Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6966
Gene name
LocationContig_380:16684..17237
Strand+
Gene length (bp)553
Transcript length (bp)426
Coding sequence length (bp)426
Protein length (aa) 142

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02100 ODC_AZ Ornithine decarboxylase antizyme 1.1E-44 29 141

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008073 ornithine decarboxylase inhibitor activity Yes
GO:0042979 ornithine decarboxylase regulator activity No
GO:0003674 molecular_function No
GO:0004857 enzyme inhibitor activity No
GO:0030234 enzyme regulator activity No
GO:0098772 molecular function regulator No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6966
MKTAFHEDRIAEALQHGLDLDHPRGFEADAWLEVWDYAGGASFRAFVANDGKEKSLFVFFDLQGVMGRDLKRALI
ALIELADGPMDCSHIVTCIDRCMPSKEALELSRSLQWVGFEMATLDHWADNLDVTSNKWVFMAMEL*
Coding >Hirsu2|6966
ATGAAGACCGCGTTCCATGAAGACCGCATCGCCGAGGCTCTCCAGCACGGCCTCGACCTCGACCACCCTCGTGGC
TTCGAGGCCGACGCCTGGCTGGAGGTCTGGGACTACGCCGGCGGCGCCAGTTTCCGCGCCTTCGTTGCCAACGAC
GGCAAGGAGAAGTCGCTCTTTGTCTTCTTCGACCTCCAAGGCGTCATGGGCCGGGATCTCAAGAGAGCCCTGATT
GCTCTCATTGAGCTCGCTGATGGACCCATGGACTGCTCCCACATTGTCACATGCATCGACCGCTGTATGCCTTCG
AAAGAGGCGCTCGAGCTCAGCCGGAGTCTGCAATGGGTTGGCTTTGAAATGGCCACACTGGATCACTGGGCCGAC
AACCTGGACGTCACCAGCAACAAATGGGTCTTCATGGCTATGGAGCTCTGA
Transcript >Hirsu2|6966
ATGAAGACCGCGTTCCATGAAGACCGCATCGCCGAGGCTCTCCAGCACGGCCTCGACCTCGACCACCCTCGTGGC
TTCGAGGCCGACGCCTGGCTGGAGGTCTGGGACTACGCCGGCGGCGCCAGTTTCCGCGCCTTCGTTGCCAACGAC
GGCAAGGAGAAGTCGCTCTTTGTCTTCTTCGACCTCCAAGGCGTCATGGGCCGGGATCTCAAGAGAGCCCTGATT
GCTCTCATTGAGCTCGCTGATGGACCCATGGACTGCTCCCACATTGTCACATGCATCGACCGCTGTATGCCTTCG
AAAGAGGCGCTCGAGCTCAGCCGGAGTCTGCAATGGGTTGGCTTTGAAATGGCCACACTGGATCACTGGGCCGAC
AACCTGGACGTCACCAGCAACAAATGGGTCTTCATGGCTATGGAGCTCTGA
Gene >Hirsu2|6966
ATGAAGACCGCGTTCCATGGTGAGAGGAACCTGTCGATGGATGGCTCCGGCCTGTCAGGTGCTTATTTGCACACG
CCGCCGCCAGAAGACCGCATCGCCGAGGCTCTCCAGCACGGCCTCGACCTCGACCACCCTCGTGGCTTCGAGGCC
GACGCCTGGCTGGAGGTCTGGGACTACGCCGGCGGCGCCAGTTTCCGCGCCTTCGTTGCCAACGACGGCAAGGAG
AAGTCGCTCTTTGTCTTCTTCGACCTCCAAGGCGTCATGGGCCGGGATCTCAAGAGAGCGTACGTTCCACTGTCC
CTCCCCGCCCCACCCACGCGCGACGCTGACGGACGTGCCCCGCAGCCTGATTGCTCTCATTGAGCTCGCTGATGG
ACCCATGGACTGCTCCCACATTGTCACATGCATCGACCGCTGTATGCCTTCGAAAGAGGCGCTCGAGCTCAGCCG
GAGTCTGCAATGGGTTGGCTTTGAAATGGCCACACTGGATCACTGGGCCGACAACCTGGACGTCACCAGCAACAA
ATGGGTCTTCATGGCTATGGAGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail