCAGGCGGCAAGCGGGCGTCCGGGCTCGACGGGCGGGACGTGGCAGCC
GTGCTGGCCGACCCGGTCGCCTGGCTGGCGGCCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail