Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6970
Gene name
LocationContig_381:3443..10508
Strand-
Gene length (bp)7065
Transcript length (bp)6822
Coding sequence length (bp)6822
Protein length (aa) 2274

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 4.4E-80 371 619
PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis 2.9E-73 8 238
PF00698 Acyl_transf_1 Acyl transferase domain 8.2E-34 908 1192
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 7.2E-29 627 751
PF00550 PP-binding Phosphopantetheine attachment site 1.6E-08 1650 1711
PF00550 PP-binding Phosphopantetheine attachment site 6.1E-11 1763 1826
PF07993 NAD_binding_4 Male sterility protein 3.3E-20 1904 2148
PF14765 PS-DH Polyketide synthase dehydratase 2.6E-11 1291 1593

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 1 1868 0.0E+00
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 1 1755 0.0E+00
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 2 1827 0.0E+00
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 372 1600 1.0E-100
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 372 1600 1.0E-100
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 1 1868 0.0E+00
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 1 1755 0.0E+00
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 2 1827 0.0E+00
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 372 1600 1.0E-100
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 372 1600 1.0E-100
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 372 1600 1.0E-100
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 372 1259 4.0E-99
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 372 1341 1.0E-98
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 358 1260 2.0E-98
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 372 1189 2.0E-98
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 372 1189 2.0E-98
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 372 1283 1.0E-97
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 347 1207 8.0E-97
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 347 1207 1.0E-96
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 372 1344 3.0E-96
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 347 1207 1.0E-95
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 372 1344 7.0E-95
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 367 1261 1.0E-94
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 359 1208 2.0E-93
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 359 1208 2.0E-93
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 359 1208 2.0E-93
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 359 1208 2.0E-93
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 359 1208 4.0E-93
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 366 1260 6.0E-93
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 367 1259 1.0E-92
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 363 1345 1.0E-91
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 364 1389 5.0E-91
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 372 1189 2.0E-90
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 372 1189 2.0E-90
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 372 1189 2.0E-90
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 366 1275 9.0E-90
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 371 1296 1.0E-89
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 372 1259 1.0E-89
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 372 1454 3.0E-89
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 372 1275 1.0E-88
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 371 1271 2.0E-88
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 372 1108 2.0E-88
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 372 1259 1.0E-87
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 372 1261 2.0E-87
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 363 1259 4.0E-87
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 364 1373 6.0E-87
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 372 1275 7.0E-87
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 364 1373 9.0E-87
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 372 1275 1.0E-86
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 372 1260 1.0E-84
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 364 1259 2.0E-84
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 366 1259 3.0E-84
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 371 1271 4.0E-84
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 372 1261 7.0E-84
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 433 1259 3.0E-83
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 372 1261 3.0E-83
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 372 1275 9.0E-83
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 369 1260 1.0E-82
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 372 1135 1.0E-81
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 372 1135 1.0E-81
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 372 1135 1.0E-81
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 365 1259 9.0E-81
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 372 1259 7.0E-80
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 433 1259 2.0E-79
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 372 1282 1.0E-78
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 373 1259 2.0E-78
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 369 1260 3.0E-78
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 372 1289 1.0E-77
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 361 1228 2.0E-77
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 372 1259 3.0E-77
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 372 1259 3.0E-77
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 372 1259 4.0E-77
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 372 1282 9.0E-77
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 372 884 1.0E-76
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 371 884 1.0E-76
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 372 1260 2.0E-76
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 372 1259 2.0E-76
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 353 890 7.0E-76
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 372 1228 2.0E-75
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 372 890 2.0E-75
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 351 890 4.0E-75
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 371 1278 6.0E-75
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 307 898 2.0E-74
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 372 1259 2.0E-74
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 368 1277 4.0E-74
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 372 1282 1.0E-73
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 372 892 1.0E-71
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 372 1280 1.0E-71
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 357 895 3.0E-69
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 372 805 9.0E-65
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 355 892 7.0E-64
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 371 1203 5.0E-63
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 348 895 1.0E-62
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 371 1109 1.0E-62
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 371 1030 2.0E-62
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 371 1208 2.0E-61
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 368 798 4.0E-60
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 372 1203 1.0E-59
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 361 889 4.0E-58
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 372 925 4.0E-58
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 372 884 2.0E-52
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 372 890 1.0E-51
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 371 805 7.0E-51
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 372 744 1.0E-47
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 372 824 1.0E-45
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 372 833 4.0E-44
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 830 1344 3.0E-27
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 907 1196 6.0E-22
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 906 1193 2.0E-21
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 459 806 5.0E-21
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 904 1306 7.0E-21
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 907 1211 1.0E-20
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 445 747 4.0E-18
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 368 747 4.0E-18
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 368 747 4.0E-18
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 368 747 4.0E-18
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 446 747 4.0E-18
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 368 747 5.0E-18
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 368 747 5.0E-18
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 371 747 6.0E-18
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 459 747 3.0E-17
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 1726 1844 4.0E-17
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 446 729 4.0E-16
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 863 1238 2.0E-15
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 369 753 5.0E-15
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 906 1193 1.0E-14
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 906 1193 1.0E-14
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 906 1193 1.0E-14
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 906 1193 1.0E-14
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 906 1193 2.0E-14
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 906 1193 2.0E-14
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 428 695 2.0E-14
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 369 806 4.0E-14
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 906 1193 4.0E-14
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 499 729 4.0E-14
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 369 753 6.0E-14
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 454 806 6.0E-14
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 439 806 8.0E-14
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 907 1134 9.0E-14
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 499 729 1.0E-13
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 505 805 2.0E-13
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 371 753 2.0E-13
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 371 747 4.0E-13
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 369 747 6.0E-13
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1782 2205 1.0E-12
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 522 772 3.0E-12
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 487 805 4.0E-12
sp|P43712|FABD_HAEIN Malonyl CoA-acyl carrier protein transacylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabD PE=3 SV=1 906 1197 6.0E-12
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 461 806 7.0E-12
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 445 803 2.0E-11
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 461 752 2.0E-11
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 461 752 2.0E-11
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 446 747 2.0E-11
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 446 747 2.0E-11
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 446 747 2.0E-11
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 446 747 2.0E-11
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 445 747 2.0E-11
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 433 753 2.0E-11
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 1751 2221 2.0E-11
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 907 1193 4.0E-11
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 371 753 5.0E-11
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 446 723 5.0E-11
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 907 1131 1.0E-10
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 365 691 1.0E-10
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 906 1130 2.0E-10
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 371 753 5.0E-10
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 445 804 6.0E-10
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1898 2151 7.0E-10
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 909 1193 9.0E-10
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1902 2202 1.0E-09
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1778 2271 1.0E-09
sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2 906 1193 1.0E-09
sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabD PE=3 SV=2 906 1193 1.0E-09
sp|Q8X8I7|FABD_ECO57 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3 906 1193 2.0E-09
sp|Q8K9J6|FABD_BUCAP Malonyl CoA-acyl carrier protein transacylase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabD PE=3 SV=1 911 1193 2.0E-09
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 371 753 2.0E-09
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 369 747 2.0E-09
sp|O85140|FABD_SALTY Malonyl CoA-acyl carrier protein transacylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabD PE=1 SV=3 906 1193 2.0E-09
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 491 806 3.0E-09
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 457 801 3.0E-09
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 907 1130 3.0E-09
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 1780 2151 7.0E-09
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 433 751 9.0E-09
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 445 809 2.0E-08
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 907 1261 6.0E-08
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1897 2207 9.0E-08
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 539 803 1.0E-07
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1763 2151 2.0E-07
sp|P43678|KAS1_STRRM Oxytetracycline polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces rimosus PE=3 SV=2 371 752 2.0E-07
sp|Q89AH0|FABD_BUCBP Malonyl CoA-acyl carrier protein transacylase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabD PE=3 SV=1 958 1094 3.0E-07
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 539 803 5.0E-07
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 539 803 5.0E-07
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 539 803 5.0E-07
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1902 2160 6.0E-07
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1903 2207 8.0E-07
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1903 2207 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6970
MANQMKLYLFGDQTFDIQPHLKTLIRERDHPILEKFLVKAYEAVRTEIFKLPYEVRDDIPRFTCLDDLVSWNQSK
KRSIPLDMAVTCIYQLGTFIQQADASKLGPDNARVAGICTGTLAAAVASCSRSLLDLVPMAVDAVTVAFRVGMHV
ADVAQRVAPSEESEPTWSIIVPGSTSDVAVRKFCEKTTLPLTSKPYVTAYAPNGITVSGPPKSLEQFINSDEFKG
LRFKDAPIYGPYHAPHLYSQYDIGKIVEGLACDTVGERSENVPLLSSSGAKVEGRTFAALLRSAAEQILLQPIRW
SSILDGLQSCLQKLSPKSFAVVSIGTTADQLVYTALKQTSLRNLMPSATSASKPPAPEATGSGSSNPKKPKLAII
GMSGRFPGAKDNEAFWDLLHEGLDVHKPVPALHWDAKTHVDATASRKNTSATPYGCWLDEPELFDARFFNISPRE
APQIDPAQRLALMTAYEAIEQAGIVPDATPSTRRDRVGVFYGVTSNDWMETNSAQNIDTYFIPGGNRAFIPGRIN
YCFKFSGPSYAIDTACSSSLAGIHLACNSLWRGDIDTAIAGGTNVLTNPDFTAGLDRGHFLSRTGNCKTFDDGAD
GYCRGEGIGTVIVKRLDDALADHDPILGVILGAYTNHSAESESITRPHVGAQRAIFSKILNQGAVDPYSVGYVEM
HGTGTQAGDAGEMSSVLDTFAPPLSQVKQGRTADEALYLGSAKANIGHGEASSGVSSLIKVLLMMQKNMIAPHCG
IKTKINRKFPTDLGERNVNIALKPTAWAKSLDPSKPRRAFVNNFSAAGGNSALLLEDAPLEQESPSAVADPRSPH
LVACSAKNGPSLQGNLRSLLQVLKQNPGMSLGQLSYTTTARRQHHQHRVMLSAGSAEDLCTQIEAALRDGAGMTR
PKSTPKLVFAFTGQGAQYPGMGKQLFEHLSFFRTEMCRLDQMGQSLGFPSVLPVIQSDEPDVSVFPPTAVQLASI
CMQIALVKLWASWNVTPVAVVGHSLGEYAALNAAGVLSDADTIYLVGKRAELLQKKCTRDTHAMLVVKGSVDDVA
RVLTGRQYEIACINSPVETVLAGSNDDITNFKGVLADAGLKTTLLKVPYAFHSSQIDPILSDFTALARGVTFSKA
KLPVLCPLNGDVAAEGSDGFGPEYLASHSRQPVNMLKALQAAYSGKIMTDQSTVLEVGPHPAISGMVRPAIGPQV
ATLASAQRARSAWQVLGLTLKALYAGGSDIRWAEYHRDFTSSHKVTPLPAYSWDLKPYWLQYVNDWSLRKGDPPL
IGNDTSSGKLESTTIHRIVEETSDANKAHVVVEADIARKDLSPLVQGHEVDGIPLCTPSVYADIALSLGKYLIQS
YRPDQREKLVDVSDMTISKALILRAGATQQLLQAHMDVDWPSKSAAVKFMSFDNKQKLQEHSRCVLRFRDGSLQK
ELQNNLANTKKKQQALRDGVGAGATARFNRPMVYRAIRPLARFHDDYRAIDEIILNSKTLEASSRLSFGSVKRGG
VYHTHPAIIDSLTQSCGFTMNCNDGTDLDNEVFMNHGWGSFQIFEPLDFDKVYTTYTRMEEGADKLWHGDVVILD
GDKVVAFFGQIAIQGVPRRVLKVILSLESGNKSQKQQPAQKQQPAVAAPSAAKAAPAATPSAAEPSHASKLAKAL
QVIAEESGLAVEDLTDGTVFSDAGIDSLLGLTISARFKEELDMDLDFNALFYEYPTVGDLKTFFGGSSTESAGSS
SPSSSAAGSASPVSNGTGATTPVTEEHSSSKVDFQRALSIISEESGVATEDLTDDTNFADSGVDSLLSLVIVSRF
RDELELDIQHESLFLECPTVADLKQLLLGGTESPSEAQPQNPEPVPAAEQKSATVQRTETETAALATRKRAVDEL
VAKYTAGFSAAGESPSAALPNDNEKVVLVTGASGSLGGHLVYHIAQLPDVKTVVCLNRENRAEPNVRQQKAMREK
GIRFPEALKHKLVVLQTDSAKPMFGLSKSEYEGLASSVTYLIHNAWPMSAKRPLAGFESQFQVMRNLIDFASDAA
SRRPETFKFSFQMVSSIGVVGHYGLGGDDSKRIMVPEQRTGIDTVLPNGYGDAKWGCERMLDETLHKYPNRFRTM
AVRLGQIAGSKTSGYWNPMEHFGFLIKSSQTLNALPDVDGDVFWTPVNDIAATLSDLVLSERSPYPIYHIENPVG
QPWRETNAILADALKISNLIPFEEWVERVRAAPQRNNPASTLLEFLDGNYKRMSCGGLVLDVQKTLEHSKTLSSV
GPVSEEVVRKYIHIWKEIGFLSA*
Coding >Hirsu2|6970
ATGGCCAACCAAATGAAGCTGTACCTCTTCGGAGACCAGACCTTTGACATTCAGCCTCACCTCAAGACCTTGATC
CGCGAAAGAGATCACCCCATCCTGGAGAAATTTCTCGTTAAGGCATACGAAGCCGTTCGTACTGAGATCTTCAAG
TTGCCCTACGAGGTTAGGGATGACATTCCTCGCTTCACCTGCCTCGACGATCTGGTTTCTTGGAACCAGAGCAAG
AAGCGGTCGATACCGCTTGACATGGCTGTGACATGCATTTATCAGCTGGGCACTTTTATCCAGCAAGCGGATGCT
TCCAAGCTTGGCCCCGACAATGCCCGGGTTGCTGGCATCTGTACGGGAACCCTGGCCGCAGCCGTGGCCAGCTGC
AGCCGCAGCCTGTTGGACCTCGTTCCTATGGCTGTCGATGCAGTCACTGTTGCCTTCAGGGTGGGCATGCACGTG
GCCGATGTCGCGCAGCGCGTGGCGCCGTCGGAGGAATCCGAACCGACCTGGTCTATCATCGTCCCCGGGTCGACG
TCTGATGTGGCCGTTCGAAAGTTCTGTGAAAAGACTACCCTGCCGTTGACGAGCAAACCCTACGTCACCGCCTAC
GCGCCGAATGGCATTACTGTGAGCGGGCCTCCGAAGTCCCTCGAGCAGTTCATCAACTCCGATGAGTTCAAGGGC
CTCCGATTCAAGGATGCCCCCATCTACGGCCCATACCACGCGCCGCATCTGTATTCGCAGTACGACATCGGCAAG
ATTGTCGAGGGCCTGGCTTGTGACACGGTCGGCGAGCGCTCCGAGAATGTCCCTCTCCTCTCCAGCTCGGGAGCC
AAGGTAGAAGGACGCACGTTCGCGGCTCTCCTTAGGTCCGCGGCCGAGCAGATTTTGCTGCAACCTATCCGATGG
AGTAGCATCCTTGACGGTTTGCAGAGCTGTCTCCAGAAGCTCAGTCCCAAGTCGTTCGCCGTCGTTTCGATTGGG
ACCACGGCGGACCAGCTCGTCTACACCGCACTCAAGCAGACGTCGCTGCGAAACTTGATGCCCTCAGCTACGAGC
GCAAGCAAGCCTCCCGCCCCGGAAGCGACGGGTTCCGGCTCTTCGAACCCCAAGAAGCCGAAGCTTGCCATCATT
GGCATGTCTGGGCGATTTCCGGGCGCCAAGGATAACGAGGCGTTCTGGGATCTCCTGCACGAGGGGCTGGATGTC
CATAAGCCTGTCCCCGCCCTCCACTGGGATGCCAAAACGCACGTGGATGCGACTGCCAGTCGCAAGAACACGAGC
GCAACGCCCTATGGCTGTTGGCTGGACGAGCCCGAGCTCTTCGACGCTCGCTTCTTCAACATTTCGCCGCGCGAG
GCGCCACAGATCGACCCGGCGCAGCGACTAGCTCTCATGACGGCATACGAGGCCATTGAGCAGGCCGGAATCGTC
CCCGACGCCACGCCCTCAACCCGACGCGACCGGGTGGGCGTCTTCTACGGAGTGACGAGCAATGATTGGATGGAG
ACGAACAGTGCCCAGAACATCGACACCTACTTCATTCCCGGCGGCAACCGAGCCTTTATCCCAGGGCGCATCAAC
TACTGCTTCAAGTTTAGCGGCCCGAGCTACGCCATCGATACGGCCTGCTCGTCCAGTCTAGCGGGCATCCACTTG
GCCTGCAATTCGCTGTGGCGAGGCGACATCGACACGGCCATCGCCGGCGGCACCAATGTCTTGACCAACCCCGAC
TTCACTGCCGGCCTGGACCGCGGTCACTTCCTCTCGCGCACCGGCAACTGCAAGACGTTTGACGATGGCGCCGAT
GGCTACTGCCGCGGCGAAGGCATCGGGACCGTCATCGTCAAGCGCCTGGACGATGCGCTCGCCGACCATGACCCC
ATCCTGGGAGTCATCCTCGGCGCCTATACCAACCACTCGGCCGAGTCCGAGTCCATCACGAGGCCGCATGTCGGC
GCCCAGCGCGCCATCTTTAGCAAGATCCTCAACCAGGGCGCCGTCGACCCCTATAGCGTCGGCTACGTCGAGATG
CACGGAACGGGCACCCAGGCCGGAGACGCCGGCGAGATGTCGAGCGTTCTCGACACCTTCGCCCCTCCCCTGTCC
CAGGTGAAGCAGGGAAGGACGGCCGACGAGGCTCTTTACCTTGGCTCTGCTAAGGCCAACATCGGCCACGGCGAG
GCATCTTCGGGCGTGTCGAGTCTGATCAAGGTGCTGCTGATGATGCAGAAGAACATGATCGCCCCGCACTGCGGC
ATCAAGACCAAGATCAACCGCAAGTTCCCGACCGATCTGGGCGAGCGCAACGTCAACATCGCCCTGAAGCCGACT
GCCTGGGCCAAGAGCCTCGATCCTTCTAAGCCCAGGCGCGCCTTCGTCAACAACTTCAGCGCTGCCGGCGGCAAC
TCTGCTCTTCTGCTCGAAGATGCACCCCTCGAGCAGGAGTCGCCCTCCGCCGTCGCCGATCCCCGAAGCCCGCAC
CTCGTCGCCTGCTCGGCCAAGAACGGACCCTCTCTGCAGGGCAACCTGCGCTCTCTGCTTCAGGTCCTGAAGCAG
AACCCCGGCATGTCCCTGGGCCAGCTCTCGTACACGACGACGGCGCGCCGCCAGCACCACCAGCACCGCGTCATG
CTTTCAGCTGGCTCGGCCGAGGATCTCTGCACTCAGATCGAGGCAGCCCTTCGCGACGGGGCGGGCATGACCAGG
CCCAAGTCCACTCCCAAGCTCGTCTTTGCCTTCACAGGCCAAGGCGCCCAGTACCCGGGCATGGGGAAGCAGCTT
TTCGAGCACCTATCCTTCTTCCGCACCGAAATGTGCCGACTCGACCAGATGGGGCAGAGCCTTGGCTTCCCGTCT
GTCCTCCCCGTCATTCAGTCCGACGAGCCGGACGTGAGCGTCTTCCCGCCCACCGCCGTTCAGCTGGCGAGCATT
TGCATGCAGATCGCACTCGTCAAACTCTGGGCGTCGTGGAACGTCACTCCGGTCGCAGTCGTTGGCCACAGCCTG
GGCGAGTATGCCGCTCTCAACGCCGCTGGAGTGCTCTCGGACGCAGACACTATCTACCTTGTCGGCAAGCGGGCG
GAGCTGCTCCAGAAGAAGTGCACGCGCGATACTCACGCCATGCTCGTCGTCAAAGGCTCGGTGGATGATGTCGCC
CGCGTTCTGACTGGCCGCCAGTACGAAATCGCCTGCATCAACTCCCCGGTCGAGACGGTGCTGGCCGGCTCCAAC
GACGACATTACCAATTTCAAGGGCGTCCTGGCTGATGCAGGCCTGAAAACTACCTTGCTCAAGGTCCCTTACGCC
TTCCACTCGTCACAGATCGATCCCATTCTGTCGGACTTCACTGCATTGGCTCGCGGCGTGACCTTCTCTAAGGCC
AAGTTACCCGTCTTGTGCCCCTTGAATGGCGACGTCGCCGCCGAGGGTAGCGACGGTTTCGGGCCCGAATATCTC
GCTAGCCACTCTCGCCAGCCAGTCAACATGCTTAAGGCCCTCCAGGCGGCCTACAGCGGCAAGATCATGACTGAC
CAGAGCACCGTTCTGGAGGTCGGCCCACACCCTGCAATCTCCGGCATGGTGCGGCCTGCAATTGGACCGCAAGTC
GCAACCCTCGCTTCGGCCCAGCGTGCCAGGTCTGCCTGGCAGGTTCTGGGGCTGACCCTCAAGGCCCTCTACGCT
GGGGGATCTGACATTCGCTGGGCCGAGTACCACCGCGACTTCACGAGCTCTCACAAGGTCACTCCCCTGCCAGCT
TACAGTTGGGACTTGAAGCCGTACTGGCTTCAATACGTCAACGACTGGTCTCTGCGCAAGGGAGATCCGCCTCTG
ATCGGCAATGATACCTCTAGCGGCAAGCTGGAGAGCACGACAATCCACCGGATTGTCGAGGAAACCAGCGACGCC
AACAAGGCTCACGTTGTTGTTGAGGCGGACATCGCGCGCAAGGACCTTAGTCCCCTGGTGCAGGGTCACGAGGTT
GATGGCATTCCACTCTGCACGCCATCCGTTTACGCCGATATTGCACTGAGCTTGGGCAAGTACCTCATCCAGAGC
TACCGCCCGGATCAGAGGGAGAAGCTCGTCGACGTGTCGGATATGACCATTTCCAAGGCCCTGATCTTGCGTGCG
GGTGCAACTCAGCAGCTGCTCCAGGCACACATGGACGTGGATTGGCCTTCCAAGTCGGCTGCCGTCAAGTTCATG
TCCTTTGACAACAAGCAGAAGCTGCAAGAGCATTCTCGATGCGTCCTGCGATTCAGGGACGGGAGCCTCCAGAAA
GAGCTCCAGAACAACTTGGCAAACACCAAGAAGAAGCAGCAAGCCCTGCGAGACGGTGTGGGCGCAGGAGCAACG
GCTCGGTTCAACAGACCCATGGTGTACCGAGCCATTCGGCCGCTGGCACGGTTCCACGATGACTACCGGGCCATC
GACGAGATCATCCTCAACAGCAAGACGCTTGAGGCGTCGAGCCGTCTCAGCTTCGGCAGCGTGAAGAGGGGTGGT
GTCTATCACACCCATCCTGCCATCATCGACTCCTTGACGCAATCGTGCGGCTTCACCATGAACTGCAACGATGGC
ACTGACCTGGACAACGAGGTGTTCATGAACCACGGCTGGGGCTCTTTCCAGATCTTCGAGCCACTCGACTTCGAC
AAGGTGTATACCACCTACACTCGAATGGAGGAGGGCGCCGACAAGCTGTGGCATGGTGATGTTGTCATTCTTGAT
GGCGATAAGGTCGTCGCGTTCTTCGGCCAGATTGCTATTCAAGGAGTGCCGCGCCGAGTTCTAAAGGTCATCTTG
TCCCTTGAAAGTGGGAACAAGTCCCAGAAGCAGCAGCCCGCCCAGAAGCAGCAACCTGCTGTGGCAGCCCCTTCC
GCCGCAAAAGCTGCCCCCGCGGCGACTCCTTCGGCTGCCGAGCCTTCTCATGCTTCGAAGCTTGCGAAGGCCCTG
CAGGTAATCGCCGAGGAGAGCGGGCTTGCCGTGGAGGACTTGACCGATGGTACCGTCTTCAGTGACGCTGGCATC
GACTCTCTTCTTGGATTGACCATCTCCGCCCGCTTCAAGGAGGAGCTCGACATGGACCTCGACTTCAACGCCTTG
TTCTATGAGTATCCCACTGTTGGGGATCTTAAGACATTCTTTGGCGGGTCCTCTACCGAGTCCGCCGGGTCGTCG
AGCCCCAGCTCCAGCGCCGCTGGGTCCGCCTCCCCCGTCTCCAATGGCACCGGGGCCACCACTCCAGTCACAGAG
GAGCATTCCTCATCTAAGGTCGACTTCCAGCGCGCCCTGTCAATCATATCGGAAGAGAGTGGTGTCGCTACGGAA
GATCTCACCGATGATACGAACTTTGCCGACTCTGGAGTGGATTCTCTGCTGTCCCTTGTCATTGTCAGCCGATTC
CGAGATGAGCTCGAGCTCGACATTCAGCACGAGTCTCTTTTCCTCGAGTGTCCGACTGTTGCCGATCTGAAGCAG
TTGCTTCTTGGGGGGACTGAATCGCCTAGCGAGGCTCAGCCGCAAAACCCCGAGCCTGTCCCGGCTGCCGAGCAG
AAGTCCGCGACAGTGCAGCGCACGGAGACGGAGACGGCTGCCCTCGCTACTCGCAAGAGAGCCGTCGACGAACTC
GTCGCCAAGTACACAGCCGGCTTCTCCGCGGCCGGAGAATCGCCATCGGCTGCTCTACCGAATGACAACGAGAAG
GTCGTCTTGGTTACGGGCGCATCGGGCAGCCTGGGAGGCCATTTGGTCTACCACATTGCCCAGCTCCCGGACGTG
AAGACGGTCGTGTGTCTCAACCGCGAGAACCGAGCAGAGCCCAATGTCCGACAGCAGAAGGCTATGCGGGAGAAG
GGCATTCGGTTTCCGGAAGCTCTCAAACACAAGCTGGTCGTGCTGCAGACTGACAGTGCCAAGCCCATGTTTGGC
TTGTCCAAGAGCGAGTACGAGGGACTCGCGAGCTCTGTCACATATCTGATCCACAACGCGTGGCCTATGAGCGCG
AAGCGACCTTTGGCTGGTTTCGAGTCCCAGTTCCAAGTCATGCGCAACCTGATCGATTTTGCTAGCGATGCCGCC
TCTCGTCGCCCGGAGACCTTCAAGTTCAGTTTCCAGATGGTGTCGTCTATTGGTGTTGTCGGTCACTACGGCCTC
GGCGGCGACGACAGCAAGAGGATTATGGTTCCTGAACAGCGAACTGGAATCGACACCGTCCTTCCCAACGGCTAC
GGAGACGCTAAATGGGGATGCGAGAGGATGCTCGACGAGACTCTGCACAAGTATCCAAACCGCTTCCGCACCATG
GCCGTCCGTCTGGGACAGATTGCCGGATCCAAGACCAGCGGCTATTGGAACCCCATGGAGCACTTCGGCTTCCTG
ATCAAGTCCTCGCAGACCTTGAATGCTCTGCCAGACGTGGACGGCGACGTCTTTTGGACTCCCGTCAACGATATA
GCTGCGACGCTGAGCGACTTGGTCCTGTCCGAACGCAGCCCCTATCCGATCTATCATATCGAGAACCCGGTTGGT
CAGCCATGGCGCGAGACGAATGCCATTTTGGCAGATGCCCTGAAGATCTCGAACTTGATTCCTTTTGAGGAGTGG
GTCGAGCGCGTGCGAGCAGCGCCGCAACGCAACAACCCCGCCTCGACACTCCTGGAGTTCTTGGATGGAAACTAC
AAGCGCATGTCATGCGGCGGCCTTGTTCTAGATGTGCAGAAGACGCTCGAGCATTCGAAGACGCTGAGTAGTGTC
GGGCCGGTGAGCGAGGAGGTGGTCCGGAAATACATTCATATTTGGAAGGAGATTGGATTCTTGAGCGCCTAG
Transcript >Hirsu2|6970
ATGGCCAACCAAATGAAGCTGTACCTCTTCGGAGACCAGACCTTTGACATTCAGCCTCACCTCAAGACCTTGATC
CGCGAAAGAGATCACCCCATCCTGGAGAAATTTCTCGTTAAGGCATACGAAGCCGTTCGTACTGAGATCTTCAAG
TTGCCCTACGAGGTTAGGGATGACATTCCTCGCTTCACCTGCCTCGACGATCTGGTTTCTTGGAACCAGAGCAAG
AAGCGGTCGATACCGCTTGACATGGCTGTGACATGCATTTATCAGCTGGGCACTTTTATCCAGCAAGCGGATGCT
TCCAAGCTTGGCCCCGACAATGCCCGGGTTGCTGGCATCTGTACGGGAACCCTGGCCGCAGCCGTGGCCAGCTGC
AGCCGCAGCCTGTTGGACCTCGTTCCTATGGCTGTCGATGCAGTCACTGTTGCCTTCAGGGTGGGCATGCACGTG
GCCGATGTCGCGCAGCGCGTGGCGCCGTCGGAGGAATCCGAACCGACCTGGTCTATCATCGTCCCCGGGTCGACG
TCTGATGTGGCCGTTCGAAAGTTCTGTGAAAAGACTACCCTGCCGTTGACGAGCAAACCCTACGTCACCGCCTAC
GCGCCGAATGGCATTACTGTGAGCGGGCCTCCGAAGTCCCTCGAGCAGTTCATCAACTCCGATGAGTTCAAGGGC
CTCCGATTCAAGGATGCCCCCATCTACGGCCCATACCACGCGCCGCATCTGTATTCGCAGTACGACATCGGCAAG
ATTGTCGAGGGCCTGGCTTGTGACACGGTCGGCGAGCGCTCCGAGAATGTCCCTCTCCTCTCCAGCTCGGGAGCC
AAGGTAGAAGGACGCACGTTCGCGGCTCTCCTTAGGTCCGCGGCCGAGCAGATTTTGCTGCAACCTATCCGATGG
AGTAGCATCCTTGACGGTTTGCAGAGCTGTCTCCAGAAGCTCAGTCCCAAGTCGTTCGCCGTCGTTTCGATTGGG
ACCACGGCGGACCAGCTCGTCTACACCGCACTCAAGCAGACGTCGCTGCGAAACTTGATGCCCTCAGCTACGAGC
GCAAGCAAGCCTCCCGCCCCGGAAGCGACGGGTTCCGGCTCTTCGAACCCCAAGAAGCCGAAGCTTGCCATCATT
GGCATGTCTGGGCGATTTCCGGGCGCCAAGGATAACGAGGCGTTCTGGGATCTCCTGCACGAGGGGCTGGATGTC
CATAAGCCTGTCCCCGCCCTCCACTGGGATGCCAAAACGCACGTGGATGCGACTGCCAGTCGCAAGAACACGAGC
GCAACGCCCTATGGCTGTTGGCTGGACGAGCCCGAGCTCTTCGACGCTCGCTTCTTCAACATTTCGCCGCGCGAG
GCGCCACAGATCGACCCGGCGCAGCGACTAGCTCTCATGACGGCATACGAGGCCATTGAGCAGGCCGGAATCGTC
CCCGACGCCACGCCCTCAACCCGACGCGACCGGGTGGGCGTCTTCTACGGAGTGACGAGCAATGATTGGATGGAG
ACGAACAGTGCCCAGAACATCGACACCTACTTCATTCCCGGCGGCAACCGAGCCTTTATCCCAGGGCGCATCAAC
TACTGCTTCAAGTTTAGCGGCCCGAGCTACGCCATCGATACGGCCTGCTCGTCCAGTCTAGCGGGCATCCACTTG
GCCTGCAATTCGCTGTGGCGAGGCGACATCGACACGGCCATCGCCGGCGGCACCAATGTCTTGACCAACCCCGAC
TTCACTGCCGGCCTGGACCGCGGTCACTTCCTCTCGCGCACCGGCAACTGCAAGACGTTTGACGATGGCGCCGAT
GGCTACTGCCGCGGCGAAGGCATCGGGACCGTCATCGTCAAGCGCCTGGACGATGCGCTCGCCGACCATGACCCC
ATCCTGGGAGTCATCCTCGGCGCCTATACCAACCACTCGGCCGAGTCCGAGTCCATCACGAGGCCGCATGTCGGC
GCCCAGCGCGCCATCTTTAGCAAGATCCTCAACCAGGGCGCCGTCGACCCCTATAGCGTCGGCTACGTCGAGATG
CACGGAACGGGCACCCAGGCCGGAGACGCCGGCGAGATGTCGAGCGTTCTCGACACCTTCGCCCCTCCCCTGTCC
CAGGTGAAGCAGGGAAGGACGGCCGACGAGGCTCTTTACCTTGGCTCTGCTAAGGCCAACATCGGCCACGGCGAG
GCATCTTCGGGCGTGTCGAGTCTGATCAAGGTGCTGCTGATGATGCAGAAGAACATGATCGCCCCGCACTGCGGC
ATCAAGACCAAGATCAACCGCAAGTTCCCGACCGATCTGGGCGAGCGCAACGTCAACATCGCCCTGAAGCCGACT
GCCTGGGCCAAGAGCCTCGATCCTTCTAAGCCCAGGCGCGCCTTCGTCAACAACTTCAGCGCTGCCGGCGGCAAC
TCTGCTCTTCTGCTCGAAGATGCACCCCTCGAGCAGGAGTCGCCCTCCGCCGTCGCCGATCCCCGAAGCCCGCAC
CTCGTCGCCTGCTCGGCCAAGAACGGACCCTCTCTGCAGGGCAACCTGCGCTCTCTGCTTCAGGTCCTGAAGCAG
AACCCCGGCATGTCCCTGGGCCAGCTCTCGTACACGACGACGGCGCGCCGCCAGCACCACCAGCACCGCGTCATG
CTTTCAGCTGGCTCGGCCGAGGATCTCTGCACTCAGATCGAGGCAGCCCTTCGCGACGGGGCGGGCATGACCAGG
CCCAAGTCCACTCCCAAGCTCGTCTTTGCCTTCACAGGCCAAGGCGCCCAGTACCCGGGCATGGGGAAGCAGCTT
TTCGAGCACCTATCCTTCTTCCGCACCGAAATGTGCCGACTCGACCAGATGGGGCAGAGCCTTGGCTTCCCGTCT
GTCCTCCCCGTCATTCAGTCCGACGAGCCGGACGTGAGCGTCTTCCCGCCCACCGCCGTTCAGCTGGCGAGCATT
TGCATGCAGATCGCACTCGTCAAACTCTGGGCGTCGTGGAACGTCACTCCGGTCGCAGTCGTTGGCCACAGCCTG
GGCGAGTATGCCGCTCTCAACGCCGCTGGAGTGCTCTCGGACGCAGACACTATCTACCTTGTCGGCAAGCGGGCG
GAGCTGCTCCAGAAGAAGTGCACGCGCGATACTCACGCCATGCTCGTCGTCAAAGGCTCGGTGGATGATGTCGCC
CGCGTTCTGACTGGCCGCCAGTACGAAATCGCCTGCATCAACTCCCCGGTCGAGACGGTGCTGGCCGGCTCCAAC
GACGACATTACCAATTTCAAGGGCGTCCTGGCTGATGCAGGCCTGAAAACTACCTTGCTCAAGGTCCCTTACGCC
TTCCACTCGTCACAGATCGATCCCATTCTGTCGGACTTCACTGCATTGGCTCGCGGCGTGACCTTCTCTAAGGCC
AAGTTACCCGTCTTGTGCCCCTTGAATGGCGACGTCGCCGCCGAGGGTAGCGACGGTTTCGGGCCCGAATATCTC
GCTAGCCACTCTCGCCAGCCAGTCAACATGCTTAAGGCCCTCCAGGCGGCCTACAGCGGCAAGATCATGACTGAC
CAGAGCACCGTTCTGGAGGTCGGCCCACACCCTGCAATCTCCGGCATGGTGCGGCCTGCAATTGGACCGCAAGTC
GCAACCCTCGCTTCGGCCCAGCGTGCCAGGTCTGCCTGGCAGGTTCTGGGGCTGACCCTCAAGGCCCTCTACGCT
GGGGGATCTGACATTCGCTGGGCCGAGTACCACCGCGACTTCACGAGCTCTCACAAGGTCACTCCCCTGCCAGCT
TACAGTTGGGACTTGAAGCCGTACTGGCTTCAATACGTCAACGACTGGTCTCTGCGCAAGGGAGATCCGCCTCTG
ATCGGCAATGATACCTCTAGCGGCAAGCTGGAGAGCACGACAATCCACCGGATTGTCGAGGAAACCAGCGACGCC
AACAAGGCTCACGTTGTTGTTGAGGCGGACATCGCGCGCAAGGACCTTAGTCCCCTGGTGCAGGGTCACGAGGTT
GATGGCATTCCACTCTGCACGCCATCCGTTTACGCCGATATTGCACTGAGCTTGGGCAAGTACCTCATCCAGAGC
TACCGCCCGGATCAGAGGGAGAAGCTCGTCGACGTGTCGGATATGACCATTTCCAAGGCCCTGATCTTGCGTGCG
GGTGCAACTCAGCAGCTGCTCCAGGCACACATGGACGTGGATTGGCCTTCCAAGTCGGCTGCCGTCAAGTTCATG
TCCTTTGACAACAAGCAGAAGCTGCAAGAGCATTCTCGATGCGTCCTGCGATTCAGGGACGGGAGCCTCCAGAAA
GAGCTCCAGAACAACTTGGCAAACACCAAGAAGAAGCAGCAAGCCCTGCGAGACGGTGTGGGCGCAGGAGCAACG
GCTCGGTTCAACAGACCCATGGTGTACCGAGCCATTCGGCCGCTGGCACGGTTCCACGATGACTACCGGGCCATC
GACGAGATCATCCTCAACAGCAAGACGCTTGAGGCGTCGAGCCGTCTCAGCTTCGGCAGCGTGAAGAGGGGTGGT
GTCTATCACACCCATCCTGCCATCATCGACTCCTTGACGCAATCGTGCGGCTTCACCATGAACTGCAACGATGGC
ACTGACCTGGACAACGAGGTGTTCATGAACCACGGCTGGGGCTCTTTCCAGATCTTCGAGCCACTCGACTTCGAC
AAGGTGTATACCACCTACACTCGAATGGAGGAGGGCGCCGACAAGCTGTGGCATGGTGATGTTGTCATTCTTGAT
GGCGATAAGGTCGTCGCGTTCTTCGGCCAGATTGCTATTCAAGGAGTGCCGCGCCGAGTTCTAAAGGTCATCTTG
TCCCTTGAAAGTGGGAACAAGTCCCAGAAGCAGCAGCCCGCCCAGAAGCAGCAACCTGCTGTGGCAGCCCCTTCC
GCCGCAAAAGCTGCCCCCGCGGCGACTCCTTCGGCTGCCGAGCCTTCTCATGCTTCGAAGCTTGCGAAGGCCCTG
CAGGTAATCGCCGAGGAGAGCGGGCTTGCCGTGGAGGACTTGACCGATGGTACCGTCTTCAGTGACGCTGGCATC
GACTCTCTTCTTGGATTGACCATCTCCGCCCGCTTCAAGGAGGAGCTCGACATGGACCTCGACTTCAACGCCTTG
TTCTATGAGTATCCCACTGTTGGGGATCTTAAGACATTCTTTGGCGGGTCCTCTACCGAGTCCGCCGGGTCGTCG
AGCCCCAGCTCCAGCGCCGCTGGGTCCGCCTCCCCCGTCTCCAATGGCACCGGGGCCACCACTCCAGTCACAGAG
GAGCATTCCTCATCTAAGGTCGACTTCCAGCGCGCCCTGTCAATCATATCGGAAGAGAGTGGTGTCGCTACGGAA
GATCTCACCGATGATACGAACTTTGCCGACTCTGGAGTGGATTCTCTGCTGTCCCTTGTCATTGTCAGCCGATTC
CGAGATGAGCTCGAGCTCGACATTCAGCACGAGTCTCTTTTCCTCGAGTGTCCGACTGTTGCCGATCTGAAGCAG
TTGCTTCTTGGGGGGACTGAATCGCCTAGCGAGGCTCAGCCGCAAAACCCCGAGCCTGTCCCGGCTGCCGAGCAG
AAGTCCGCGACAGTGCAGCGCACGGAGACGGAGACGGCTGCCCTCGCTACTCGCAAGAGAGCCGTCGACGAACTC
GTCGCCAAGTACACAGCCGGCTTCTCCGCGGCCGGAGAATCGCCATCGGCTGCTCTACCGAATGACAACGAGAAG
GTCGTCTTGGTTACGGGCGCATCGGGCAGCCTGGGAGGCCATTTGGTCTACCACATTGCCCAGCTCCCGGACGTG
AAGACGGTCGTGTGTCTCAACCGCGAGAACCGAGCAGAGCCCAATGTCCGACAGCAGAAGGCTATGCGGGAGAAG
GGCATTCGGTTTCCGGAAGCTCTCAAACACAAGCTGGTCGTGCTGCAGACTGACAGTGCCAAGCCCATGTTTGGC
TTGTCCAAGAGCGAGTACGAGGGACTCGCGAGCTCTGTCACATATCTGATCCACAACGCGTGGCCTATGAGCGCG
AAGCGACCTTTGGCTGGTTTCGAGTCCCAGTTCCAAGTCATGCGCAACCTGATCGATTTTGCTAGCGATGCCGCC
TCTCGTCGCCCGGAGACCTTCAAGTTCAGTTTCCAGATGGTGTCGTCTATTGGTGTTGTCGGTCACTACGGCCTC
GGCGGCGACGACAGCAAGAGGATTATGGTTCCTGAACAGCGAACTGGAATCGACACCGTCCTTCCCAACGGCTAC
GGAGACGCTAAATGGGGATGCGAGAGGATGCTCGACGAGACTCTGCACAAGTATCCAAACCGCTTCCGCACCATG
GCCGTCCGTCTGGGACAGATTGCCGGATCCAAGACCAGCGGCTATTGGAACCCCATGGAGCACTTCGGCTTCCTG
ATCAAGTCCTCGCAGACCTTGAATGCTCTGCCAGACGTGGACGGCGACGTCTTTTGGACTCCCGTCAACGATATA
GCTGCGACGCTGAGCGACTTGGTCCTGTCCGAACGCAGCCCCTATCCGATCTATCATATCGAGAACCCGGTTGGT
CAGCCATGGCGCGAGACGAATGCCATTTTGGCAGATGCCCTGAAGATCTCGAACTTGATTCCTTTTGAGGAGTGG
GTCGAGCGCGTGCGAGCAGCGCCGCAACGCAACAACCCCGCCTCGACACTCCTGGAGTTCTTGGATGGAAACTAC
AAGCGCATGTCATGCGGCGGCCTTGTTCTAGATGTGCAGAAGACGCTCGAGCATTCGAAGACGCTGAGTAGTGTC
GGGCCGGTGAGCGAGGAGGTGGTCCGGAAATACATTCATATTTGGAAGGAGATTGGATTCTTGAGCGCCTAG
Gene >Hirsu2|6970
ATGGCCAACCAAATGAAGCTGTACCTCTTCGGAGACCAGACCTTTGACATTCAGCCTCACCTCAAGACCTTGATC
CGCGAAAGAGATCACCCCATCCTGGAGAAATTTCTCGTTAAGGCATACGAAGCCGTTCGTACTGAGATCTTCAAG
TTGCCCTACGAGGTTAGGGATGACATTCCTCGCTTCACCTGCCTCGACGATCTGGTTTCTTGGAACCAGAGCAAG
AAGCGGTCGATACCGCTTGACATGGCTGTGACATGCATTTATCAGCTGGGCACTTTTATCCAGTAAGCAGACGCT
GATTCTGGACACTTGTCAGAATCTGAGCTCCAGGGGCTAATAAATCGTGCAGGCAAGCGGATGCTTCCAAGCTTG
GCCCCGACAATGCCCGGGTTGCTGGCATCTGTACGGGAACCCTGGCCGCAGCCGTGGCCAGCTGCAGCCGCAGCC
TGTTGGACCTCGTTCCTATGGCTGTCGATGCAGTCACTGTTGCCTTCAGGGTGGGCATGCACGTGGCCGATGTCG
CGCAGCGCGTGGCGCCGTCGGAGGAATCCGAACCGACCTGGTCTATCATCGTCCCCGGGTCGACGTCTGATGTGG
CCGTTCGAAAGTTCTGTGAAAAGACTGTGGGTAGACTCACATCCTCGGATACTGTTCTCGCTCCTAACCTTCAAT
GTTCCGATTAGACCCTGCCGTTGACGAGCAAACCCTACGTCACCGCCTACGCGCCGAATGGCATTACTGTGAGCG
GGCCTCCGAAGTCCCTCGAGCAGTTCATCAACTCCGATGAGTTCAAGGGCCTCCGATTCAAGGATGCCCCCATCT
ACGGCCCATACCACGCGCCGCATCTGTATTCGCAGTACGACATCGGCAAGATTGTCGAGGGCCTGGCTTGTGACA
CGGTCGGCGAGCGCTCCGAGAATGTCCCTCTCCTCTCCAGCTCGGGAGCCAAGGTAGAAGGACGCACGTTCGCGG
CTCTCCTTAGGTCCGCGGCCGAGCAGATTTTGCTGCAACCTATCCGATGGAGTAGCATCCTTGACGGTTTGCAGA
GCTGTCTCCAGAAGCTCAGTCCCAAGTCGTTCGCCGTCGTTTCGATTGGGACCACGGCGGACCAGCTCGTCTACA
CCGCACTCAAGCAGACGTCGCTGCGAAACTTGATGCCCTCAGCTACGAGCGCAAGCAAGCCTCCCGCCCCGGAAG
CGACGGGTTCCGGCTCTTCGAACCCCAAGAAGCCGAAGCTTGCCATCATTGGCATGTCTGGGCGATTTCCGGGCG
CCAAGGATAACGAGGCGTTCTGGGATCTCCTGCACGAGGGGCTGGATGTCCATAAGCCTGTCCCCGCCCTCCACT
GGGATGCCAAAACGCACGTGGATGCGACTGCCAGTCGCAAGAACACGAGCGCAACGCCCTATGGCTGTTGGCTGG
ACGAGCCCGAGCTCTTCGACGCTCGCTTCTTCAACATTTCGCCGCGCGAGGCGCCACAGATCGACCCGGCGCAGC
GACTAGCTCTCATGACGGCATACGAGGCCATTGAGCAGGCCGGAATCGTCCCCGACGCCACGCCCTCAACCCGAC
GCGACCGGGTGGGCGTCTTCTACGGAGTGACGAGCAATGATTGGATGGAGACGAACAGTGCCCAGAACATCGACA
CCTACTTCATTCCCGGCGGCAACCGAGCCTTTATCCCAGGGCGCATCAACTACTGCTTCAAGTTTAGCGGCCCGA
GCTACGCCATCGATACGGCCTGCTCGTCCAGTCTAGCGGGCATCCACTTGGCCTGCAATTCGCTGTGGCGAGGCG
ACATCGACACGGCCATCGCCGGCGGCACCAATGTCTTGACCAACCCCGACTTCACTGCCGGCCTGGACCGCGGTC
ACTTCCTCTCGCGCACCGGCAACTGCAAGACGTTTGACGATGGCGCCGATGGCTACTGCCGCGGCGAAGGCATCG
GGACCGTCATCGTCAAGCGCCTGGACGATGCGCTCGCCGACCATGACCCCATCCTGGGAGTCATCCTCGGCGCCT
ATACCAACCACTCGGCCGAGTCCGAGTCCATCACGAGGCCGCATGTCGGCGCCCAGCGCGCCATCTTTAGCAAGA
TCCTCAACCAGGGCGCCGTCGACCCCTATAGCGTCGGCTACGTCGAGATGCACGGAACGGGCACCCAGGCCGGAG
ACGCCGGCGAGATGTCGAGCGTTCTCGACACCTTCGCCCCTCCCCTGTCCCAGGTGAAGCAGGGAAGGACGGCCG
ACGAGGCTCTTTACCTTGGCTCTGCTAAGGCCAACATCGGCCACGGCGAGGCATCTTCGGGCGTGTCGAGTCTGA
TCAAGGTGCTGCTGATGATGCAGAAGAACATGATCGCCCCGCACTGCGGCATCAAGACCAAGATCAACCGCAAGT
TCCCGACCGATCTGGGCGAGCGCAACGTCAACATCGCCCTGAAGCCGACTGCCTGGGCCAAGAGCCTCGATCCTT
CTAAGCCCAGGCGCGCCTTCGTCAACAACTTCAGCGCTGCCGGCGGCAACTCTGCTCTTCTGCTCGAAGATGCAC
CCCTCGAGCAGGAGTCGCCCTCCGCCGTCGCCGATCCCCGAAGCCCGCACCTCGTCGCCTGCTCGGCCAAGAACG
GACCCTCTCTGCAGGGCAACCTGCGCTCTCTGCTTCAGGTCCTGAAGCAGAACCCCGGCATGTCCCTGGGCCAGC
TCTCGTACACGACGACGGCGCGCCGCCAGCACCACCAGCACCGCGTCATGCTTTCAGCTGGCTCGGCCGAGGATC
TCTGCACTCAGATCGAGGCAGCCCTTCGCGACGGGGCGGGCATGACCAGGCCCAAGTCCACTCCCAAGCTCGTCT
TTGCCTTCACAGGCCAAGGCGCCCAGTACCCGGGCATGGGGAAGCAGCTTTTCGAGCACCTATCCTTCTTCCGCA
CCGAAATGTGCCGACTCGACCAGATGGGGCAGAGCCTTGGCTTCCCGTCTGTCCTCCCCGTCATTCAGTCCGACG
AGCCGGACGTGAGCGTCTTCCCGCCCACCGCCGTTCAGCTGGCGAGCATTTGCATGCAGATCGCACTCGTCAAAC
TCTGGGCGTCGTGGAACGTCACTCCGGTCGCAGTCGTTGGCCACAGCCTGGGCGAGTATGCCGCTCTCAACGCCG
CTGGAGTGCTCTCGGACGCAGACACTATCTACCTTGTCGGCAAGCGGGCGGAGCTGCTCCAGAAGAAGTGCACGC
GCGATACTCACGCCATGCTCGTCGTCAAAGGCTCGGTGGATGATGTCGCCCGCGTTCTGACTGGCCGCCAGTACG
AAATCGCCTGCATCAACTCCCCGGTCGAGACGGTGCTGGCCGGCTCCAACGACGACATTACCAATTTCAAGGGCG
TCCTGGCTGATGCAGGCCTGAAAACTACCTTGCTCAAGGTCCCTTACGCCTTCCACTCGTCACAGATCGATCCCA
TTCTGTCGGACTTCACTGCATTGGCTCGCGGCGTGACCTTCTCTAAGGCCAAGTTACCCGTCTTGTGCCCCTTGA
ATGGCGACGTCGCCGCCGAGGGTAGCGACGGTTTCGGGCCCGAATATCTCGCTAGCCACTCTCGCCAGCCAGTCA
ACATGCTTAAGGCCCTCCAGGCGGCCTACAGCGGCAAGATCATGACTGACCAGAGCACCGTTCTGGAGGTCGGCC
CACACCCTGCAATCTCCGGCATGGTGCGGCCTGCAATTGGACCGCAAGTCGCAACCCTCGCTTCGGCCCAGCGTG
CCAGGTCTGCCTGGCAGGTTCTGGGGCTGACCCTCAAGGCCCTCTACGCTGGGGGATCTGACATTCGCTGGGCCG
AGTACCACCGCGACTTCACGAGCTCTCACAAGGTCACTCCCCTGCCAGCTTACAGTTGGGACTTGAAGCCGTACT
GGCTTCAATACGTCAACGACTGGTCTCTGCGCAAGGGAGATCCGCCTCTGATCGGCAATGATACCTCTAGCGGCA
AGCTGGAGAGCACGACAATCCACCGGATTGTCGAGGAAACCAGCGACGCCAACAAGGCTCACGTTGTTGTTGAGG
CGGACATCGCGCGCAAGGACCTTAGTCCCCTGGTGCAGGGTCACGAGGTTGATGGCATTCCACTCTGCACGCCAT
CCGTTTACGCCGATATTGCACTGAGCTTGGGCAAGTACCTCATCCAGAGCTACCGCCCGGATCAGAGGGAGAAGC
TCGTCGACGTGTCGGATATGACCATTTCCAAGGCCCTGATCTTGCGTGCGGGTGCAACTCAGCAGCTGCTCCAGG
CACACATGGACGTGGATTGGCCTTCCAAGTCGGCTGCCGTCAAGTTCATGTCCTTTGACGTAAGTATTTGTTTCC
TCCTATTACAGTGCTTGAGGCCCAGCTAACTGAATCGATTATAGAACAAGCAGAAGCTGCAAGAGCATTCTCGAT
GCGTCCTGCGATTCAGGGACGGGAGCCTCCAGAAAGAGCTCCAGAACAACTTGGCAAACACCAAGAAGAAGCAGC
AAGCCCTGCGAGACGGTGTGGGCGCAGGAGCAACGGCTCGGTTCAACAGACCCATGGTGTACCGAGCCATTCGGC
CGCTGGCACGGTTCCACGATGACTACCGGGCCATCGACGAGATCATCCTCAACAGCAAGACGCTTGAGGCGTCGA
GCCGTCTCAGCTTCGGCAGCGTGAAGAGGGGTGGTGTCTATCACACCCATCCTGCCATCATCGACTCCTTGACGC
AATCGTGCGGCTTCACCATGAACTGCAACGATGGCACTGACCTGGACAACGAGGTGTTCATGAACCACGGCTGGG
GCTCTTTCCAGATCTTCGAGCCACTCGACTTCGACAAGGTGTATACCACCTACACTCGAATGGAGGAGGGCGCCG
ACAAGCTGTGGCATGGTGATGTTGTCATTCTTGATGGCGATAAGGTCGTCGCGTTCTTCGGCCAGATTGCTGTCC
GTGGCCCCTACACCCCAGGCTCCCACCCACACATCTTGGCTAACTATTTCTCAGATTCAAGGAGTGCCGCGCCGA
GTTCTAAAGGTCATCTTGTCCCTTGAAAGTGGGAACAAGTCCCAGAAGCAGCAGCCCGCCCAGAAGCAGCAACCT
GCTGTGGCAGCCCCTTCCGCCGCAAAAGCTGCCCCCGCGGCGACTCCTTCGGCTGCCGAGCCTTCTCATGCTTCG
AAGCTTGCGAAGGCCCTGCAGGTAATCGCCGAGGAGAGCGGGCTTGCCGTGGAGGACTTGACCGATGGTACCGTC
TTCAGTGACGCTGGCATCGACTCTCTTCTTGGATTGACCATCTCCGCCCGCTTCAAGGAGGAGCTCGACATGGAC
CTCGACTTCAACGCCTTGTTCTATGAGTATCCCACTGTTGGGGATCTTAAGACATTCTTTGGCGGGTCCTCTACC
GAGTCCGCCGGGTCGTCGAGCCCCAGCTCCAGCGCCGCTGGGTCCGCCTCCCCCGTCTCCAATGGCACCGGGGCC
ACCACTCCAGTCACAGAGGAGCATTCCTCATCTAAGGTCGACTTCCAGCGCGCCCTGTCAATCATATCGGAAGAG
AGTGGTGTCGCTACGGAAGATCTCACCGATGATACGAACTTTGCCGACTCTGGAGTGGATTCTCTGCTGTCCCTT
GTCATTGTCAGCCGATTCCGAGATGAGCTCGAGCTCGACATTCAGCACGAGTCTCTTTTCCTCGAGTGTCCGACT
GTTGCCGATCTGAAGCAGTTGCTTCTTGGGGGGACTGAATCGCCTAGCGAGGCTCAGCCGCAAAACCCCGAGCCT
GTCCCGGCTGCCGAGCAGAAGTCCGCGACAGTGCAGCGCACGGAGACGGAGACGGCTGCCCTCGCTACTCGCAAG
AGAGCCGTCGACGAACTCGTCGCCAAGTACACAGCCGGCTTCTCCGCGGCCGGAGAATCGCCATCGGCTGCTCTA
CCGAATGACAACGAGAAGGTCGTCTTGGTTACGGGCGCATCGGGCAGCCTGGGAGGCCATTTGGTCTACCACATT
GCCCAGCTCCCGGACGTGAAGACGGTCGTGTGTCTCAACCGCGAGAACCGAGCAGAGCCCAATGTCCGACAGCAG
AAGGCTATGCGGGAGAAGGGCATTCGGTTTCCGGAAGCTCTCAAACACAAGCTGGTCGTGCTGCAGACTGACAGT
GCCAAGCCCATGTTTGGCTTGTCCAAGAGCGAGTACGAGGGACTCGCGAGCTCTGTCACATATCTGATCCACAAC
GCGTGGCCTATGAGCGCGAAGCGACCTTTGGCTGGTTTCGAGTCCCAGTTCCAAGTCATGCGCAACCTGATCGAT
TTTGCTAGCGATGCCGCCTCTCGTCGCCCGGAGACCTTCAAGTTCAGTTTCCAGATGGTGTCGTCTATTGGTGTT
GTCGGTCACTACGGCCTCGGCGGCGACGACAGCAAGAGGATTATGGTTCCTGAACAGCGAACTGGAATCGACACC
GTCCTTCCCAACGGCTACGGAGACGCTAAATGGGGATGCGAGAGGATGCTCGACGAGACTCTGCACAAGTATCCA
AACCGCTTCCGCACCATGGCCGTCCGTCTGGGACAGATTGCCGGATCCAAGACCAGCGGCTATTGGAACCCCATG
GAGCACTTCGGCTTCCTGATCAAGTCCTCGCAGACCTTGAATGCTCTGCCAGACGTGGACGGCGACGTCTTTTGG
ACTCCCGTCAACGATATAGCTGCGACGCTGAGCGACTTGGTCCTGTCCGAACGCAGCCCCTATCCGATCTATCAT
ATCGAGAACCCGGTTGGTCAGCCATGGCGCGAGACGAATGCCATTTTGGCAGATGCCCTGAAGATCTCGAACTTG
ATTCCTTTTGAGGAGTGGGTCGAGCGCGTGCGAGCAGCGCCGCAACGCAACAACCCCGCCTCGACACTCCTGGAG
TTCTTGGATGGAAACTACAAGCGCATGTCATGCGGCGGCCTTGTTCTAGATGTGCAGAAGACGCTCGAGCATTCG
AAGACGCTGAGTAGTGTCGGGCCGGTGAGCGAGGAGGTGGTCCGGAAATACATTCATATTTGGAAGGAGATTGGA
TTCTTGAGCGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail