Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6980
Gene name
LocationContig_383:3990..5809
Strand+
Gene length (bp)1819
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 1.4E-13 102 133
PF00320 GATA GATA zinc finger 1.5E-15 262 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 99 337 5.0E-59
sp|Q92259|SREP_PENCH GATA factor SREP OS=Penicillium chrysogenum GN=SREP PE=3 SV=1 99 560 8.0E-57
sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein URBS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=URBS1 PE=3 SV=2 87 312 4.0E-55
sp|Q10134|FEP1_SCHPO Iron-sensing transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fep1 PE=1 SV=1 99 313 5.0E-44
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 262 312 7.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 99 337 5.0E-59
sp|Q92259|SREP_PENCH GATA factor SREP OS=Penicillium chrysogenum GN=SREP PE=3 SV=1 99 560 8.0E-57
sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein URBS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=URBS1 PE=3 SV=2 87 312 4.0E-55
sp|Q10134|FEP1_SCHPO Iron-sensing transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fep1 PE=1 SV=1 99 313 5.0E-44
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 262 312 7.0E-16
sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogaster GN=srp PE=1 SV=2 260 311 8.0E-16
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 262 332 3.0E-15
sp|Q5A201|GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GZF3 PE=2 SV=1 261 312 7.0E-15
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 252 315 8.0E-15
sp|Q5A432|GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAT1 PE=2 SV=1 260 311 1.0E-14
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 260 311 1.0E-14
sp|Q01168|NUT1_MAGO7 Nitrogen regulatory protein NUT1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NUT1 PE=3 SV=1 250 311 2.0E-14
sp|P42944|GZF3_YEAST Protein GZF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GZF3 PE=1 SV=1 244 311 2.0E-14
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 244 311 3.0E-14
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 262 337 3.0E-14
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 258 311 4.0E-14
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 258 311 5.0E-14
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 260 311 6.0E-14
sp|Q95JA5|GATA6_PIG Transcription factor GATA-6 (Fragment) OS=Sus scrofa GN=GATA6 PE=2 SV=2 260 311 6.0E-14
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 260 311 7.0E-14
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 260 311 8.0E-14
sp|P43574|GAT1_YEAST Transcriptional regulatory protein GAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT1 PE=1 SV=1 260 311 8.0E-14
sp|Q01582|AREA_PENCH Nitrogen regulatory protein areA OS=Penicillium chrysogenum GN=AREA PE=3 SV=1 261 311 8.0E-14
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 260 345 1.0E-13
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 260 311 1.0E-13
sp|P78688|AREA_GIBFU Nitrogen regulatory protein areA OS=Gibberella fujikuroi GN=AREA PE=3 SV=1 245 311 1.0E-13
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 258 311 1.0E-13
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 258 311 1.0E-13
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 262 336 1.0E-13
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 261 311 1.0E-13
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 258 311 1.0E-13
sp|P26343|DAL80_YEAST Nitrogen regulatory protein DAL80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL80 PE=2 SV=1 261 307 1.0E-13
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 261 311 1.0E-13
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 261 311 1.0E-13
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 258 311 1.0E-13
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 262 311 1.0E-13
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 261 313 1.0E-13
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 258 311 1.0E-13
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 261 311 1.0E-13
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 262 336 2.0E-13
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 260 311 2.0E-13
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 258 311 2.0E-13
sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 260 311 2.0E-13
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 261 311 2.0E-13
sp|P17429|AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=areA PE=1 SV=2 262 311 2.0E-13
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 262 309 2.0E-13
sp|P18494|GLN3_YEAST Nitrogen regulatory protein GLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN3 PE=1 SV=2 254 309 2.0E-13
sp|P23768|GAT1B_XENLA GATA-binding factor 1-B OS=Xenopus laevis GN=gata1-b PE=2 SV=1 262 311 2.0E-13
sp|O13412|AREA_ASPNG Nitrogen regulatory protein areA OS=Aspergillus niger GN=areA PE=3 SV=1 262 311 2.0E-13
sp|P19212|NIT2_NEUCR Nitrogen catabolic enzyme regulatory protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-2 PE=1 SV=2 262 311 3.0E-13
sp|Q92269|NRFA_PENUR Nitrogen regulatory protein nrfA OS=Penicillium urticae GN=nrfA PE=3 SV=1 262 311 3.0E-13
sp|O13415|AREA_ASPOR Nitrogen regulatory protein areA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=areA PE=3 SV=1 262 311 4.0E-13
sp|O13508|AREA_PENRO Nitrogen regulatory protein areA OS=Penicillium roqueforti GN=AREA PE=3 SV=2 262 311 4.0E-13
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 262 311 6.0E-13
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 241 313 7.0E-13
sp|Q5A432|GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAT1 PE=2 SV=1 85 142 1.0E-12
sp|P23768|GAT1B_XENLA GATA-binding factor 1-B OS=Xenopus laevis GN=gata1-b PE=2 SV=1 262 313 1.0E-12
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 261 313 1.0E-12
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 262 313 3.0E-12
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 262 313 4.0E-12
sp|Q10280|GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gaf1 PE=1 SV=2 262 321 5.0E-12
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 262 313 6.0E-12
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 262 312 1.0E-11
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 262 312 1.0E-11
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 262 312 1.0E-11
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 262 316 2.0E-11
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 262 312 2.0E-11
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 262 311 2.0E-11
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 262 312 2.0E-11
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 262 312 2.0E-11
sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 240 312 2.0E-11
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 262 311 2.0E-11
sp|Q9BWX5|GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens GN=GATA5 PE=1 SV=1 262 311 2.0E-11
sp|Q3SZJ5|GATA5_BOVIN Transcription factor GATA-5 OS=Bos taurus GN=GATA5 PE=2 SV=1 262 311 2.0E-11
sp|O94720|YCF8_SCHPO GATA zinc finger domain-containing protein C1393.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.08 PE=3 SV=1 260 306 2.0E-11
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 262 312 3.0E-11
sp|P18494|GLN3_YEAST Nitrogen regulatory protein GLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN3 PE=1 SV=2 102 142 5.0E-11
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 262 312 6.0E-11
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 262 311 6.0E-11
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 236 312 7.0E-11
sp|Q10655|ELT2_CAEEL Transcription factor elt-2 OS=Caenorhabditis elegans GN=elt-2 PE=2 SV=1 260 311 7.0E-11
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 99 143 8.0E-11
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 262 311 8.0E-11
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 262 312 8.0E-11
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 262 311 8.0E-11
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 262 312 8.0E-11
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 242 312 9.0E-11
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 262 311 9.0E-11
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 262 310 9.0E-11
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 262 312 1.0E-10
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 262 311 1.0E-10
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 262 311 1.0E-10
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 262 311 1.0E-10
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 262 312 1.0E-10
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 262 311 1.0E-10
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 262 311 1.0E-10
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 262 311 1.0E-10
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 262 311 1.0E-10
sp|O13412|AREA_ASPNG Nitrogen regulatory protein areA OS=Aspergillus niger GN=areA PE=3 SV=1 85 142 2.0E-10
sp|Q01168|NUT1_MAGO7 Nitrogen regulatory protein NUT1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NUT1 PE=3 SV=1 36 142 3.0E-10
sp|Q92269|NRFA_PENUR Nitrogen regulatory protein nrfA OS=Penicillium urticae GN=nrfA PE=3 SV=1 88 142 4.0E-10
sp|O13415|AREA_ASPOR Nitrogen regulatory protein areA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=areA PE=3 SV=1 88 142 4.0E-10
sp|O13508|AREA_PENRO Nitrogen regulatory protein areA OS=Penicillium roqueforti GN=AREA PE=3 SV=2 88 142 4.0E-10
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 272 311 4.0E-10
sp|Q9BWX5|GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens GN=GATA5 PE=1 SV=1 272 311 4.0E-10
sp|Q10655|ELT2_CAEEL Transcription factor elt-2 OS=Caenorhabditis elegans GN=elt-2 PE=2 SV=1 99 143 4.0E-10
sp|P17429|AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=areA PE=1 SV=2 97 142 6.0E-10
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 272 311 6.0E-10
sp|Q3SZJ5|GATA5_BOVIN Transcription factor GATA-5 OS=Bos taurus GN=GATA5 PE=2 SV=1 272 311 6.0E-10
sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogaster GN=srp PE=1 SV=2 89 143 7.0E-10
sp|P43574|GAT1_YEAST Transcriptional regulatory protein GAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT1 PE=1 SV=1 102 142 8.0E-10
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 272 311 8.0E-10
sp|P78688|AREA_GIBFU Nitrogen regulatory protein areA OS=Gibberella fujikuroi GN=AREA PE=3 SV=1 96 142 9.0E-10
sp|P42944|GZF3_YEAST Protein GZF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GZF3 PE=1 SV=1 101 142 1.0E-09
sp|Q01582|AREA_PENCH Nitrogen regulatory protein areA OS=Penicillium chrysogenum GN=AREA PE=3 SV=1 102 142 1.0E-09
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 99 143 1.0E-09
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 272 311 1.0E-09
sp|P26343|DAL80_YEAST Nitrogen regulatory protein DAL80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL80 PE=2 SV=1 96 142 2.0E-09
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 91 143 2.0E-09
sp|P19212|NIT2_NEUCR Nitrogen catabolic enzyme regulatory protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-2 PE=1 SV=2 101 142 2.0E-09
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 102 142 3.0E-09
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 262 339 3.0E-09
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 91 143 3.0E-09
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 91 143 3.0E-09
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 91 143 3.0E-09
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 91 143 3.0E-09
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 91 143 3.0E-09
sp|Q9UHF7|TRPS1_HUMAN Zinc finger transcription factor Trps1 OS=Homo sapiens GN=TRPS1 PE=1 SV=2 260 385 3.0E-09
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 93 143 4.0E-09
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 91 143 4.0E-09
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 91 143 4.0E-09
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 91 143 4.0E-09
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 91 143 4.0E-09
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 91 143 7.0E-09
sp|Q5A201|GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GZF3 PE=2 SV=1 99 142 8.0E-09
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 99 143 8.0E-09
sp|Q925H1|TRPS1_MOUSE Zinc finger transcription factor Trps1 OS=Mus musculus GN=Trps1 PE=1 SV=1 260 321 8.0E-09
sp|O94720|YCF8_SCHPO GATA zinc finger domain-containing protein C1393.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.08 PE=3 SV=1 91 143 9.0E-09
sp|Q90ZS6|TRPS1_XENLA Zinc finger transcription factor Trps1 OS=Xenopus laevis GN=trps1 PE=1 SV=1 83 146 9.0E-09
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 262 299 1.0E-08
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 91 166 1.0E-08
sp|P23768|GAT1B_XENLA GATA-binding factor 1-B OS=Xenopus laevis GN=gata1-b PE=2 SV=1 99 143 1.0E-08
sp|Q90ZS6|TRPS1_XENLA Zinc finger transcription factor Trps1 OS=Xenopus laevis GN=trps1 PE=1 SV=1 260 348 1.0E-08
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 99 143 2.0E-08
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 99 143 2.0E-08
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 91 143 2.0E-08
sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 91 143 2.0E-08
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 99 143 3.0E-08
sp|Q95JA5|GATA6_PIG Transcription factor GATA-6 (Fragment) OS=Sus scrofa GN=GATA6 PE=2 SV=2 99 143 3.0E-08
sp|Q925H1|TRPS1_MOUSE Zinc finger transcription factor Trps1 OS=Mus musculus GN=Trps1 PE=1 SV=1 73 146 3.0E-08
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 99 143 4.0E-08
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 99 143 4.0E-08
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 99 143 4.0E-08
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 99 143 4.0E-08
sp|Q9UHF7|TRPS1_HUMAN Zinc finger transcription factor Trps1 OS=Homo sapiens GN=TRPS1 PE=1 SV=2 99 146 4.0E-08
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 99 143 5.0E-08
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 99 143 5.0E-08
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 99 143 5.0E-08
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 99 143 6.0E-08
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 99 143 6.0E-08
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 99 143 6.0E-08
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 99 180 7.0E-08
sp|Q92259|SREP_PENCH GATA factor SREP OS=Penicillium chrysogenum GN=SREP PE=3 SV=1 254 299 8.0E-08
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 99 144 2.0E-07
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 99 150 2.0E-07
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 99 150 2.0E-07
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 99 150 2.0E-07
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 99 150 2.0E-07
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 99 150 2.0E-07
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 99 150 2.0E-07
sp|O94720|YCF8_SCHPO GATA zinc finger domain-containing protein C1393.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.08 PE=3 SV=1 82 140 2.0E-07
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 99 143 3.0E-07
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 99 154 3.0E-07
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 99 150 3.0E-07
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 99 150 3.0E-07
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 99 150 3.0E-07
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 99 150 4.0E-07
sp|O94720|YCF8_SCHPO GATA zinc finger domain-containing protein C1393.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.08 PE=3 SV=1 261 300 4.0E-07
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 102 144 5.0E-07
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 99 150 5.0E-07
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 99 150 5.0E-07
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 102 144 6.0E-07
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 99 150 6.0E-07
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 25 144 6.0E-07
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 102 144 7.0E-07
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 99 150 7.0E-07
sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 97 150 8.0E-07
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 102 149 9.0E-07
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 102 144 1.0E-06
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 102 144 1.0E-06
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 102 144 1.0E-06
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 99 150 1.0E-06
sp|P23768|GAT1B_XENLA GATA-binding factor 1-B OS=Xenopus laevis GN=gata1-b PE=2 SV=1 102 149 1.0E-06
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 102 149 1.0E-06
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 102 149 1.0E-06
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 99 138 2.0E-06
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 102 149 2.0E-06
sp|Q9BWX5|GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens GN=GATA5 PE=1 SV=1 99 138 2.0E-06
sp|Q3SZJ5|GATA5_BOVIN Transcription factor GATA-5 OS=Bos taurus GN=GATA5 PE=2 SV=1 99 138 2.0E-06
sp|Q9M1U2|GAT14_ARATH GATA transcription factor 14 OS=Arabidopsis thaliana GN=GATA14 PE=2 SV=1 67 128 2.0E-06
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 99 143 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0003677 DNA binding No
GO:0003674 molecular_function No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0003676 nucleic acid binding No
GO:0031326 regulation of cellular biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:0046914 transition metal ion binding No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0043167 ion binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6980
MVMNQVSHNTASAAREPGSMRTALPSRPMSTKARDVAETATQASPRDPPDKDARAPRRSHGTASPNLRANKEAGS
ARGQSLSPLAGDGSAKTSSAGHGGQVCSNCGTTRTPLWRRSPQGATICNACGLYLKARNTSRPTSLKKPPNVVSA
GPPRPTPTKASSSSGSKPFPNLAGATYVSADQTPTGTCPGGGRCNGTGGAEGCNGCPAFNNRVSKSAQLNVMQRQ
KACSGPAAEGGSAEEPAPIDVNALQAQNQDATVVIACQNCGTTITPLWRRDESGHTICNACGLYYKLHGVHRPVT
MKKATIKRRKRVIPASQEEEQDESAESVDAQSQEKTPERGTENEDGSINLGLRRRPDHPLTIEPEPVIRSSGQSS
PLPSASDLAAYHQPSGYPRNVPSPFNDDNRLPPMTSMAAVIGDRQSSKSPASFLSSRRKRSFSATETDAGSVTDS
GHDGAKRLSSIKSILNPPIADDDRPMSRPASVDRADYTLPPLRAPSSGLGPGGSPGPPAATDLAAGGGGVGPREA
VENERLKAERRFALQKEAEKMRELLAAKERELMELGND*
Coding >Hirsu2|6980
ATGGTGATGAACCAAGTATCGCACAACACGGCCTCGGCCGCCCGAGAGCCCGGCTCGATGCGGACCGCCCTCCCG
TCCCGGCCCATGTCCACCAAGGCCCGCGACGTCGCCGAGACTGCGACACAAGCCTCGCCACGGGACCCGCCGGAT
AAGGACGCGCGTGCGCCCCGGCGCAGCCACGGCACAGCCTCCCCGAACCTCAGAGCCAATAAAGAGGCCGGCTCT
GCCAGGGGCCAGAGCCTGAGCCCCTTGGCCGGCGATGGAAGTGCAAAGACGAGCAGCGCCGGTCACGGTGGTCAA
GTCTGCAGCAACTGCGGAACCACTCGAACGCCGCTATGGAGACGGTCTCCTCAGGGCGCGACAATATGCAACGCC
TGCGGCCTCTACCTCAAGGCCAGGAACACGTCCAGACCGACGAGCCTCAAGAAGCCGCCGAATGTCGTCTCCGCC
GGCCCGCCGCGCCCTACCCCCACCAAGGCCAGCTCATCCTCGGGATCCAAGCCGTTCCCGAACCTGGCCGGTGCC
ACGTACGTCTCGGCGGATCAGACGCCGACGGGAACCTGTCCGGGCGGCGGACGCTGCAACGGGACTGGCGGTGCT
GAGGGCTGCAACGGCTGTCCGGCATTCAACAACCGCGTGTCCAAGAGCGCCCAACTCAACGTGATGCAGAGACAA
AAGGCCTGCTCAGGCCCGGCGGCCGAAGGCGGCTCGGCCGAGGAGCCGGCCCCGATCGACGTCAACGCGCTCCAG
GCCCAAAACCAGGATGCCACCGTCGTCATCGCGTGCCAAAATTGTGGCACCACCATCACGCCACTGTGGCGGAGG
GACGAGAGCGGACATACCATCTGCAATGCTTGTGGCCTCTACTATAAGCTACACGGGGTGCACAGGCCCGTCACG
ATGAAGAAGGCGACGATTAAGAGACGCAAGCGGGTGATCCCGGCCTCGCAGGAAGAAGAACAGGACGAATCGGCC
GAGTCGGTCGATGCGCAGAGCCAGGAGAAGACGCCGGAGCGGGGGACGGAAAACGAGGACGGGTCCATAAACCTT
GGACTCCGACGGCGGCCGGACCACCCGCTGACCATCGAGCCGGAGCCCGTGATACGGTCGAGCGGGCAGAGCTCG
CCACTGCCGTCGGCTTCGGACCTGGCCGCCTATCATCAGCCGAGCGGGTATCCGCGGAACGTGCCCAGCCCCTTC
AACGACGACAACCGGCTGCCGCCGATGACGTCGATGGCGGCGGTCATTGGCGACCGGCAGTCTTCCAAGTCGCCG
GCCTCGTTTCTGTCGTCGAGACGGAAACGCTCCTTTTCGGCAACGGAGACGGACGCCGGCAGCGTGACGGACAGC
GGGCACGACGGGGCGAAGCGACTGTCTTCGATCAAGTCGATACTGAACCCGCCGATAGCCGACGACGACAGGCCG
ATGTCTCGGCCGGCAAGCGTGGACAGGGCGGACTACACGCTGCCGCCGCTCCGAGCGCCGAGCTCGGGTCTCGGG
CCCGGGGGCAGTCCCGGCCCGCCAGCGGCGACGGATCTGGCCGCGGGGGGTGGCGGCGTCGGGCCGCGGGAGGCG
GTGGAGAATGAACGGCTCAAGGCCGAACGCAGATTCGCGCTGCAGAAAGAGGCAGAGAAGATGCGGGAGCTGCTG
GCGGCCAAGGAGCGAGAGCTGATGGAACTCGGGAACGACTGA
Transcript >Hirsu2|6980
ATGGTGATGAACCAAGTATCGCACAACACGGCCTCGGCCGCCCGAGAGCCCGGCTCGATGCGGACCGCCCTCCCG
TCCCGGCCCATGTCCACCAAGGCCCGCGACGTCGCCGAGACTGCGACACAAGCCTCGCCACGGGACCCGCCGGAT
AAGGACGCGCGTGCGCCCCGGCGCAGCCACGGCACAGCCTCCCCGAACCTCAGAGCCAATAAAGAGGCCGGCTCT
GCCAGGGGCCAGAGCCTGAGCCCCTTGGCCGGCGATGGAAGTGCAAAGACGAGCAGCGCCGGTCACGGTGGTCAA
GTCTGCAGCAACTGCGGAACCACTCGAACGCCGCTATGGAGACGGTCTCCTCAGGGCGCGACAATATGCAACGCC
TGCGGCCTCTACCTCAAGGCCAGGAACACGTCCAGACCGACGAGCCTCAAGAAGCCGCCGAATGTCGTCTCCGCC
GGCCCGCCGCGCCCTACCCCCACCAAGGCCAGCTCATCCTCGGGATCCAAGCCGTTCCCGAACCTGGCCGGTGCC
ACGTACGTCTCGGCGGATCAGACGCCGACGGGAACCTGTCCGGGCGGCGGACGCTGCAACGGGACTGGCGGTGCT
GAGGGCTGCAACGGCTGTCCGGCATTCAACAACCGCGTGTCCAAGAGCGCCCAACTCAACGTGATGCAGAGACAA
AAGGCCTGCTCAGGCCCGGCGGCCGAAGGCGGCTCGGCCGAGGAGCCGGCCCCGATCGACGTCAACGCGCTCCAG
GCCCAAAACCAGGATGCCACCGTCGTCATCGCGTGCCAAAATTGTGGCACCACCATCACGCCACTGTGGCGGAGG
GACGAGAGCGGACATACCATCTGCAATGCTTGTGGCCTCTACTATAAGCTACACGGGGTGCACAGGCCCGTCACG
ATGAAGAAGGCGACGATTAAGAGACGCAAGCGGGTGATCCCGGCCTCGCAGGAAGAAGAACAGGACGAATCGGCC
GAGTCGGTCGATGCGCAGAGCCAGGAGAAGACGCCGGAGCGGGGGACGGAAAACGAGGACGGGTCCATAAACCTT
GGACTCCGACGGCGGCCGGACCACCCGCTGACCATCGAGCCGGAGCCCGTGATACGGTCGAGCGGGCAGAGCTCG
CCACTGCCGTCGGCTTCGGACCTGGCCGCCTATCATCAGCCGAGCGGGTATCCGCGGAACGTGCCCAGCCCCTTC
AACGACGACAACCGGCTGCCGCCGATGACGTCGATGGCGGCGGTCATTGGCGACCGGCAGTCTTCCAAGTCGCCG
GCCTCGTTTCTGTCGTCGAGACGGAAACGCTCCTTTTCGGCAACGGAGACGGACGCCGGCAGCGTGACGGACAGC
GGGCACGACGGGGCGAAGCGACTGTCTTCGATCAAGTCGATACTGAACCCGCCGATAGCCGACGACGACAGGCCG
ATGTCTCGGCCGGCAAGCGTGGACAGGGCGGACTACACGCTGCCGCCGCTCCGAGCGCCGAGCTCGGGTCTCGGG
CCCGGGGGCAGTCCCGGCCCGCCAGCGGCGACGGATCTGGCCGCGGGGGGTGGCGGCGTCGGGCCGCGGGAGGCG
GTGGAGAATGAACGGCTCAAGGCCGAACGCAGATTCGCGCTGCAGAAAGAGGCAGAGAAGATGCGGGAGCTGCTG
GCGGCCAAGGAGCGAGAGCTGATGGAACTCGGGAACGACTGA
Gene >Hirsu2|6980
ATGGTGATGAACCAAGTATCGCACAACACGGCCTCGGCCGCCCGAGAGCCCGGCTCGATGCGGACCGCCCTCCCG
TCCCGGCCCATGTCCACCAAGGCCCGCGACGTCGCCGAGACTGCGACACAAGCCTCGCCACGGGACCCGCCGGAT
AAGGACGCGCGTGCGCCCCGGCGCAGCCACGGCACAGCCTCCCCGAACCTCAGAGCCAATAAAGAGGCCGGCTCT
GCCAGGGGCCAGAGCCTGAGCCCCTTGGCCGGCGATGGAAGTGCAAAGACGAGCAGCGCCGGTCACGGTGGTCAA
GTCTGCAGGTCTGTCGATGCCCCTCTCTGCAACACCGACCGGCCGTCCCCGCAAATTGCTGATGATTTCTCTACA
GCAACTGCGGAACCACTCGAACGCCGCTATGGAGACGGTCTCCTCAGGGCGCGACAATATGCAACGCCTGCGGCC
TCTACCTCAAGGCCAGGAACACGTCCAGACCGACGAGCCTCAAGAAGCCGCCGAATGTCGTCTCCGCCGGCCCGC
CGCGCCCTACCCCCACCAAGGCCAGCTCATCCTCGGGATCCAAGCCGTTCCCGAACCTGGCCGGTGCCACGTACG
TCTCGGCGGATCAGACGCCGACGGGAACCTGTCCGGGCGGCGGACGCTGCAACGGGACTGGCGGTGCTGAGGGCT
GCAACGGCTGTCCGGCATTCAACAACCGCGTGTCCAAGAGCGCCCAACTCAACGTGATGCAGAGACAAAAGGCCT
GCTCAGGCCCGGCGGCCGAAGGCGGCTCGGCCGAGGAGCCGGCCCCGATCGACGTCAACGCGCTCCAGGCCCAAA
ACCAGGATGCCACCGTCGTCATCGCGTGCCAAAATTGTGGCACCACCATCACGCCACTGTGGCGGAGGGACGAGA
GCGGACATACCATCTGCAATGCTTGTGGTTCGTGGCATCCCGACGGTCACATTATGTGCACACACCCCTGCTAAC
CACGTGCGCAGGCCTCTACTATAAGCTACACGGGGTGCACAGGCCCGTCACGATGAAGAAGGCGACGATTAAGAG
ACGCAAGCGGGTGATCCCGGCCTCGCAGGAAGAAGAACAGGACGAATCGGCCGAGTCGGTCGATGCGCAGAGCCA
GGAGAAGACGCCGGAGCGGGGGACGGAAAACGAGGACGGGTCCATAAACCTTGGACTCCGACGGCGGCCGGACCA
CCCGCTGACCATCGAGCCGGAGCCCGTGATACGGTCGAGCGGGCAGAGCTCGCCACTGCCGTCGGCTTCGGACCT
GGCCGCCTATCATCAGCCGAGCGGGTATCCGCGGAACGTGCCCAGCCCCTTCAACGACGACAACCGGCTGCCGCC
GATGACGTCGATGGCGGCGGTCATTGGCGACCGGCAGTCTTCCAAGTCGCCGGCCTCGTTTCTGTCGTCGAGACG
GAAACGCTCCTTTTCGGCAACGGAGACGGACGCCGGCAGCGTGACGGACAGCGGGCACGACGGGGCGAAGCGACT
GTCTTCGATCAAGTCGATACTGAACCCGCCGATAGCCGACGACGACAGGCCGATGTCTCGGCCGGCAAGCGTGGA
CAGGGCGGACTACACGCTGCCGCCGCTCCGAGCGCCGAGCTCGGGTCTCGGGCCCGGGGGCAGTCCCGGCCCGCC
AGCGGCGACGGATCTGGCCGCGGGGGGTGGCGGCGTCGGGCCGCGGGAGGCGGTGGAGAATGAACGGCTCAAGGC
CGAACGCAGATTCGCGCTGCAGAAAGAGGCAGAGAAGATGCGGGAGCTGCTGGCGGCCAAGGAGCGAGAGCTGAT
GGAACTCGGGAACGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail