Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6970
Gene name
LocationContig_381:3443..10508
Strand-
Gene length (bp)7065
Transcript length (bp)6822
Coding sequence length (bp)6822
Protein length (aa) 2274

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 2.8E-78 372 619
PF16073 SAT Starter unit:ACP transacylase in aflatoxin biosynthesis 1.8E-73 8 238
PF00698 Acyl_transf_1 Acyl transferase domain 9.0E-34 908 1192
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 2.6E-28 627 751
PF00550 PP-binding Phosphopantetheine attachment site 1.5E-08 1650 1711
PF00550 PP-binding Phosphopantetheine attachment site 6.8E-11 1763 1826
PF07993 NAD_binding_4 Male sterility protein 9.6E-21 1904 2148
PF14765 PS-DH Polyketide synthase dehydratase 3.5E-11 1291 1591

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 1 1868 0.0E+00
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 1 1755 0.0E+00
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 2 1827 0.0E+00
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 372 1600 1.0E-100
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 372 1600 1.0E-100
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 1 1868 0.0E+00
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 1 1755 0.0E+00
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 2 1827 0.0E+00
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 372 1600 1.0E-100
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 372 1600 1.0E-100
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 372 1600 1.0E-100
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 372 1259 4.0E-99
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 372 1341 1.0E-98
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 358 1260 2.0E-98
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 372 1189 2.0E-98
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 372 1189 2.0E-98
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 372 1283 1.0E-97
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 347 1207 8.0E-97
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 347 1207 1.0E-96
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 372 1344 3.0E-96
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 347 1207 1.0E-95
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 372 1344 7.0E-95
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 367 1261 1.0E-94
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 359 1208 2.0E-93
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 359 1208 2.0E-93
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 359 1208 2.0E-93
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 359 1208 2.0E-93
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 359 1208 4.0E-93
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 366 1260 6.0E-93
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 367 1259 1.0E-92
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 363 1345 1.0E-91
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 364 1389 5.0E-91
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 372 1189 2.0E-90
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 372 1189 2.0E-90
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 372 1189 2.0E-90
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 366 1275 9.0E-90
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 371 1296 1.0E-89
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 372 1259 1.0E-89
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 372 1454 3.0E-89
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 372 1275 1.0E-88
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 371 1271 2.0E-88
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 372 1108 2.0E-88
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 372 1259 1.0E-87
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 372 1261 2.0E-87
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 363 1259 4.0E-87
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 364 1373 6.0E-87
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 372 1275 7.0E-87
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 364 1373 9.0E-87
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 372 1275 1.0E-86
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 372 1260 1.0E-84
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 364 1259 2.0E-84
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 366 1259 3.0E-84
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 371 1271 4.0E-84
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 372 1261 7.0E-84
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 433 1259 3.0E-83
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 372 1261 3.0E-83
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 372 1275 9.0E-83
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 369 1260 1.0E-82
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 372 1135 1.0E-81
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 372 1135 1.0E-81
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 372 1135 1.0E-81
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 365 1259 9.0E-81
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 372 1259 7.0E-80
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 433 1259 2.0E-79
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 372 1282 1.0E-78
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 373 1259 2.0E-78
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 369 1260 3.0E-78
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 372 1289 1.0E-77
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 361 1228 2.0E-77
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 372 1259 3.0E-77
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 372 1259 3.0E-77
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 372 1259 4.0E-77
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 372 1282 9.0E-77
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 372 884 1.0E-76
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 371 884 1.0E-76
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 372 1260 2.0E-76
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 372 1259 2.0E-76
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 353 890 7.0E-76
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 372 1228 2.0E-75
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 372 890 2.0E-75
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 351 890 4.0E-75
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 371 1278 6.0E-75
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 307 898 2.0E-74
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 372 1259 2.0E-74
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 368 1277 4.0E-74
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 372 1282 1.0E-73
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 372 892 1.0E-71
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 372 1280 1.0E-71
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 357 895 3.0E-69
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 372 805 9.0E-65
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 355 892 7.0E-64
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 371 1203 5.0E-63
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 348 895 1.0E-62
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 371 1109 1.0E-62
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 371 1030 2.0E-62
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 371 1208 2.0E-61
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 368 798 4.0E-60
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 372 1203 1.0E-59
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 361 889 4.0E-58
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 372 925 4.0E-58
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 372 884 2.0E-52
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 372 890 1.0E-51
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 371 805 7.0E-51
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 372 744 1.0E-47
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 372 824 1.0E-45
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 372 833 4.0E-44
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 830 1344 3.0E-27
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 907 1196 6.0E-22
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 906 1193 2.0E-21
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 459 806 5.0E-21
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 904 1306 7.0E-21
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 907 1211 1.0E-20
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 445 747 4.0E-18
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 368 747 4.0E-18
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 368 747 4.0E-18
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 368 747 4.0E-18
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 446 747 4.0E-18
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 368 747 5.0E-18
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 368 747 5.0E-18
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 371 747 6.0E-18
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 459 747 3.0E-17
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 1726 1844 4.0E-17
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 446 729 4.0E-16
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 863 1238 2.0E-15
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 369 753 5.0E-15
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 906 1193 1.0E-14
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 906 1193 1.0E-14
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 906 1193 1.0E-14
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 906 1193 1.0E-14
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 906 1193 2.0E-14
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 906 1193 2.0E-14
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 428 695 2.0E-14
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 369 806 4.0E-14
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 906 1193 4.0E-14
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 499 729 4.0E-14
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 369 753 6.0E-14
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 454 806 6.0E-14
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 439 806 8.0E-14
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 907 1134 9.0E-14
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 499 729 1.0E-13
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 505 805 2.0E-13
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 371 753 2.0E-13
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 371 747 4.0E-13
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 369 747 6.0E-13
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1782 2205 1.0E-12
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 522 772 3.0E-12
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 487 805 4.0E-12
sp|P43712|FABD_HAEIN Malonyl CoA-acyl carrier protein transacylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabD PE=3 SV=1 906 1197 6.0E-12
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 461 806 7.0E-12
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 445 803 2.0E-11
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 461 752 2.0E-11
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 461 752 2.0E-11
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 446 747 2.0E-11
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 446 747 2.0E-11
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 446 747 2.0E-11
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 446 747 2.0E-11
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 445 747 2.0E-11
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 433 753 2.0E-11
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 1751 2221 2.0E-11
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 907 1193 4.0E-11
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 371 753 5.0E-11
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 446 723 5.0E-11
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 907 1131 1.0E-10
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 365 691 1.0E-10
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 906 1130 2.0E-10
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 371 753 5.0E-10
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 445 804 6.0E-10
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1898 2151 7.0E-10
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 909 1193 9.0E-10
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1902 2202 1.0E-09
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1778 2271 1.0E-09
sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2 906 1193 1.0E-09
sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabD PE=3 SV=2 906 1193 1.0E-09
sp|Q8X8I7|FABD_ECO57 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3 906 1193 2.0E-09
sp|Q8K9J6|FABD_BUCAP Malonyl CoA-acyl carrier protein transacylase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabD PE=3 SV=1 911 1193 2.0E-09
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 371 753 2.0E-09
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 369 747 2.0E-09
sp|O85140|FABD_SALTY Malonyl CoA-acyl carrier protein transacylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabD PE=1 SV=3 906 1193 2.0E-09
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 491 806 3.0E-09
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 457 801 3.0E-09
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 907 1130 3.0E-09
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 1780 2151 7.0E-09
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 433 751 9.0E-09
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 445 809 2.0E-08
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 907 1261 6.0E-08
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1897 2207 9.0E-08
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 539 803 1.0E-07
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1763 2151 2.0E-07
sp|P43678|KAS1_STRRM Oxytetracycline polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces rimosus PE=3 SV=2 371 752 2.0E-07
sp|Q89AH0|FABD_BUCBP Malonyl CoA-acyl carrier protein transacylase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabD PE=3 SV=1 958 1094 3.0E-07
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 539 803 5.0E-07
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 539 803 5.0E-07
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 539 803 5.0E-07
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1902 2160 6.0E-07
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1903 2207 8.0E-07
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1903 2207 8.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7226 0.357 0.1096 0.109 0.1725 0.0286 0.0413 0.048 0.1144 0.023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 32 PKS

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup59
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1119
Ophiocordyceps australis 1348a (Ghana) OphauG2|676
Ophiocordyceps australis 1348a (Ghana) OphauG2|3943
Ophiocordyceps australis 1348a (Ghana) OphauG2|2993
Ophiocordyceps australis 1348a (Ghana) OphauG2|373
Ophiocordyceps australis map64 (Brazil) OphauB2|1594
Ophiocordyceps australis map64 (Brazil) OphauB2|2073
Ophiocordyceps australis map64 (Brazil) OphauB2|3136
Ophiocordyceps australis map64 (Brazil) OphauB2|590
Ophiocordyceps australis map64 (Brazil) OphauB2|8024
Ophiocordyceps camponoti-floridani Ophcf2|06417
Ophiocordyceps camponoti-floridani Ophcf2|02938
Ophiocordyceps camponoti-rufipedis Ophun1|7485
Ophiocordyceps camponoti-rufipedis Ophun1|3498
Ophiocordyceps kimflemingae Ophio5|1446
Ophiocordyceps kimflemingae Ophio5|6649
Ophiocordyceps subramaniannii Hirsu2|6970 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6425
Ophiocordyceps subramaniannii Hirsu2|5821
Ophiocordyceps subramaniannii Hirsu2|3798

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6970
MANQMKLYLFGDQTFDIQPHLKTLIRERDHPILEKFLVKAYEAVRTEIFKLPYEVRDDIPRFTCLDDLVSWNQSK
KRSIPLDMAVTCIYQLGTFIQQADASKLGPDNARVAGICTGTLAAAVASCSRSLLDLVPMAVDAVTVAFRVGMHV
ADVAQRVAPSEESEPTWSIIVPGSTSDVAVRKFCEKTTLPLTSKPYVTAYAPNGITVSGPPKSLEQFINSDEFKG
LRFKDAPIYGPYHAPHLYSQYDIGKIVEGLACDTVGERSENVPLLSSSGAKVEGRTFAALLRSAAEQILLQPIRW
SSILDGLQSCLQKLSPKSFAVVSIGTTADQLVYTALKQTSLRNLMPSATSASKPPAPEATGSGSSNPKKPKLAII
GMSGRFPGAKDNEAFWDLLHEGLDVHKPVPALHWDAKTHVDATASRKNTSATPYGCWLDEPELFDARFFNISPRE
APQIDPAQRLALMTAYEAIEQAGIVPDATPSTRRDRVGVFYGVTSNDWMETNSAQNIDTYFIPGGNRAFIPGRIN
YCFKFSGPSYAIDTACSSSLAGIHLACNSLWRGDIDTAIAGGTNVLTNPDFTAGLDRGHFLSRTGNCKTFDDGAD
GYCRGEGIGTVIVKRLDDALADHDPILGVILGAYTNHSAESESITRPHVGAQRAIFSKILNQGAVDPYSVGYVEM
HGTGTQAGDAGEMSSVLDTFAPPLSQVKQGRTADEALYLGSAKANIGHGEASSGVSSLIKVLLMMQKNMIAPHCG
IKTKINRKFPTDLGERNVNIALKPTAWAKSLDPSKPRRAFVNNFSAAGGNSALLLEDAPLEQESPSAVADPRSPH
LVACSAKNGPSLQGNLRSLLQVLKQNPGMSLGQLSYTTTARRQHHQHRVMLSAGSAEDLCTQIEAALRDGAGMTR
PKSTPKLVFAFTGQGAQYPGMGKQLFEHLSFFRTEMCRLDQMGQSLGFPSVLPVIQSDEPDVSVFPPTAVQLASI
CMQIALVKLWASWNVTPVAVVGHSLGEYAALNAAGVLSDADTIYLVGKRAELLQKKCTRDTHAMLVVKGSVDDVA
RVLTGRQYEIACINSPVETVLAGSNDDITNFKGVLADAGLKTTLLKVPYAFHSSQIDPILSDFTALARGVTFSKA
KLPVLCPLNGDVAAEGSDGFGPEYLASHSRQPVNMLKALQAAYSGKIMTDQSTVLEVGPHPAISGMVRPAIGPQV
ATLASAQRARSAWQVLGLTLKALYAGGSDIRWAEYHRDFTSSHKVTPLPAYSWDLKPYWLQYVNDWSLRKGDPPL
IGNDTSSGKLESTTIHRIVEETSDANKAHVVVEADIARKDLSPLVQGHEVDGIPLCTPSVYADIALSLGKYLIQS
YRPDQREKLVDVSDMTISKALILRAGATQQLLQAHMDVDWPSKSAAVKFMSFDNKQKLQEHSRCVLRFRDGSLQK
ELQNNLANTKKKQQALRDGVGAGATARFNRPMVYRAIRPLARFHDDYRAIDEIILNSKTLEASSRLSFGSVKRGG
VYHTHPAIIDSLTQSCGFTMNCNDGTDLDNEVFMNHGWGSFQIFEPLDFDKVYTTYTRMEEGADKLWHGDVVILD
GDKVVAFFGQIAIQGVPRRVLKVILSLESGNKSQKQQPAQKQQPAVAAPSAAKAAPAATPSAAEPSHASKLAKAL
QVIAEESGLAVEDLTDGTVFSDAGIDSLLGLTISARFKEELDMDLDFNALFYEYPTVGDLKTFFGGSSTESAGSS
SPSSSAAGSASPVSNGTGATTPVTEEHSSSKVDFQRALSIISEESGVATEDLTDDTNFADSGVDSLLSLVIVSRF
RDELELDIQHESLFLECPTVADLKQLLLGGTESPSEAQPQNPEPVPAAEQKSATVQRTETETAALATRKRAVDEL
VAKYTAGFSAAGESPSAALPNDNEKVVLVTGASGSLGGHLVYHIAQLPDVKTVVCLNRENRAEPNVRQQKAMREK
GIRFPEALKHKLVVLQTDSAKPMFGLSKSEYEGLASSVTYLIHNAWPMSAKRPLAGFESQFQVMRNLIDFASDAA
SRRPETFKFSFQMVSSIGVVGHYGLGGDDSKRIMVPEQRTGIDTVLPNGYGDAKWGCERMLDETLHKYPNRFRTM
AVRLGQIAGSKTSGYWNPMEHFGFLIKSSQTLNALPDVDGDVFWTPVNDIAATLSDLVLSERSPYPIYHIENPVG
QPWRETNAILADALKISNLIPFEEWVERVRAAPQRNNPASTLLEFLDGNYKRMSCGGLVLDVQKTLEHSKTLSSV
GPVSEEVVRKYIHIWKEIGFLSA*
Coding >Hirsu2|6970
ATGGCCAACCAAATGAAGCTGTACCTCTTCGGAGACCAGACCTTTGACATTCAGCCTCACCTCAAGACCTTGATC
CGCGAAAGAGATCACCCCATCCTGGAGAAATTTCTCGTTAAGGCATACGAAGCCGTTCGTACTGAGATCTTCAAG
TTGCCCTACGAGGTTAGGGATGACATTCCTCGCTTCACCTGCCTCGACGATCTGGTTTCTTGGAACCAGAGCAAG
AAGCGGTCGATACCGCTTGACATGGCTGTGACATGCATTTATCAGCTGGGCACTTTTATCCAGCAAGCGGATGCT
TCCAAGCTTGGCCCCGACAATGCCCGGGTTGCTGGCATCTGTACGGGAACCCTGGCCGCAGCCGTGGCCAGCTGC
AGCCGCAGCCTGTTGGACCTCGTTCCTATGGCTGTCGATGCAGTCACTGTTGCCTTCAGGGTGGGCATGCACGTG
GCCGATGTCGCGCAGCGCGTGGCGCCGTCGGAGGAATCCGAACCGACCTGGTCTATCATCGTCCCCGGGTCGACG
TCTGATGTGGCCGTTCGAAAGTTCTGTGAAAAGACTACCCTGCCGTTGACGAGCAAACCCTACGTCACCGCCTAC
GCGCCGAATGGCATTACTGTGAGCGGGCCTCCGAAGTCCCTCGAGCAGTTCATCAACTCCGATGAGTTCAAGGGC
CTCCGATTCAAGGATGCCCCCATCTACGGCCCATACCACGCGCCGCATCTGTATTCGCAGTACGACATCGGCAAG
ATTGTCGAGGGCCTGGCTTGTGACACGGTCGGCGAGCGCTCCGAGAATGTCCCTCTCCTCTCCAGCTCGGGAGCC
AAGGTAGAAGGACGCACGTTCGCGGCTCTCCTTAGGTCCGCGGCCGAGCAGATTTTGCTGCAACCTATCCGATGG
AGTAGCATCCTTGACGGTTTGCAGAGCTGTCTCCAGAAGCTCAGTCCCAAGTCGTTCGCCGTCGTTTCGATTGGG
ACCACGGCGGACCAGCTCGTCTACACCGCACTCAAGCAGACGTCGCTGCGAAACTTGATGCCCTCAGCTACGAGC
GCAAGCAAGCCTCCCGCCCCGGAAGCGACGGGTTCCGGCTCTTCGAACCCCAAGAAGCCGAAGCTTGCCATCATT
GGCATGTCTGGGCGATTTCCGGGCGCCAAGGATAACGAGGCGTTCTGGGATCTCCTGCACGAGGGGCTGGATGTC
CATAAGCCTGTCCCCGCCCTCCACTGGGATGCCAAAACGCACGTGGATGCGACTGCCAGTCGCAAGAACACGAGC
GCAACGCCCTATGGCTGTTGGCTGGACGAGCCCGAGCTCTTCGACGCTCGCTTCTTCAACATTTCGCCGCGCGAG
GCGCCACAGATCGACCCGGCGCAGCGACTAGCTCTCATGACGGCATACGAGGCCATTGAGCAGGCCGGAATCGTC
CCCGACGCCACGCCCTCAACCCGACGCGACCGGGTGGGCGTCTTCTACGGAGTGACGAGCAATGATTGGATGGAG
ACGAACAGTGCCCAGAACATCGACACCTACTTCATTCCCGGCGGCAACCGAGCCTTTATCCCAGGGCGCATCAAC
TACTGCTTCAAGTTTAGCGGCCCGAGCTACGCCATCGATACGGCCTGCTCGTCCAGTCTAGCGGGCATCCACTTG
GCCTGCAATTCGCTGTGGCGAGGCGACATCGACACGGCCATCGCCGGCGGCACCAATGTCTTGACCAACCCCGAC
TTCACTGCCGGCCTGGACCGCGGTCACTTCCTCTCGCGCACCGGCAACTGCAAGACGTTTGACGATGGCGCCGAT
GGCTACTGCCGCGGCGAAGGCATCGGGACCGTCATCGTCAAGCGCCTGGACGATGCGCTCGCCGACCATGACCCC
ATCCTGGGAGTCATCCTCGGCGCCTATACCAACCACTCGGCCGAGTCCGAGTCCATCACGAGGCCGCATGTCGGC
GCCCAGCGCGCCATCTTTAGCAAGATCCTCAACCAGGGCGCCGTCGACCCCTATAGCGTCGGCTACGTCGAGATG
CACGGAACGGGCACCCAGGCCGGAGACGCCGGCGAGATGTCGAGCGTTCTCGACACCTTCGCCCCTCCCCTGTCC
CAGGTGAAGCAGGGAAGGACGGCCGACGAGGCTCTTTACCTTGGCTCTGCTAAGGCCAACATCGGCCACGGCGAG
GCATCTTCGGGCGTGTCGAGTCTGATCAAGGTGCTGCTGATGATGCAGAAGAACATGATCGCCCCGCACTGCGGC
ATCAAGACCAAGATCAACCGCAAGTTCCCGACCGATCTGGGCGAGCGCAACGTCAACATCGCCCTGAAGCCGACT
GCCTGGGCCAAGAGCCTCGATCCTTCTAAGCCCAGGCGCGCCTTCGTCAACAACTTCAGCGCTGCCGGCGGCAAC
TCTGCTCTTCTGCTCGAAGATGCACCCCTCGAGCAGGAGTCGCCCTCCGCCGTCGCCGATCCCCGAAGCCCGCAC
CTCGTCGCCTGCTCGGCCAAGAACGGACCCTCTCTGCAGGGCAACCTGCGCTCTCTGCTTCAGGTCCTGAAGCAG
AACCCCGGCATGTCCCTGGGCCAGCTCTCGTACACGACGACGGCGCGCCGCCAGCACCACCAGCACCGCGTCATG
CTTTCAGCTGGCTCGGCCGAGGATCTCTGCACTCAGATCGAGGCAGCCCTTCGCGACGGGGCGGGCATGACCAGG
CCCAAGTCCACTCCCAAGCTCGTCTTTGCCTTCACAGGCCAAGGCGCCCAGTACCCGGGCATGGGGAAGCAGCTT
TTCGAGCACCTATCCTTCTTCCGCACCGAAATGTGCCGACTCGACCAGATGGGGCAGAGCCTTGGCTTCCCGTCT
GTCCTCCCCGTCATTCAGTCCGACGAGCCGGACGTGAGCGTCTTCCCGCCCACCGCCGTTCAGCTGGCGAGCATT
TGCATGCAGATCGCACTCGTCAAACTCTGGGCGTCGTGGAACGTCACTCCGGTCGCAGTCGTTGGCCACAGCCTG
GGCGAGTATGCCGCTCTCAACGCCGCTGGAGTGCTCTCGGACGCAGACACTATCTACCTTGTCGGCAAGCGGGCG
GAGCTGCTCCAGAAGAAGTGCACGCGCGATACTCACGCCATGCTCGTCGTCAAAGGCTCGGTGGATGATGTCGCC
CGCGTTCTGACTGGCCGCCAGTACGAAATCGCCTGCATCAACTCCCCGGTCGAGACGGTGCTGGCCGGCTCCAAC
GACGACATTACCAATTTCAAGGGCGTCCTGGCTGATGCAGGCCTGAAAACTACCTTGCTCAAGGTCCCTTACGCC
TTCCACTCGTCACAGATCGATCCCATTCTGTCGGACTTCACTGCATTGGCTCGCGGCGTGACCTTCTCTAAGGCC
AAGTTACCCGTCTTGTGCCCCTTGAATGGCGACGTCGCCGCCGAGGGTAGCGACGGTTTCGGGCCCGAATATCTC
GCTAGCCACTCTCGCCAGCCAGTCAACATGCTTAAGGCCCTCCAGGCGGCCTACAGCGGCAAGATCATGACTGAC
CAGAGCACCGTTCTGGAGGTCGGCCCACACCCTGCAATCTCCGGCATGGTGCGGCCTGCAATTGGACCGCAAGTC
GCAACCCTCGCTTCGGCCCAGCGTGCCAGGTCTGCCTGGCAGGTTCTGGGGCTGACCCTCAAGGCCCTCTACGCT
GGGGGATCTGACATTCGCTGGGCCGAGTACCACCGCGACTTCACGAGCTCTCACAAGGTCACTCCCCTGCCAGCT
TACAGTTGGGACTTGAAGCCGTACTGGCTTCAATACGTCAACGACTGGTCTCTGCGCAAGGGAGATCCGCCTCTG
ATCGGCAATGATACCTCTAGCGGCAAGCTGGAGAGCACGACAATCCACCGGATTGTCGAGGAAACCAGCGACGCC
AACAAGGCTCACGTTGTTGTTGAGGCGGACATCGCGCGCAAGGACCTTAGTCCCCTGGTGCAGGGTCACGAGGTT
GATGGCATTCCACTCTGCACGCCATCCGTTTACGCCGATATTGCACTGAGCTTGGGCAAGTACCTCATCCAGAGC
TACCGCCCGGATCAGAGGGAGAAGCTCGTCGACGTGTCGGATATGACCATTTCCAAGGCCCTGATCTTGCGTGCG
GGTGCAACTCAGCAGCTGCTCCAGGCACACATGGACGTGGATTGGCCTTCCAAGTCGGCTGCCGTCAAGTTCATG
TCCTTTGACAACAAGCAGAAGCTGCAAGAGCATTCTCGATGCGTCCTGCGATTCAGGGACGGGAGCCTCCAGAAA
GAGCTCCAGAACAACTTGGCAAACACCAAGAAGAAGCAGCAAGCCCTGCGAGACGGTGTGGGCGCAGGAGCAACG
GCTCGGTTCAACAGACCCATGGTGTACCGAGCCATTCGGCCGCTGGCACGGTTCCACGATGACTACCGGGCCATC
GACGAGATCATCCTCAACAGCAAGACGCTTGAGGCGTCGAGCCGTCTCAGCTTCGGCAGCGTGAAGAGGGGTGGT
GTCTATCACACCCATCCTGCCATCATCGACTCCTTGACGCAATCGTGCGGCTTCACCATGAACTGCAACGATGGC
ACTGACCTGGACAACGAGGTGTTCATGAACCACGGCTGGGGCTCTTTCCAGATCTTCGAGCCACTCGACTTCGAC
AAGGTGTATACCACCTACACTCGAATGGAGGAGGGCGCCGACAAGCTGTGGCATGGTGATGTTGTCATTCTTGAT
GGCGATAAGGTCGTCGCGTTCTTCGGCCAGATTGCTATTCAAGGAGTGCCGCGCCGAGTTCTAAAGGTCATCTTG
TCCCTTGAAAGTGGGAACAAGTCCCAGAAGCAGCAGCCCGCCCAGAAGCAGCAACCTGCTGTGGCAGCCCCTTCC
GCCGCAAAAGCTGCCCCCGCGGCGACTCCTTCGGCTGCCGAGCCTTCTCATGCTTCGAAGCTTGCGAAGGCCCTG
CAGGTAATCGCCGAGGAGAGCGGGCTTGCCGTGGAGGACTTGACCGATGGTACCGTCTTCAGTGACGCTGGCATC
GACTCTCTTCTTGGATTGACCATCTCCGCCCGCTTCAAGGAGGAGCTCGACATGGACCTCGACTTCAACGCCTTG
TTCTATGAGTATCCCACTGTTGGGGATCTTAAGACATTCTTTGGCGGGTCCTCTACCGAGTCCGCCGGGTCGTCG
AGCCCCAGCTCCAGCGCCGCTGGGTCCGCCTCCCCCGTCTCCAATGGCACCGGGGCCACCACTCCAGTCACAGAG
GAGCATTCCTCATCTAAGGTCGACTTCCAGCGCGCCCTGTCAATCATATCGGAAGAGAGTGGTGTCGCTACGGAA
GATCTCACCGATGATACGAACTTTGCCGACTCTGGAGTGGATTCTCTGCTGTCCCTTGTCATTGTCAGCCGATTC
CGAGATGAGCTCGAGCTCGACATTCAGCACGAGTCTCTTTTCCTCGAGTGTCCGACTGTTGCCGATCTGAAGCAG
TTGCTTCTTGGGGGGACTGAATCGCCTAGCGAGGCTCAGCCGCAAAACCCCGAGCCTGTCCCGGCTGCCGAGCAG
AAGTCCGCGACAGTGCAGCGCACGGAGACGGAGACGGCTGCCCTCGCTACTCGCAAGAGAGCCGTCGACGAACTC
GTCGCCAAGTACACAGCCGGCTTCTCCGCGGCCGGAGAATCGCCATCGGCTGCTCTACCGAATGACAACGAGAAG
GTCGTCTTGGTTACGGGCGCATCGGGCAGCCTGGGAGGCCATTTGGTCTACCACATTGCCCAGCTCCCGGACGTG
AAGACGGTCGTGTGTCTCAACCGCGAGAACCGAGCAGAGCCCAATGTCCGACAGCAGAAGGCTATGCGGGAGAAG
GGCATTCGGTTTCCGGAAGCTCTCAAACACAAGCTGGTCGTGCTGCAGACTGACAGTGCCAAGCCCATGTTTGGC
TTGTCCAAGAGCGAGTACGAGGGACTCGCGAGCTCTGTCACATATCTGATCCACAACGCGTGGCCTATGAGCGCG
AAGCGACCTTTGGCTGGTTTCGAGTCCCAGTTCCAAGTCATGCGCAACCTGATCGATTTTGCTAGCGATGCCGCC
TCTCGTCGCCCGGAGACCTTCAAGTTCAGTTTCCAGATGGTGTCGTCTATTGGTGTTGTCGGTCACTACGGCCTC
GGCGGCGACGACAGCAAGAGGATTATGGTTCCTGAACAGCGAACTGGAATCGACACCGTCCTTCCCAACGGCTAC
GGAGACGCTAAATGGGGATGCGAGAGGATGCTCGACGAGACTCTGCACAAGTATCCAAACCGCTTCCGCACCATG
GCCGTCCGTCTGGGACAGATTGCCGGATCCAAGACCAGCGGCTATTGGAACCCCATGGAGCACTTCGGCTTCCTG
ATCAAGTCCTCGCAGACCTTGAATGCTCTGCCAGACGTGGACGGCGACGTCTTTTGGACTCCCGTCAACGATATA
GCTGCGACGCTGAGCGACTTGGTCCTGTCCGAACGCAGCCCCTATCCGATCTATCATATCGAGAACCCGGTTGGT
CAGCCATGGCGCGAGACGAATGCCATTTTGGCAGATGCCCTGAAGATCTCGAACTTGATTCCTTTTGAGGAGTGG
GTCGAGCGCGTGCGAGCAGCGCCGCAACGCAACAACCCCGCCTCGACACTCCTGGAGTTCTTGGATGGAAACTAC
AAGCGCATGTCATGCGGCGGCCTTGTTCTAGATGTGCAGAAGACGCTCGAGCATTCGAAGACGCTGAGTAGTGTC
GGGCCGGTGAGCGAGGAGGTGGTCCGGAAATACATTCATATTTGGAAGGAGATTGGATTCTTGAGCGCCTAG
Transcript >Hirsu2|6970
ATGGCCAACCAAATGAAGCTGTACCTCTTCGGAGACCAGACCTTTGACATTCAGCCTCACCTCAAGACCTTGATC
CGCGAAAGAGATCACCCCATCCTGGAGAAATTTCTCGTTAAGGCATACGAAGCCGTTCGTACTGAGATCTTCAAG
TTGCCCTACGAGGTTAGGGATGACATTCCTCGCTTCACCTGCCTCGACGATCTGGTTTCTTGGAACCAGAGCAAG
AAGCGGTCGATACCGCTTGACATGGCTGTGACATGCATTTATCAGCTGGGCACTTTTATCCAGCAAGCGGATGCT
TCCAAGCTTGGCCCCGACAATGCCCGGGTTGCTGGCATCTGTACGGGAACCCTGGCCGCAGCCGTGGCCAGCTGC
AGCCGCAGCCTGTTGGACCTCGTTCCTATGGCTGTCGATGCAGTCACTGTTGCCTTCAGGGTGGGCATGCACGTG
GCCGATGTCGCGCAGCGCGTGGCGCCGTCGGAGGAATCCGAACCGACCTGGTCTATCATCGTCCCCGGGTCGACG
TCTGATGTGGCCGTTCGAAAGTTCTGTGAAAAGACTACCCTGCCGTTGACGAGCAAACCCTACGTCACCGCCTAC
GCGCCGAATGGCATTACTGTGAGCGGGCCTCCGAAGTCCCTCGAGCAGTTCATCAACTCCGATGAGTTCAAGGGC
CTCCGATTCAAGGATGCCCCCATCTACGGCCCATACCACGCGCCGCATCTGTATTCGCAGTACGACATCGGCAAG
ATTGTCGAGGGCCTGGCTTGTGACACGGTCGGCGAGCGCTCCGAGAATGTCCCTCTCCTCTCCAGCTCGGGAGCC
AAGGTAGAAGGACGCACGTTCGCGGCTCTCCTTAGGTCCGCGGCCGAGCAGATTTTGCTGCAACCTATCCGATGG
AGTAGCATCCTTGACGGTTTGCAGAGCTGTCTCCAGAAGCTCAGTCCCAAGTCGTTCGCCGTCGTTTCGATTGGG
ACCACGGCGGACCAGCTCGTCTACACCGCACTCAAGCAGACGTCGCTGCGAAACTTGATGCCCTCAGCTACGAGC
GCAAGCAAGCCTCCCGCCCCGGAAGCGACGGGTTCCGGCTCTTCGAACCCCAAGAAGCCGAAGCTTGCCATCATT
GGCATGTCTGGGCGATTTCCGGGCGCCAAGGATAACGAGGCGTTCTGGGATCTCCTGCACGAGGGGCTGGATGTC
CATAAGCCTGTCCCCGCCCTCCACTGGGATGCCAAAACGCACGTGGATGCGACTGCCAGTCGCAAGAACACGAGC
GCAACGCCCTATGGCTGTTGGCTGGACGAGCCCGAGCTCTTCGACGCTCGCTTCTTCAACATTTCGCCGCGCGAG
GCGCCACAGATCGACCCGGCGCAGCGACTAGCTCTCATGACGGCATACGAGGCCATTGAGCAGGCCGGAATCGTC
CCCGACGCCACGCCCTCAACCCGACGCGACCGGGTGGGCGTCTTCTACGGAGTGACGAGCAATGATTGGATGGAG
ACGAACAGTGCCCAGAACATCGACACCTACTTCATTCCCGGCGGCAACCGAGCCTTTATCCCAGGGCGCATCAAC
TACTGCTTCAAGTTTAGCGGCCCGAGCTACGCCATCGATACGGCCTGCTCGTCCAGTCTAGCGGGCATCCACTTG
GCCTGCAATTCGCTGTGGCGAGGCGACATCGACACGGCCATCGCCGGCGGCACCAATGTCTTGACCAACCCCGAC
TTCACTGCCGGCCTGGACCGCGGTCACTTCCTCTCGCGCACCGGCAACTGCAAGACGTTTGACGATGGCGCCGAT
GGCTACTGCCGCGGCGAAGGCATCGGGACCGTCATCGTCAAGCGCCTGGACGATGCGCTCGCCGACCATGACCCC
ATCCTGGGAGTCATCCTCGGCGCCTATACCAACCACTCGGCCGAGTCCGAGTCCATCACGAGGCCGCATGTCGGC
GCCCAGCGCGCCATCTTTAGCAAGATCCTCAACCAGGGCGCCGTCGACCCCTATAGCGTCGGCTACGTCGAGATG
CACGGAACGGGCACCCAGGCCGGAGACGCCGGCGAGATGTCGAGCGTTCTCGACACCTTCGCCCCTCCCCTGTCC
CAGGTGAAGCAGGGAAGGACGGCCGACGAGGCTCTTTACCTTGGCTCTGCTAAGGCCAACATCGGCCACGGCGAG
GCATCTTCGGGCGTGTCGAGTCTGATCAAGGTGCTGCTGATGATGCAGAAGAACATGATCGCCCCGCACTGCGGC
ATCAAGACCAAGATCAACCGCAAGTTCCCGACCGATCTGGGCGAGCGCAACGTCAACATCGCCCTGAAGCCGACT
GCCTGGGCCAAGAGCCTCGATCCTTCTAAGCCCAGGCGCGCCTTCGTCAACAACTTCAGCGCTGCCGGCGGCAAC
TCTGCTCTTCTGCTCGAAGATGCACCCCTCGAGCAGGAGTCGCCCTCCGCCGTCGCCGATCCCCGAAGCCCGCAC
CTCGTCGCCTGCTCGGCCAAGAACGGACCCTCTCTGCAGGGCAACCTGCGCTCTCTGCTTCAGGTCCTGAAGCAG
AACCCCGGCATGTCCCTGGGCCAGCTCTCGTACACGACGACGGCGCGCCGCCAGCACCACCAGCACCGCGTCATG
CTTTCAGCTGGCTCGGCCGAGGATCTCTGCACTCAGATCGAGGCAGCCCTTCGCGACGGGGCGGGCATGACCAGG
CCCAAGTCCACTCCCAAGCTCGTCTTTGCCTTCACAGGCCAAGGCGCCCAGTACCCGGGCATGGGGAAGCAGCTT
TTCGAGCACCTATCCTTCTTCCGCACCGAAATGTGCCGACTCGACCAGATGGGGCAGAGCCTTGGCTTCCCGTCT
GTCCTCCCCGTCATTCAGTCCGACGAGCCGGACGTGAGCGTCTTCCCGCCCACCGCCGTTCAGCTGGCGAGCATT
TGCATGCAGATCGCACTCGTCAAACTCTGGGCGTCGTGGAACGTCACTCCGGTCGCAGTCGTTGGCCACAGCCTG
GGCGAGTATGCCGCTCTCAACGCCGCTGGAGTGCTCTCGGACGCAGACACTATCTACCTTGTCGGCAAGCGGGCG
GAGCTGCTCCAGAAGAAGTGCACGCGCGATACTCACGCCATGCTCGTCGTCAAAGGCTCGGTGGATGATGTCGCC
CGCGTTCTGACTGGCCGCCAGTACGAAATCGCCTGCATCAACTCCCCGGTCGAGACGGTGCTGGCCGGCTCCAAC
GACGACATTACCAATTTCAAGGGCGTCCTGGCTGATGCAGGCCTGAAAACTACCTTGCTCAAGGTCCCTTACGCC
TTCCACTCGTCACAGATCGATCCCATTCTGTCGGACTTCACTGCATTGGCTCGCGGCGTGACCTTCTCTAAGGCC
AAGTTACCCGTCTTGTGCCCCTTGAATGGCGACGTCGCCGCCGAGGGTAGCGACGGTTTCGGGCCCGAATATCTC
GCTAGCCACTCTCGCCAGCCAGTCAACATGCTTAAGGCCCTCCAGGCGGCCTACAGCGGCAAGATCATGACTGAC
CAGAGCACCGTTCTGGAGGTCGGCCCACACCCTGCAATCTCCGGCATGGTGCGGCCTGCAATTGGACCGCAAGTC
GCAACCCTCGCTTCGGCCCAGCGTGCCAGGTCTGCCTGGCAGGTTCTGGGGCTGACCCTCAAGGCCCTCTACGCT
GGGGGATCTGACATTCGCTGGGCCGAGTACCACCGCGACTTCACGAGCTCTCACAAGGTCACTCCCCTGCCAGCT
TACAGTTGGGACTTGAAGCCGTACTGGCTTCAATACGTCAACGACTGGTCTCTGCGCAAGGGAGATCCGCCTCTG
ATCGGCAATGATACCTCTAGCGGCAAGCTGGAGAGCACGACAATCCACCGGATTGTCGAGGAAACCAGCGACGCC
AACAAGGCTCACGTTGTTGTTGAGGCGGACATCGCGCGCAAGGACCTTAGTCCCCTGGTGCAGGGTCACGAGGTT
GATGGCATTCCACTCTGCACGCCATCCGTTTACGCCGATATTGCACTGAGCTTGGGCAAGTACCTCATCCAGAGC
TACCGCCCGGATCAGAGGGAGAAGCTCGTCGACGTGTCGGATATGACCATTTCCAAGGCCCTGATCTTGCGTGCG
GGTGCAACTCAGCAGCTGCTCCAGGCACACATGGACGTGGATTGGCCTTCCAAGTCGGCTGCCGTCAAGTTCATG
TCCTTTGACAACAAGCAGAAGCTGCAAGAGCATTCTCGATGCGTCCTGCGATTCAGGGACGGGAGCCTCCAGAAA
GAGCTCCAGAACAACTTGGCAAACACCAAGAAGAAGCAGCAAGCCCTGCGAGACGGTGTGGGCGCAGGAGCAACG
GCTCGGTTCAACAGACCCATGGTGTACCGAGCCATTCGGCCGCTGGCACGGTTCCACGATGACTACCGGGCCATC
GACGAGATCATCCTCAACAGCAAGACGCTTGAGGCGTCGAGCCGTCTCAGCTTCGGCAGCGTGAAGAGGGGTGGT
GTCTATCACACCCATCCTGCCATCATCGACTCCTTGACGCAATCGTGCGGCTTCACCATGAACTGCAACGATGGC
ACTGACCTGGACAACGAGGTGTTCATGAACCACGGCTGGGGCTCTTTCCAGATCTTCGAGCCACTCGACTTCGAC
AAGGTGTATACCACCTACACTCGAATGGAGGAGGGCGCCGACAAGCTGTGGCATGGTGATGTTGTCATTCTTGAT
GGCGATAAGGTCGTCGCGTTCTTCGGCCAGATTGCTATTCAAGGAGTGCCGCGCCGAGTTCTAAAGGTCATCTTG
TCCCTTGAAAGTGGGAACAAGTCCCAGAAGCAGCAGCCCGCCCAGAAGCAGCAACCTGCTGTGGCAGCCCCTTCC
GCCGCAAAAGCTGCCCCCGCGGCGACTCCTTCGGCTGCCGAGCCTTCTCATGCTTCGAAGCTTGCGAAGGCCCTG
CAGGTAATCGCCGAGGAGAGCGGGCTTGCCGTGGAGGACTTGACCGATGGTACCGTCTTCAGTGACGCTGGCATC
GACTCTCTTCTTGGATTGACCATCTCCGCCCGCTTCAAGGAGGAGCTCGACATGGACCTCGACTTCAACGCCTTG
TTCTATGAGTATCCCACTGTTGGGGATCTTAAGACATTCTTTGGCGGGTCCTCTACCGAGTCCGCCGGGTCGTCG
AGCCCCAGCTCCAGCGCCGCTGGGTCCGCCTCCCCCGTCTCCAATGGCACCGGGGCCACCACTCCAGTCACAGAG
GAGCATTCCTCATCTAAGGTCGACTTCCAGCGCGCCCTGTCAATCATATCGGAAGAGAGTGGTGTCGCTACGGAA
GATCTCACCGATGATACGAACTTTGCCGACTCTGGAGTGGATTCTCTGCTGTCCCTTGTCATTGTCAGCCGATTC
CGAGATGAGCTCGAGCTCGACATTCAGCACGAGTCTCTTTTCCTCGAGTGTCCGACTGTTGCCGATCTGAAGCAG
TTGCTTCTTGGGGGGACTGAATCGCCTAGCGAGGCTCAGCCGCAAAACCCCGAGCCTGTCCCGGCTGCCGAGCAG
AAGTCCGCGACAGTGCAGCGCACGGAGACGGAGACGGCTGCCCTCGCTACTCGCAAGAGAGCCGTCGACGAACTC
GTCGCCAAGTACACAGCCGGCTTCTCCGCGGCCGGAGAATCGCCATCGGCTGCTCTACCGAATGACAACGAGAAG
GTCGTCTTGGTTACGGGCGCATCGGGCAGCCTGGGAGGCCATTTGGTCTACCACATTGCCCAGCTCCCGGACGTG
AAGACGGTCGTGTGTCTCAACCGCGAGAACCGAGCAGAGCCCAATGTCCGACAGCAGAAGGCTATGCGGGAGAAG
GGCATTCGGTTTCCGGAAGCTCTCAAACACAAGCTGGTCGTGCTGCAGACTGACAGTGCCAAGCCCATGTTTGGC
TTGTCCAAGAGCGAGTACGAGGGACTCGCGAGCTCTGTCACATATCTGATCCACAACGCGTGGCCTATGAGCGCG
AAGCGACCTTTGGCTGGTTTCGAGTCCCAGTTCCAAGTCATGCGCAACCTGATCGATTTTGCTAGCGATGCCGCC
TCTCGTCGCCCGGAGACCTTCAAGTTCAGTTTCCAGATGGTGTCGTCTATTGGTGTTGTCGGTCACTACGGCCTC
GGCGGCGACGACAGCAAGAGGATTATGGTTCCTGAACAGCGAACTGGAATCGACACCGTCCTTCCCAACGGCTAC
GGAGACGCTAAATGGGGATGCGAGAGGATGCTCGACGAGACTCTGCACAAGTATCCAAACCGCTTCCGCACCATG
GCCGTCCGTCTGGGACAGATTGCCGGATCCAAGACCAGCGGCTATTGGAACCCCATGGAGCACTTCGGCTTCCTG
ATCAAGTCCTCGCAGACCTTGAATGCTCTGCCAGACGTGGACGGCGACGTCTTTTGGACTCCCGTCAACGATATA
GCTGCGACGCTGAGCGACTTGGTCCTGTCCGAACGCAGCCCCTATCCGATCTATCATATCGAGAACCCGGTTGGT
CAGCCATGGCGCGAGACGAATGCCATTTTGGCAGATGCCCTGAAGATCTCGAACTTGATTCCTTTTGAGGAGTGG
GTCGAGCGCGTGCGAGCAGCGCCGCAACGCAACAACCCCGCCTCGACACTCCTGGAGTTCTTGGATGGAAACTAC
AAGCGCATGTCATGCGGCGGCCTTGTTCTAGATGTGCAGAAGACGCTCGAGCATTCGAAGACGCTGAGTAGTGTC
GGGCCGGTGAGCGAGGAGGTGGTCCGGAAATACATTCATATTTGGAAGGAGATTGGATTCTTGAGCGCCTAG
Gene >Hirsu2|6970
ATGGCCAACCAAATGAAGCTGTACCTCTTCGGAGACCAGACCTTTGACATTCAGCCTCACCTCAAGACCTTGATC
CGCGAAAGAGATCACCCCATCCTGGAGAAATTTCTCGTTAAGGCATACGAAGCCGTTCGTACTGAGATCTTCAAG
TTGCCCTACGAGGTTAGGGATGACATTCCTCGCTTCACCTGCCTCGACGATCTGGTTTCTTGGAACCAGAGCAAG
AAGCGGTCGATACCGCTTGACATGGCTGTGACATGCATTTATCAGCTGGGCACTTTTATCCAGTAAGCAGACGCT
GATTCTGGACACTTGTCAGAATCTGAGCTCCAGGGGCTAATAAATCGTGCAGGCAAGCGGATGCTTCCAAGCTTG
GCCCCGACAATGCCCGGGTTGCTGGCATCTGTACGGGAACCCTGGCCGCAGCCGTGGCCAGCTGCAGCCGCAGCC
TGTTGGACCTCGTTCCTATGGCTGTCGATGCAGTCACTGTTGCCTTCAGGGTGGGCATGCACGTGGCCGATGTCG
CGCAGCGCGTGGCGCCGTCGGAGGAATCCGAACCGACCTGGTCTATCATCGTCCCCGGGTCGACGTCTGATGTGG
CCGTTCGAAAGTTCTGTGAAAAGACTGTGGGTAGACTCACATCCTCGGATACTGTTCTCGCTCCTAACCTTCAAT
GTTCCGATTAGACCCTGCCGTTGACGAGCAAACCCTACGTCACCGCCTACGCGCCGAATGGCATTACTGTGAGCG
GGCCTCCGAAGTCCCTCGAGCAGTTCATCAACTCCGATGAGTTCAAGGGCCTCCGATTCAAGGATGCCCCCATCT
ACGGCCCATACCACGCGCCGCATCTGTATTCGCAGTACGACATCGGCAAGATTGTCGAGGGCCTGGCTTGTGACA
CGGTCGGCGAGCGCTCCGAGAATGTCCCTCTCCTCTCCAGCTCGGGAGCCAAGGTAGAAGGACGCACGTTCGCGG
CTCTCCTTAGGTCCGCGGCCGAGCAGATTTTGCTGCAACCTATCCGATGGAGTAGCATCCTTGACGGTTTGCAGA
GCTGTCTCCAGAAGCTCAGTCCCAAGTCGTTCGCCGTCGTTTCGATTGGGACCACGGCGGACCAGCTCGTCTACA
CCGCACTCAAGCAGACGTCGCTGCGAAACTTGATGCCCTCAGCTACGAGCGCAAGCAAGCCTCCCGCCCCGGAAG
CGACGGGTTCCGGCTCTTCGAACCCCAAGAAGCCGAAGCTTGCCATCATTGGCATGTCTGGGCGATTTCCGGGCG
CCAAGGATAACGAGGCGTTCTGGGATCTCCTGCACGAGGGGCTGGATGTCCATAAGCCTGTCCCCGCCCTCCACT
GGGATGCCAAAACGCACGTGGATGCGACTGCCAGTCGCAAGAACACGAGCGCAACGCCCTATGGCTGTTGGCTGG
ACGAGCCCGAGCTCTTCGACGCTCGCTTCTTCAACATTTCGCCGCGCGAGGCGCCACAGATCGACCCGGCGCAGC
GACTAGCTCTCATGACGGCATACGAGGCCATTGAGCAGGCCGGAATCGTCCCCGACGCCACGCCCTCAACCCGAC
GCGACCGGGTGGGCGTCTTCTACGGAGTGACGAGCAATGATTGGATGGAGACGAACAGTGCCCAGAACATCGACA
CCTACTTCATTCCCGGCGGCAACCGAGCCTTTATCCCAGGGCGCATCAACTACTGCTTCAAGTTTAGCGGCCCGA
GCTACGCCATCGATACGGCCTGCTCGTCCAGTCTAGCGGGCATCCACTTGGCCTGCAATTCGCTGTGGCGAGGCG
ACATCGACACGGCCATCGCCGGCGGCACCAATGTCTTGACCAACCCCGACTTCACTGCCGGCCTGGACCGCGGTC
ACTTCCTCTCGCGCACCGGCAACTGCAAGACGTTTGACGATGGCGCCGATGGCTACTGCCGCGGCGAAGGCATCG
GGACCGTCATCGTCAAGCGCCTGGACGATGCGCTCGCCGACCATGACCCCATCCTGGGAGTCATCCTCGGCGCCT
ATACCAACCACTCGGCCGAGTCCGAGTCCATCACGAGGCCGCATGTCGGCGCCCAGCGCGCCATCTTTAGCAAGA
TCCTCAACCAGGGCGCCGTCGACCCCTATAGCGTCGGCTACGTCGAGATGCACGGAACGGGCACCCAGGCCGGAG
ACGCCGGCGAGATGTCGAGCGTTCTCGACACCTTCGCCCCTCCCCTGTCCCAGGTGAAGCAGGGAAGGACGGCCG
ACGAGGCTCTTTACCTTGGCTCTGCTAAGGCCAACATCGGCCACGGCGAGGCATCTTCGGGCGTGTCGAGTCTGA
TCAAGGTGCTGCTGATGATGCAGAAGAACATGATCGCCCCGCACTGCGGCATCAAGACCAAGATCAACCGCAAGT
TCCCGACCGATCTGGGCGAGCGCAACGTCAACATCGCCCTGAAGCCGACTGCCTGGGCCAAGAGCCTCGATCCTT
CTAAGCCCAGGCGCGCCTTCGTCAACAACTTCAGCGCTGCCGGCGGCAACTCTGCTCTTCTGCTCGAAGATGCAC
CCCTCGAGCAGGAGTCGCCCTCCGCCGTCGCCGATCCCCGAAGCCCGCACCTCGTCGCCTGCTCGGCCAAGAACG
GACCCTCTCTGCAGGGCAACCTGCGCTCTCTGCTTCAGGTCCTGAAGCAGAACCCCGGCATGTCCCTGGGCCAGC
TCTCGTACACGACGACGGCGCGCCGCCAGCACCACCAGCACCGCGTCATGCTTTCAGCTGGCTCGGCCGAGGATC
TCTGCACTCAGATCGAGGCAGCCCTTCGCGACGGGGCGGGCATGACCAGGCCCAAGTCCACTCCCAAGCTCGTCT
TTGCCTTCACAGGCCAAGGCGCCCAGTACCCGGGCATGGGGAAGCAGCTTTTCGAGCACCTATCCTTCTTCCGCA
CCGAAATGTGCCGACTCGACCAGATGGGGCAGAGCCTTGGCTTCCCGTCTGTCCTCCCCGTCATTCAGTCCGACG
AGCCGGACGTGAGCGTCTTCCCGCCCACCGCCGTTCAGCTGGCGAGCATTTGCATGCAGATCGCACTCGTCAAAC
TCTGGGCGTCGTGGAACGTCACTCCGGTCGCAGTCGTTGGCCACAGCCTGGGCGAGTATGCCGCTCTCAACGCCG
CTGGAGTGCTCTCGGACGCAGACACTATCTACCTTGTCGGCAAGCGGGCGGAGCTGCTCCAGAAGAAGTGCACGC
GCGATACTCACGCCATGCTCGTCGTCAAAGGCTCGGTGGATGATGTCGCCCGCGTTCTGACTGGCCGCCAGTACG
AAATCGCCTGCATCAACTCCCCGGTCGAGACGGTGCTGGCCGGCTCCAACGACGACATTACCAATTTCAAGGGCG
TCCTGGCTGATGCAGGCCTGAAAACTACCTTGCTCAAGGTCCCTTACGCCTTCCACTCGTCACAGATCGATCCCA
TTCTGTCGGACTTCACTGCATTGGCTCGCGGCGTGACCTTCTCTAAGGCCAAGTTACCCGTCTTGTGCCCCTTGA
ATGGCGACGTCGCCGCCGAGGGTAGCGACGGTTTCGGGCCCGAATATCTCGCTAGCCACTCTCGCCAGCCAGTCA
ACATGCTTAAGGCCCTCCAGGCGGCCTACAGCGGCAAGATCATGACTGACCAGAGCACCGTTCTGGAGGTCGGCC
CACACCCTGCAATCTCCGGCATGGTGCGGCCTGCAATTGGACCGCAAGTCGCAACCCTCGCTTCGGCCCAGCGTG
CCAGGTCTGCCTGGCAGGTTCTGGGGCTGACCCTCAAGGCCCTCTACGCTGGGGGATCTGACATTCGCTGGGCCG
AGTACCACCGCGACTTCACGAGCTCTCACAAGGTCACTCCCCTGCCAGCTTACAGTTGGGACTTGAAGCCGTACT
GGCTTCAATACGTCAACGACTGGTCTCTGCGCAAGGGAGATCCGCCTCTGATCGGCAATGATACCTCTAGCGGCA
AGCTGGAGAGCACGACAATCCACCGGATTGTCGAGGAAACCAGCGACGCCAACAAGGCTCACGTTGTTGTTGAGG
CGGACATCGCGCGCAAGGACCTTAGTCCCCTGGTGCAGGGTCACGAGGTTGATGGCATTCCACTCTGCACGCCAT
CCGTTTACGCCGATATTGCACTGAGCTTGGGCAAGTACCTCATCCAGAGCTACCGCCCGGATCAGAGGGAGAAGC
TCGTCGACGTGTCGGATATGACCATTTCCAAGGCCCTGATCTTGCGTGCGGGTGCAACTCAGCAGCTGCTCCAGG
CACACATGGACGTGGATTGGCCTTCCAAGTCGGCTGCCGTCAAGTTCATGTCCTTTGACGTAAGTATTTGTTTCC
TCCTATTACAGTGCTTGAGGCCCAGCTAACTGAATCGATTATAGAACAAGCAGAAGCTGCAAGAGCATTCTCGAT
GCGTCCTGCGATTCAGGGACGGGAGCCTCCAGAAAGAGCTCCAGAACAACTTGGCAAACACCAAGAAGAAGCAGC
AAGCCCTGCGAGACGGTGTGGGCGCAGGAGCAACGGCTCGGTTCAACAGACCCATGGTGTACCGAGCCATTCGGC
CGCTGGCACGGTTCCACGATGACTACCGGGCCATCGACGAGATCATCCTCAACAGCAAGACGCTTGAGGCGTCGA
GCCGTCTCAGCTTCGGCAGCGTGAAGAGGGGTGGTGTCTATCACACCCATCCTGCCATCATCGACTCCTTGACGC
AATCGTGCGGCTTCACCATGAACTGCAACGATGGCACTGACCTGGACAACGAGGTGTTCATGAACCACGGCTGGG
GCTCTTTCCAGATCTTCGAGCCACTCGACTTCGACAAGGTGTATACCACCTACACTCGAATGGAGGAGGGCGCCG
ACAAGCTGTGGCATGGTGATGTTGTCATTCTTGATGGCGATAAGGTCGTCGCGTTCTTCGGCCAGATTGCTGTCC
GTGGCCCCTACACCCCAGGCTCCCACCCACACATCTTGGCTAACTATTTCTCAGATTCAAGGAGTGCCGCGCCGA
GTTCTAAAGGTCATCTTGTCCCTTGAAAGTGGGAACAAGTCCCAGAAGCAGCAGCCCGCCCAGAAGCAGCAACCT
GCTGTGGCAGCCCCTTCCGCCGCAAAAGCTGCCCCCGCGGCGACTCCTTCGGCTGCCGAGCCTTCTCATGCTTCG
AAGCTTGCGAAGGCCCTGCAGGTAATCGCCGAGGAGAGCGGGCTTGCCGTGGAGGACTTGACCGATGGTACCGTC
TTCAGTGACGCTGGCATCGACTCTCTTCTTGGATTGACCATCTCCGCCCGCTTCAAGGAGGAGCTCGACATGGAC
CTCGACTTCAACGCCTTGTTCTATGAGTATCCCACTGTTGGGGATCTTAAGACATTCTTTGGCGGGTCCTCTACC
GAGTCCGCCGGGTCGTCGAGCCCCAGCTCCAGCGCCGCTGGGTCCGCCTCCCCCGTCTCCAATGGCACCGGGGCC
ACCACTCCAGTCACAGAGGAGCATTCCTCATCTAAGGTCGACTTCCAGCGCGCCCTGTCAATCATATCGGAAGAG
AGTGGTGTCGCTACGGAAGATCTCACCGATGATACGAACTTTGCCGACTCTGGAGTGGATTCTCTGCTGTCCCTT
GTCATTGTCAGCCGATTCCGAGATGAGCTCGAGCTCGACATTCAGCACGAGTCTCTTTTCCTCGAGTGTCCGACT
GTTGCCGATCTGAAGCAGTTGCTTCTTGGGGGGACTGAATCGCCTAGCGAGGCTCAGCCGCAAAACCCCGAGCCT
GTCCCGGCTGCCGAGCAGAAGTCCGCGACAGTGCAGCGCACGGAGACGGAGACGGCTGCCCTCGCTACTCGCAAG
AGAGCCGTCGACGAACTCGTCGCCAAGTACACAGCCGGCTTCTCCGCGGCCGGAGAATCGCCATCGGCTGCTCTA
CCGAATGACAACGAGAAGGTCGTCTTGGTTACGGGCGCATCGGGCAGCCTGGGAGGCCATTTGGTCTACCACATT
GCCCAGCTCCCGGACGTGAAGACGGTCGTGTGTCTCAACCGCGAGAACCGAGCAGAGCCCAATGTCCGACAGCAG
AAGGCTATGCGGGAGAAGGGCATTCGGTTTCCGGAAGCTCTCAAACACAAGCTGGTCGTGCTGCAGACTGACAGT
GCCAAGCCCATGTTTGGCTTGTCCAAGAGCGAGTACGAGGGACTCGCGAGCTCTGTCACATATCTGATCCACAAC
GCGTGGCCTATGAGCGCGAAGCGACCTTTGGCTGGTTTCGAGTCCCAGTTCCAAGTCATGCGCAACCTGATCGAT
TTTGCTAGCGATGCCGCCTCTCGTCGCCCGGAGACCTTCAAGTTCAGTTTCCAGATGGTGTCGTCTATTGGTGTT
GTCGGTCACTACGGCCTCGGCGGCGACGACAGCAAGAGGATTATGGTTCCTGAACAGCGAACTGGAATCGACACC
GTCCTTCCCAACGGCTACGGAGACGCTAAATGGGGATGCGAGAGGATGCTCGACGAGACTCTGCACAAGTATCCA
AACCGCTTCCGCACCATGGCCGTCCGTCTGGGACAGATTGCCGGATCCAAGACCAGCGGCTATTGGAACCCCATG
GAGCACTTCGGCTTCCTGATCAAGTCCTCGCAGACCTTGAATGCTCTGCCAGACGTGGACGGCGACGTCTTTTGG
ACTCCCGTCAACGATATAGCTGCGACGCTGAGCGACTTGGTCCTGTCCGAACGCAGCCCCTATCCGATCTATCAT
ATCGAGAACCCGGTTGGTCAGCCATGGCGCGAGACGAATGCCATTTTGGCAGATGCCCTGAAGATCTCGAACTTG
ATTCCTTTTGAGGAGTGGGTCGAGCGCGTGCGAGCAGCGCCGCAACGCAACAACCCCGCCTCGACACTCCTGGAG
TTCTTGGATGGAAACTACAAGCGCATGTCATGCGGCGGCCTTGTTCTAGATGTGCAGAAGACGCTCGAGCATTCG
AAGACGCTGAGTAGTGTCGGGCCGGTGAGCGAGGAGGTGGTCCGGAAATACATTCATATTTGGAAGGAGATTGGA
TTCTTGAGCGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail