Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6963
Gene name
LocationContig_380:5537..8643
Strand-
Gene length (bp)3106
Transcript length (bp)2934
Coding sequence length (bp)2934
Protein length (aa) 978

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01237 Oxysterol_BP Oxysterol-binding protein 1.8E-110 595 958
PF15409 PH_8 Pleckstrin homology domain 1.6E-35 217 304
PF00169 PH PH domain 1.3E-06 217 305

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13944|YEH1_SCHPO Oxysterol-binding protein homolog C23H4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H4.01c PE=1 SV=2 565 972 7.0E-109
sp|P38713|OSH3_YEAST Oxysterol-binding protein homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH3 PE=1 SV=1 556 972 8.0E-99
sp|Q9BZF3|OSBL6_HUMAN Oxysterol-binding protein-related protein 6 OS=Homo sapiens GN=OSBPL6 PE=1 SV=1 460 960 2.0E-73
sp|Q8BXR9|OSBL6_MOUSE Oxysterol-binding protein-related protein 6 OS=Mus musculus GN=Osbpl6 PE=1 SV=1 487 960 1.0E-72
sp|Q9DBS9|OSBL3_MOUSE Oxysterol-binding protein-related protein 3 OS=Mus musculus GN=Osbpl3 PE=1 SV=2 497 939 2.0E-71
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13944|YEH1_SCHPO Oxysterol-binding protein homolog C23H4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H4.01c PE=1 SV=2 565 972 7.0E-109
sp|P38713|OSH3_YEAST Oxysterol-binding protein homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH3 PE=1 SV=1 556 972 8.0E-99
sp|Q9BZF3|OSBL6_HUMAN Oxysterol-binding protein-related protein 6 OS=Homo sapiens GN=OSBPL6 PE=1 SV=1 460 960 2.0E-73
sp|Q8BXR9|OSBL6_MOUSE Oxysterol-binding protein-related protein 6 OS=Mus musculus GN=Osbpl6 PE=1 SV=1 487 960 1.0E-72
sp|Q9DBS9|OSBL3_MOUSE Oxysterol-binding protein-related protein 3 OS=Mus musculus GN=Osbpl3 PE=1 SV=2 497 939 2.0E-71
sp|Q9H4L5|OSBL3_HUMAN Oxysterol-binding protein-related protein 3 OS=Homo sapiens GN=OSBPL3 PE=1 SV=1 460 939 3.0E-70
sp|Q9BZF2|OSBL7_HUMAN Oxysterol-binding protein-related protein 7 OS=Homo sapiens GN=OSBPL7 PE=2 SV=1 582 961 8.0E-67
sp|Q8L751|ORP1C_ARATH Oxysterol-binding protein-related protein 1C OS=Arabidopsis thaliana GN=ORP1C PE=2 SV=1 580 972 2.0E-61
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.05c PE=1 SV=2 595 972 3.0E-61
sp|Q8S8P9|ORP1B_ARATH Oxysterol-binding protein-related protein 1B OS=Arabidopsis thaliana GN=ORP1B PE=2 SV=1 580 972 9.0E-59
sp|O80866|ORP1A_ARATH Oxysterol-binding protein-related protein 1A OS=Arabidopsis thaliana GN=ORP1A PE=2 SV=1 526 972 2.0E-58
sp|Q9SU36|ORP2B_ARATH Oxysterol-binding protein-related protein 2B OS=Arabidopsis thaliana GN=ORP2B PE=2 SV=2 582 972 7.0E-56
sp|Q969R2|OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens GN=OSBP2 PE=1 SV=2 510 972 8.0E-55
sp|Q5QNQ6|OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus GN=Osbp2 PE=1 SV=1 157 972 1.0E-54
sp|Q9SAF0|ORP1D_ARATH Oxysterol-binding protein-related protein 1D OS=Arabidopsis thaliana GN=ORP1D PE=2 SV=1 458 973 3.0E-54
sp|Q940Y1|ORP2A_ARATH Oxysterol-binding protein-related protein 2A OS=Arabidopsis thaliana GN=ORP2A PE=2 SV=1 580 972 5.0E-54
sp|Q3B7Z2|OSBP1_MOUSE Oxysterol-binding protein 1 OS=Mus musculus GN=Osbp PE=1 SV=3 582 972 1.0E-51
sp|P16258|OSBP1_RABIT Oxysterol-binding protein 1 OS=Oryctolagus cuniculus GN=OSBP PE=1 SV=1 582 972 3.0E-51
sp|P35845|OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWH1 PE=1 SV=4 502 972 9.0E-51
sp|P22059|OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens GN=OSBP PE=1 SV=1 582 972 1.0E-50
sp|Q91XL9|OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 582 972 1.0E-50
sp|Q9BXW6|OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 582 972 3.0E-50
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 582 972 4.0E-50
sp|Q12451|OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH2 PE=1 SV=1 595 972 9.0E-48
sp|Q9H1P3|OSBL2_HUMAN Oxysterol-binding protein-related protein 2 OS=Homo sapiens GN=OSBPL2 PE=1 SV=1 595 947 2.0E-47
sp|Q8BX94|OSBL2_MOUSE Oxysterol-binding protein-related protein 2 OS=Mus musculus GN=Osbpl2 PE=1 SV=1 595 947 9.0E-46
sp|Q54ID7|OSB11_DICDI Oxysterol-binding protein 11 OS=Dictyostelium discoideum GN=osbK PE=3 SV=1 604 962 8.0E-43
sp|Q93Y40|ORP3C_ARATH Oxysterol-binding protein-related protein 3C OS=Arabidopsis thaliana GN=ORP3C PE=2 SV=1 595 939 6.0E-41
sp|Q54QP6|OSB8_DICDI Oxysterol-binding protein 8 OS=Dictyostelium discoideum GN=osbH PE=1 SV=1 574 960 4.0E-39
sp|O13944|YEH1_SCHPO Oxysterol-binding protein homolog C23H4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H4.01c PE=1 SV=2 4 318 2.0E-37
sp|Q9SR33|ORP3B_ARATH Oxysterol-binding protein-related protein 3B OS=Arabidopsis thaliana GN=ORP3B PE=2 SV=1 599 934 2.0E-37
sp|Q9LZM1|ORP3A_ARATH Oxysterol-binding protein-related protein 3A OS=Arabidopsis thaliana GN=ORP3A PE=1 SV=1 599 934 2.0E-37
sp|Q9H0X9|OSBL5_HUMAN Oxysterol-binding protein-related protein 5 OS=Homo sapiens GN=OSBPL5 PE=1 SV=1 605 934 8.0E-21
sp|Q86KG4|OSB4_DICDI Oxysterol-binding protein 4 OS=Dictyostelium discoideum GN=osbD PE=3 SV=2 604 939 2.0E-20
sp|Q9BZF1|OSBL8_HUMAN Oxysterol-binding protein-related protein 8 OS=Homo sapiens GN=OSBPL8 PE=1 SV=3 595 934 1.0E-19
sp|B9EJ86|OSBL8_MOUSE Oxysterol-binding protein-related protein 8 OS=Mus musculus GN=Osbpl8 PE=1 SV=1 595 934 6.0E-19
sp|Q54NM4|OSB10_DICDI Oxysterol-binding protein 10 OS=Dictyostelium discoideum GN=osbJ PE=3 SV=1 611 939 2.0E-18
sp|Q9ER64|OSBL5_MOUSE Oxysterol-binding protein-related protein 5 OS=Mus musculus GN=Osbpl5 PE=1 SV=3 605 935 4.0E-16
sp|P38713|OSH3_YEAST Oxysterol-binding protein homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH3 PE=1 SV=1 217 302 5.0E-16
sp|Q96SU4|OSBL9_HUMAN Oxysterol-binding protein-related protein 9 OS=Homo sapiens GN=OSBPL9 PE=1 SV=2 504 921 1.0E-15
sp|Q5R9W4|OSBL9_PONAB Oxysterol-binding protein-related protein 9 OS=Pongo abelii GN=OSBPL9 PE=2 SV=1 504 921 1.0E-15
sp|Q9UW25|OBPA_CANAL Oxysterol-binding protein-like protein OBPa OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPA PE=3 SV=1 605 832 2.0E-15
sp|Q0IJ05|OSBL9_XENTR Oxysterol-binding protein-related protein 9 OS=Xenopus tropicalis GN=osbpl9 PE=2 SV=1 596 934 6.0E-15
sp|A2A8Z1|OSBL9_MOUSE Oxysterol-binding protein-related protein 9 OS=Mus musculus GN=Osbpl9 PE=1 SV=1 504 921 1.0E-14
sp|P0C199|KES1_USTMA Protein KES1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=KES1 PE=3 SV=1 607 956 1.0E-14
sp|O74178|KES1_SCHPO Protein kes1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kes1 PE=2 SV=2 607 957 5.0E-14
sp|Q9BXB5|OSB10_HUMAN Oxysterol-binding protein-related protein 10 OS=Homo sapiens GN=OSBPL10 PE=1 SV=2 604 939 2.0E-13
sp|P38755|OSH7_YEAST Oxysterol-binding protein homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH7 PE=1 SV=1 605 832 8.0E-13
sp|Q02201|OSH6_YEAST Oxysterol-binding protein homolog 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH6 PE=1 SV=1 605 908 2.0E-11
sp|Q9UW21|OBPAL_CANAL Oxysterol-binding protein-like protein OBPalpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPALPHA PE=3 SV=1 595 812 7.0E-11
sp|P35844|KES1_YEAST Oxysterol-binding protein homolog 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KES1 PE=1 SV=1 607 945 2.0E-10
sp|Q8MPQ7|OSB1_DICDI Oxysterol-binding protein 1 OS=Dictyostelium discoideum GN=osbA PE=1 SV=1 604 836 8.0E-10
sp|Q9UUA1|YJX1_SCHPO Oxysterol-binding protein homolog C23B6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.01c PE=1 SV=2 596 831 2.0E-09
sp|Q54PS9|OSB9_DICDI Oxysterol-binding protein 9 OS=Dictyostelium discoideum GN=osbI PE=3 SV=1 605 918 7.0E-09
sp|P35843|HES1_YEAST Protein HES1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HES1 PE=1 SV=1 607 938 4.0E-07
sp|O43021|YGV7_SCHPO Oxysterol-binding protein homolog C354.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.07c PE=3 SV=4 607 934 4.0E-07
sp|Q54EF5|OSB12_DICDI Oxysterol-binding protein 12 OS=Dictyostelium discoideum GN=osbL PE=3 SV=1 605 805 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6963
MAGIEQLEVHSKSYVVRWVKVDQGNTLSWSVQPHKKSINFGIVKHPGSGATTISAPAGDESDAAQTQSIADGKSI
RNSKKETAQDLLSGKGFIPIAWHGKCEADKVSLGTYDVQPGQGGMYGLVFDNTFSKQTSKTATFVVLTYPTGAAP
QTVNHVPNLQLPHAQSSQSSLARFGSPRPDLGPSPSVDSFHSQDARSRALSISGRSEFTAPPTCQVGTLSKRKRK
KGQGYARRFFSLDYTTCTLSYYHNRSSSALRGAIPLSLAAIAADERRREISIDSGAEIWHLRAPTDKEFQEWARA
LERASRIARGDSQLSSQLPTRPKLDLDHGASKPARDASRAEEVEWQQVETLVSRVVGTRDALRRLTKEAAALPRP
STAGRHLSPSSAMPGEEGRDGYFPPVADKRPFWKRKSSTPSLSPVLPQQTTSSTDITPTAAAPNGESPARGRPRG
TAHEKSIHEHCEALLSDLDTVVTEFSALIAGSRRRRMSVPLSAGGASRISIDTTSTKDEFFDAEDAKPAVVKIDG
SGDESAQTDGDEAETRDGSSVSSRDDDELVSADSAGHLFPSRPKSLAPLPLDKAVSRRTTIPPATVQPPSLIAFV
RKNVGKDLSTISMPVSANEPTSLLQKLAEQLEYAQLLDKAARQKSATERLLFVTAFAVSQFSSGRAKERSIRKPF
NPLLGETFELVRTNKEVPGGFRLLVEKVQHRPVRLAMQAESANWSFAQSPAPGQKFWGKSAEITTEGRVRVALRL
GDGSDEFYSWNVATMFLRNVVMGEKYVEPVGTMQVVNDSSGHKATVEFKSKGMFGGRSEEVQVNTYGPDGADTGS
GLAGTWTGGLRTVGPGKAASEDVWQAGKLVDNAGQTYGMTRFAASLNEVTEVEKGRVAATDSRLRPDQRLAEQGE
LEAAETWKHRLEEAQRARRRDMEARGEAHRPRWFVKADDSPEGEEVWKMRTGKDGYWEERARGSWTGVPAIFEAS
DE*
Coding >Hirsu2|6963
ATGGCGGGAATCGAGCAGCTAGAGGTTCACAGCAAGTCCTACGTCGTCCGCTGGGTCAAGGTCGACCAAGGGAAC
ACGCTGTCATGGAGCGTCCAGCCACACAAGAAGTCCATAAACTTTGGCATCGTCAAGCATCCCGGGAGCGGTGCC
ACGACCATCTCCGCCCCCGCCGGCGATGAATCGGACGCGGCCCAGACCCAGAGCATCGCCGACGGCAAATCGATC
CGGAACTCGAAGAAGGAGACGGCGCAGGACTTGCTGTCGGGCAAGGGCTTCATCCCCATCGCCTGGCACGGCAAA
TGCGAGGCCGACAAGGTGTCTCTGGGCACCTACGACGTCCAGCCGGGACAGGGTGGCATGTACGGCCTGGTCTTT
GACAACACCTTCTCCAAGCAGACGTCCAAGACGGCCACCTTCGTCGTCCTCACCTACCCTACGGGGGCGGCCCCC
CAGACCGTCAACCACGTGCCCAACCTCCAGCTGCCCCATGCCCAGTCGAGCCAGTCCAGCCTGGCCAGGTTCGGC
AGCCCGCGCCCCGACCTCGGCCCATCGCCGTCCGTCGACAGCTTTCACAGCCAGGACGCCCGCTCCCGCGCCCTC
TCGATATCAGGCAGAAGCGAGTTCACCGCCCCGCCGACCTGCCAGGTCGGCACGCTCTCCAAGAGGAAGCGCAAG
AAGGGGCAAGGCTACGCCCGCCGTTTCTTCTCCCTCGACTACACCACCTGCACCCTGTCCTACTACCACAATCGC
AGCTCGTCGGCGCTGCGCGGGGCCATTCCCCTGAGCCTGGCCGCCATCGCGGCCGACGAGAGACGGAGGGAGATC
AGCATCGACTCGGGAGCCGAGATCTGGCACCTGAGGGCCCCCACCGACAAGGAGTTTCAAGAGTGGGCGCGCGCA
CTCGAGAGGGCCAGCCGAATCGCCAGGGGGGACTCGCAGTTGTCTTCCCAGCTGCCGACGAGGCCGAAGCTCGAC
CTCGACCACGGCGCCTCGAAGCCCGCGAGAGATGCGAGTCGCGCCGAAGAGGTCGAGTGGCAGCAAGTCGAGACG
CTGGTGAGCCGAGTGGTCGGCACGCGCGACGCGCTCCGTCGCTTGACGAAGGAGGCGGCCGCGCTTCCGAGGCCC
TCTACAGCAGGACGGCACCTATCCCCGAGCTCCGCCATGCCCGGCGAGGAGGGAAGGGACGGCTACTTCCCTCCC
GTGGCGGATAAGAGGCCGTTTTGGAAGAGGAAGTCGAGCACCCCGTCCCTGAGCCCCGTACTACCACAGCAGACG
ACATCCTCGACCGACATCACGCCGACGGCAGCCGCGCCGAACGGCGAGAGCCCGGCCCGGGGCAGGCCGAGAGGG
ACGGCGCACGAGAAGTCGATCCACGAACACTGCGAGGCCCTGCTGTCCGATCTCGACACCGTCGTCACCGAGTTC
TCGGCGCTCATCGCCGGCAGCAGGAGGCGGCGGATGTCGGTACCGCTCTCGGCCGGCGGCGCGTCCCGCATCAGC
ATCGACACGACGTCGACCAAGGACGAGTTCTTCGACGCGGAGGACGCCAAGCCGGCCGTCGTCAAGATCGACGGC
AGCGGAGACGAGTCGGCGCAGACGGACGGCGACGAGGCCGAGACGCGCGACGGCTCCTCCGTCTCGTCCAGGGAC
GACGACGAGCTGGTCAGCGCCGACAGCGCCGGCCACCTGTTCCCGTCGAGGCCCAAGAGCCTGGCGCCGCTGCCG
CTGGACAAGGCGGTGTCTCGACGGACGACGATACCGCCGGCGACGGTGCAGCCGCCGAGCCTGATAGCGTTCGTG
CGCAAGAACGTGGGCAAGGACCTGAGCACCATCAGCATGCCCGTCTCGGCCAACGAGCCGACGTCGCTGCTGCAG
AAGCTGGCGGAGCAGCTCGAGTACGCGCAGCTGCTGGACAAGGCGGCGCGGCAGAAGAGCGCGACGGAGCGGCTG
CTGTTCGTCACGGCCTTTGCCGTGTCGCAGTTCAGCAGCGGGCGGGCCAAGGAGCGGTCGATACGCAAGCCGTTC
AACCCGCTGCTCGGCGAGACGTTCGAGCTGGTGCGGACGAACAAGGAGGTGCCCGGCGGGTTCCGGCTGCTGGTG
GAGAAGGTGCAGCACCGGCCGGTGCGGCTGGCGATGCAGGCCGAGTCGGCCAACTGGTCGTTTGCGCAGTCGCCG
GCGCCCGGGCAGAAGTTCTGGGGAAAGAGCGCCGAGATCACGACGGAGGGCCGGGTGCGGGTGGCGCTGCGGCTG
GGCGACGGCAGCGACGAGTTCTACTCGTGGAACGTGGCCACCATGTTCCTGCGCAACGTGGTGATGGGGGAGAAG
TACGTGGAGCCGGTGGGCACGATGCAGGTGGTCAACGACAGCAGCGGGCACAAGGCGACGGTCGAGTTCAAGAGC
AAGGGCATGTTCGGCGGGCGGTCGGAGGAGGTGCAGGTCAACACGTACGGGCCCGACGGGGCGGACACGGGCAGC
GGGCTGGCCGGGACGTGGACGGGCGGCCTGCGGACGGTGGGGCCGGGCAAGGCGGCGAGCGAGGATGTGTGGCAG
GCGGGCAAGCTGGTGGACAACGCCGGGCAGACGTACGGCATGACGCGCTTCGCGGCCTCGCTCAACGAGGTGACG
GAGGTGGAGAAGGGCCGGGTGGCGGCGACGGACAGCCGGCTGCGGCCGGACCAGCGGCTGGCGGAGCAGGGCGAG
CTGGAGGCGGCCGAGACGTGGAAGCACCGGCTCGAGGAGGCGCAGCGGGCGCGGCGGCGCGACATGGAGGCGCGC
GGCGAGGCGCACCGGCCGCGGTGGTTCGTCAAGGCGGACGACTCGCCGGAGGGGGAGGAGGTGTGGAAGATGAGG
ACCGGCAAGGACGGCTACTGGGAGGAGAGGGCGCGCGGGAGCTGGACGGGCGTGCCGGCCATCTTTGAGGCTTCG
GACGAGTAG
Transcript >Hirsu2|6963
ATGGCGGGAATCGAGCAGCTAGAGGTTCACAGCAAGTCCTACGTCGTCCGCTGGGTCAAGGTCGACCAAGGGAAC
ACGCTGTCATGGAGCGTCCAGCCACACAAGAAGTCCATAAACTTTGGCATCGTCAAGCATCCCGGGAGCGGTGCC
ACGACCATCTCCGCCCCCGCCGGCGATGAATCGGACGCGGCCCAGACCCAGAGCATCGCCGACGGCAAATCGATC
CGGAACTCGAAGAAGGAGACGGCGCAGGACTTGCTGTCGGGCAAGGGCTTCATCCCCATCGCCTGGCACGGCAAA
TGCGAGGCCGACAAGGTGTCTCTGGGCACCTACGACGTCCAGCCGGGACAGGGTGGCATGTACGGCCTGGTCTTT
GACAACACCTTCTCCAAGCAGACGTCCAAGACGGCCACCTTCGTCGTCCTCACCTACCCTACGGGGGCGGCCCCC
CAGACCGTCAACCACGTGCCCAACCTCCAGCTGCCCCATGCCCAGTCGAGCCAGTCCAGCCTGGCCAGGTTCGGC
AGCCCGCGCCCCGACCTCGGCCCATCGCCGTCCGTCGACAGCTTTCACAGCCAGGACGCCCGCTCCCGCGCCCTC
TCGATATCAGGCAGAAGCGAGTTCACCGCCCCGCCGACCTGCCAGGTCGGCACGCTCTCCAAGAGGAAGCGCAAG
AAGGGGCAAGGCTACGCCCGCCGTTTCTTCTCCCTCGACTACACCACCTGCACCCTGTCCTACTACCACAATCGC
AGCTCGTCGGCGCTGCGCGGGGCCATTCCCCTGAGCCTGGCCGCCATCGCGGCCGACGAGAGACGGAGGGAGATC
AGCATCGACTCGGGAGCCGAGATCTGGCACCTGAGGGCCCCCACCGACAAGGAGTTTCAAGAGTGGGCGCGCGCA
CTCGAGAGGGCCAGCCGAATCGCCAGGGGGGACTCGCAGTTGTCTTCCCAGCTGCCGACGAGGCCGAAGCTCGAC
CTCGACCACGGCGCCTCGAAGCCCGCGAGAGATGCGAGTCGCGCCGAAGAGGTCGAGTGGCAGCAAGTCGAGACG
CTGGTGAGCCGAGTGGTCGGCACGCGCGACGCGCTCCGTCGCTTGACGAAGGAGGCGGCCGCGCTTCCGAGGCCC
TCTACAGCAGGACGGCACCTATCCCCGAGCTCCGCCATGCCCGGCGAGGAGGGAAGGGACGGCTACTTCCCTCCC
GTGGCGGATAAGAGGCCGTTTTGGAAGAGGAAGTCGAGCACCCCGTCCCTGAGCCCCGTACTACCACAGCAGACG
ACATCCTCGACCGACATCACGCCGACGGCAGCCGCGCCGAACGGCGAGAGCCCGGCCCGGGGCAGGCCGAGAGGG
ACGGCGCACGAGAAGTCGATCCACGAACACTGCGAGGCCCTGCTGTCCGATCTCGACACCGTCGTCACCGAGTTC
TCGGCGCTCATCGCCGGCAGCAGGAGGCGGCGGATGTCGGTACCGCTCTCGGCCGGCGGCGCGTCCCGCATCAGC
ATCGACACGACGTCGACCAAGGACGAGTTCTTCGACGCGGAGGACGCCAAGCCGGCCGTCGTCAAGATCGACGGC
AGCGGAGACGAGTCGGCGCAGACGGACGGCGACGAGGCCGAGACGCGCGACGGCTCCTCCGTCTCGTCCAGGGAC
GACGACGAGCTGGTCAGCGCCGACAGCGCCGGCCACCTGTTCCCGTCGAGGCCCAAGAGCCTGGCGCCGCTGCCG
CTGGACAAGGCGGTGTCTCGACGGACGACGATACCGCCGGCGACGGTGCAGCCGCCGAGCCTGATAGCGTTCGTG
CGCAAGAACGTGGGCAAGGACCTGAGCACCATCAGCATGCCCGTCTCGGCCAACGAGCCGACGTCGCTGCTGCAG
AAGCTGGCGGAGCAGCTCGAGTACGCGCAGCTGCTGGACAAGGCGGCGCGGCAGAAGAGCGCGACGGAGCGGCTG
CTGTTCGTCACGGCCTTTGCCGTGTCGCAGTTCAGCAGCGGGCGGGCCAAGGAGCGGTCGATACGCAAGCCGTTC
AACCCGCTGCTCGGCGAGACGTTCGAGCTGGTGCGGACGAACAAGGAGGTGCCCGGCGGGTTCCGGCTGCTGGTG
GAGAAGGTGCAGCACCGGCCGGTGCGGCTGGCGATGCAGGCCGAGTCGGCCAACTGGTCGTTTGCGCAGTCGCCG
GCGCCCGGGCAGAAGTTCTGGGGAAAGAGCGCCGAGATCACGACGGAGGGCCGGGTGCGGGTGGCGCTGCGGCTG
GGCGACGGCAGCGACGAGTTCTACTCGTGGAACGTGGCCACCATGTTCCTGCGCAACGTGGTGATGGGGGAGAAG
TACGTGGAGCCGGTGGGCACGATGCAGGTGGTCAACGACAGCAGCGGGCACAAGGCGACGGTCGAGTTCAAGAGC
AAGGGCATGTTCGGCGGGCGGTCGGAGGAGGTGCAGGTCAACACGTACGGGCCCGACGGGGCGGACACGGGCAGC
GGGCTGGCCGGGACGTGGACGGGCGGCCTGCGGACGGTGGGGCCGGGCAAGGCGGCGAGCGAGGATGTGTGGCAG
GCGGGCAAGCTGGTGGACAACGCCGGGCAGACGTACGGCATGACGCGCTTCGCGGCCTCGCTCAACGAGGTGACG
GAGGTGGAGAAGGGCCGGGTGGCGGCGACGGACAGCCGGCTGCGGCCGGACCAGCGGCTGGCGGAGCAGGGCGAG
CTGGAGGCGGCCGAGACGTGGAAGCACCGGCTCGAGGAGGCGCAGCGGGCGCGGCGGCGCGACATGGAGGCGCGC
GGCGAGGCGCACCGGCCGCGGTGGTTCGTCAAGGCGGACGACTCGCCGGAGGGGGAGGAGGTGTGGAAGATGAGG
ACCGGCAAGGACGGCTACTGGGAGGAGAGGGCGCGCGGGAGCTGGACGGGCGTGCCGGCCATCTTTGAGGCTTCG
GACGAGTAG
Gene >Hirsu2|6963
ATGGCGGGAATCGAGCAGCTAGAGGTTCACAGCAAGGTACGGCCGCCGTCCCACGCCCCAATGCCCGCCGCCGGA
GGCATGCCGTGCTGATCCAACGACCGCCAACCGCAGTCCTACGTCGTCCGCTGGGTCAAGGTCGACCAAGGGAAC
ACGCTGTCATGGAGCGTCCAGCCACACAAGAAGTCCATGTAGGCACACCTTGGCCCCTCTCCCTGCCTCCCGCCC
GCCCCGCCGCAGGCCTTGGCGACGCGCCCCCGCCACCACCCACTGACGGCCATGGCGTAGAAACTTTGGCATCGT
CAAGCATCCCGGGAGCGGTGCCACGACCATCTCCGCCCCCGCCGGCGATGAATCGGACGCGGCCCAGACCCAGAG
CATCGCCGACGGCAAATCGATCCGGAACTCGAAGAAGGAGACGGCGCAGGACTTGCTGTCGGGCAAGGGCTTCAT
CCCCATCGCCTGGCACGGCAAATGCGAGGCCGACAAGGTGTCTCTGGGCACCTACGACGTCCAGCCGGGACAGGG
TGGCATGTACGGCCTGGTCTTTGACAACACCTTCTCCAAGCAGACGTCCAAGACGGCCACCTTCGTCGTCCTCAC
CTACCCTACGGGGGCGGCCCCCCAGACCGTCAACCACGTGCCCAACCTCCAGCTGCCCCATGCCCAGTCGAGCCA
GTCCAGCCTGGCCAGGTTCGGCAGCCCGCGCCCCGACCTCGGCCCATCGCCGTCCGTCGACAGCTTTCACAGCCA
GGACGCCCGCTCCCGCGCCCTCTCGATATCAGGCAGAAGCGAGTTCACCGCCCCGCCGACCTGCCAGGTCGGCAC
GCTCTCCAAGAGGAAGCGCAAGAAGGGGCAAGGCTACGCCCGCCGTTTCTTCTCCCTCGACTACACCACCTGCAC
CCTGTCCTACTACCACAATCGCAGCTCGTCGGCGCTGCGCGGGGCCATTCCCCTGAGCCTGGCCGCCATCGCGGC
CGACGAGAGACGGAGGGAGATCAGCATCGACTCGGGAGCCGAGATCTGGCACCTGAGGGCCCCCACCGACAAGGA
GTTTCAAGAGTGGGCGCGCGCACTCGAGAGGGCCAGCCGAATCGCCAGGGGGGACTCGCAGTTGTCTTCCCAGCT
GCCGACGAGGCCGAAGCTCGACCTCGACCACGGCGCCTCGAAGCCCGCGAGAGATGCGAGTCGCGCCGAAGAGGT
CGAGTGGCAGCAAGTCGAGACGCTGGTGAGCCGAGTGGTCGGCACGCGCGACGCGCTCCGTCGCTTGACGAAGGA
GGCGGCCGCGCTTCCGAGGCCCTCTACAGCAGGACGGCACCTATCCCCGAGCTCCGCCATGCCCGGCGAGGAGGG
AAGGGACGGCTACTTCCCTCCCGTGGCGGATAAGAGGCCGTTTTGGAAGAGGAAGTCGAGCACCCCGTCCCTGAG
CCCCGTACTACCACAGCAGACGACATCCTCGACCGACATCACGCCGACGGCAGCCGCGCCGAACGGCGAGAGCCC
GGCCCGGGGCAGGCCGAGAGGGACGGCGCACGAGAAGTCGATCCACGAACACTGCGAGGCCCTGCTGTCCGATCT
CGACACCGTCGTCACCGAGTTCTCGGCGCTCATCGCCGGCAGCAGGAGGCGGCGGATGTCGGTACCGCTCTCGGC
CGGCGGCGCGTCCCGCATCAGCATCGACACGACGTCGACCAAGGACGAGTTCTTCGACGCGGAGGACGCCAAGCC
GGCCGTCGTCAAGATCGACGGCAGCGGAGACGAGTCGGCGCAGACGGACGGCGACGAGGCCGAGACGCGCGACGG
CTCCTCCGTCTCGTCCAGGGACGACGACGAGCTGGTCAGCGCCGACAGCGCCGGCCACCTGTTCCCGTCGAGGCC
CAAGAGCCTGGCGCCGCTGCCGCTGGACAAGGCGGTGTCTCGACGGACGACGATACCGCCGGCGACGGTGCAGCC
GCCGAGCCTGATAGCGTTCGTGCGCAAGAACGTGGGCAAGGACCTGAGCACCATCAGCATGCCCGTCTCGGCCAA
CGAGCCGACGTCGCTGCTGCAGAAGCTGGCGGAGCAGCTCGAGTACGCGCAGCTGCTGGACAAGGCGGCGCGGCA
GAAGAGCGCGACGGAGCGGCTGCTGTTCGTCACGGCCTTTGCCGTGTCGCAGTTCAGCAGCGGGCGGGCCAAGGA
GCGGTCGATACGCAAGCCGTTCAACCCGCTGCTCGGCGAGACGTTCGAGCTGGTGCGGACGAACAAGGAGGTGCC
CGGCGGGTTCCGGCTGCTGGTGGAGAAGGTGCAGCACCGGCCGGTGCGGCTGGCGATGCAGGCCGAGTCGGCCAA
CTGGTCGTTTGCGCAGTCGCCGGCGCCCGGGCAGAAGTTCTGGGGAAAGAGCGCCGAGATCACGACGGAGGGCCG
GGTGCGGGTGGCGCTGCGGCTGGGCGACGGCAGCGACGAGTTCTACTCGTGGAACGTGGCCACCATGTTCCTGCG
CAACGTGGTGATGGGGGAGAAGTACGTGGAGCCGGTGGGCACGATGCAGGTGGTCAACGACAGCAGCGGGCACAA
GGCGACGGTCGAGTTCAAGAGCAAGGGCATGTTCGGCGGGCGGTCGGAGGAGGTGCAGGTCAACACGTACGGGCC
CGACGGGGCGGACACGGGCAGCGGGCTGGCCGGGACGTGGACGGGCGGCCTGCGGACGGTGGGGCCGGGCAAGGC
GGCGAGCGAGGATGTGTGGCAGGCGGGCAAGCTGGTGGACAACGCCGGGCAGACGTACGGCATGACGCGCTTCGC
GGCCTCGCTCAACGAGGTGACGGAGGTGGAGAAGGGCCGGGTGGCGGCGACGGACAGCCGGCTGCGGCCGGACCA
GCGGCTGGCGGAGCAGGGCGAGCTGGAGGCGGCCGAGACGTGGAAGCACCGGCTCGAGGAGGCGCAGCGGGCGCG
GCGGCGCGACATGGAGGCGCGCGGCGAGGCGCACCGGCCGCGGTGGTTCGTCAAGGCGGACGACTCGCCGGAGGG
GGAGGAGGTGTGGAAGATGAGGACCGGCAAGGACGGCTACTGGGAGGAGAGGGCGCGCGGGAGCTGGACGGGCGT
GCCGGCCATCTTTGAGGCTTCGGACGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail