Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6958
Gene name
LocationContig_38:40617..43315
Strand-
Gene length (bp)2698
Transcript length (bp)2181
Coding sequence length (bp)2181
Protein length (aa) 727

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 1.9E-21 279 398
PF08022 FAD_binding_8 FAD-binding domain 2.0E-06 451 497

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36033|FRE2_YEAST Ferric/cupric reductase transmembrane component 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE2 PE=1 SV=1 226 724 2.0E-42
sp|Q08905|FRE3_YEAST Ferric reductase transmembrane component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE3 PE=1 SV=1 149 705 2.0E-42
sp|Q08908|FRE5_YEAST Ferric reductase transmembrane component 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE5 PE=2 SV=1 145 724 1.0E-41
sp|Q12473|FRE6_YEAST Ferric reductase transmembrane component 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE6 PE=1 SV=1 231 724 6.0E-38
sp|P53746|FRE4_YEAST Ferric reductase transmembrane component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE4 PE=2 SV=1 231 724 9.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36033|FRE2_YEAST Ferric/cupric reductase transmembrane component 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE2 PE=1 SV=1 226 724 2.0E-42
sp|Q08905|FRE3_YEAST Ferric reductase transmembrane component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE3 PE=1 SV=1 149 705 2.0E-42
sp|Q08908|FRE5_YEAST Ferric reductase transmembrane component 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE5 PE=2 SV=1 145 724 1.0E-41
sp|Q12473|FRE6_YEAST Ferric reductase transmembrane component 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE6 PE=1 SV=1 231 724 6.0E-38
sp|P53746|FRE4_YEAST Ferric reductase transmembrane component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE4 PE=2 SV=1 231 724 9.0E-35
sp|P32791|FRE1_YEAST Ferric/cupric reductase transmembrane component 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE1 PE=1 SV=1 228 726 4.0E-34
sp|P78588|FREL_CANAX Probable ferric reductase transmembrane component OS=Candida albicans GN=CFL1 PE=3 SV=1 165 724 9.0E-34
sp|Q5A446|FRE1_CANAL Ferric/cupric reductase transmembrane component 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CFL1 PE=2 SV=1 165 724 1.0E-32
sp|Q04800|FRP1_SCHPO Ferric reductase transmembrane component 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp1 PE=1 SV=1 278 708 4.0E-13
sp|O94727|FRP2_SCHPO Ferric/cupric reductase transmembrane component 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp2 PE=3 SV=1 278 724 5.0E-13
sp|Q12333|FRE7_YEAST Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE7 PE=1 SV=2 276 617 3.0E-10
sp|A6ZN61|FRE7_YEAS7 Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain YJM789) GN=FRE7 PE=3 SV=1 276 617 2.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 160 182 22
2 239 258 19
3 278 295 17
4 316 338 22
5 353 375 22
6 384 406 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6958
MLRAALLPCLLLSTPSVSTAAARGHGDNCARACDKCLQPVRFNDSLPTDPAAVHLCRSRLALSSRHLCLQNYCGP
EAAGLALGAWNATCSELVGSPLPPLLVNHSREALARLPRIHKGDALGADGPLVEAVIPSAGFFRAWAETLDSVDF
VKRHHSLYALATGLFWAGVVLIGFVHKLCLAFSRMRRGRHQRRPPSTPRLVDAGRRWFQRNVTIPAAFGYRCAEA
VWWASIPPRMQAMTIAVFLLMNLFFGVHGYMIVSENMYLPSWEQQVLRYASDRMGIMAFANFPLIWLFGMRNNVA
IWLTGWSAQTYNHFHRWVARAATLQALVHAFGYTAFILRSHGWKSLLWLYSTLFFSAGQVAAVLMCALVACSFCW
IRRRHYETFLVLHIGMSVLLLVAMLGHVSIFHGRLNSLFWIPVYIWVLDRSIRLLRLIAFNPLRIYADAYASFSA
ETNIVRLNVSIGKGTYKVRPGTYYYLTLLEDAHFWESHPFSVASVSSHSLKSTDELSPLLTAERPRRLEAGDGSG
PGRRGRGGKQMTFLIRPYNGFTKRLKRLASDEPSSPVRLRVFVEGPYGHTTALDRYDRVVFLAGGSGVSVFLSYQ
RLLAGSGSAVQLHWAVREPAFATEVLATDMDEDWIGREDFSVDLYVPASMPATDAADGRPRAGVRHHATRLDVDT
VVQTAVAAAGRGQRLCVVACGPSSIKDETRAAVVAALRGAECRLDFVEESW*
Coding >Hirsu2|6958
ATGCTGCGAGCAGCACTGCTCCCGTGCTTGCTTCTGTCGACGCCGTCTGTCTCCACGGCCGCCGCCCGCGGCCAC
GGCGACAACTGCGCGAGGGCCTGCGACAAGTGCCTGCAACCCGTGCGCTTCAACGACTCGCTGCCGACCGATCCT
GCTGCCGTTCACCTGTGTCGCAGCCGGCTCGCGCTGTCATCTCGCCATCTGTGCCTCCAGAACTACTGCGGCCCG
GAGGCGGCAGGCCTGGCCCTCGGCGCATGGAACGCCACTTGTTCGGAGCTCGTCGGCTCTCCGCTTCCGCCCTTG
CTCGTCAACCACTCACGCGAGGCCCTTGCCCGCCTGCCCAGGATTCACAAGGGCGACGCCCTGGGCGCGGACGGA
CCGCTGGTCGAGGCTGTCATCCCGTCGGCCGGCTTCTTCCGGGCCTGGGCCGAGACACTGGACTCTGTGGACTTC
GTGAAAAGGCATCATTCACTCTACGCGCTCGCCACGGGGCTCTTCTGGGCCGGCGTCGTCCTGATCGGCTTCGTC
CATAAGCTATGTCTCGCATTTTCGCGCATGCGCCGAGGTCGACACCAGAGGCGTCCGCCATCCACACCACGCCTC
GTCGACGCCGGCCGAAGATGGTTCCAGCGTAACGTCACGATCCCGGCCGCATTTGGCTACCGTTGCGCCGAGGCC
GTCTGGTGGGCGAGCATCCCGCCGCGGATGCAAGCCATGACCATCGCCGTCTTCCTCCTGATGAACCTCTTCTTC
GGCGTCCACGGCTACATGATCGTTTCGGAGAATATGTACCTCCCGTCGTGGGAACAGCAGGTCCTCCGTTACGCC
TCGGACAGGATGGGAATCATGGCCTTTGCCAACTTTCCCCTGATATGGCTATTTGGGATGAGAAACAACGTGGCG
ATATGGCTGACGGGATGGAGCGCCCAGACTTATAATCACTTCCACCGCTGGGTTGCTCGCGCCGCCACGCTGCAG
GCTCTTGTGCACGCTTTTGGATACACGGCGTTTATCTTAAGAAGCCATGGCTGGAAGTCTCTGCTGTGGTTGTAT
TCTACCCTTTTCTTCAGTGCCGGCCAAGTCGCCGCCGTGCTCATGTGCGCTTTGGTCGCTTGCTCCTTCTGCTGG
ATCCGTCGACGACACTACGAAACCTTTCTCGTCCTTCACATCGGAATGTCAGTCTTGCTCTTGGTTGCCATGCTC
GGCCACGTTTCGATATTCCATGGAAGATTGAACAGCCTCTTCTGGATCCCGGTTTATATATGGGTTCTCGATAGA
TCGATTCGCCTGCTGCGGCTGATTGCGTTCAACCCGCTGCGAATCTACGCCGACGCGTATGCCTCGTTCAGTGCC
GAAACGAACATCGTTCGATTGAATGTGTCAATCGGCAAGGGTACCTACAAAGTTCGCCCCGGAACGTACTACTAC
CTGACCTTGCTGGAAGACGCGCACTTCTGGGAGAGCCATCCGTTCAGCGTCGCCTCCGTCTCGAGCCACTCGCTG
AAAAGCACGGACGAGCTCTCGCCACTGCTGACGGCGGAACGGCCCCGGCGCCTCGAGGCGGGCGACGGCAGTGGG
CCGGGACGACGTGGGCGCGGCGGAAAGCAGATGACCTTCCTCATCCGGCCCTACAACGGTTTCACGAAGCGCCTC
AAGCGCCTGGCGTCGGACGAGCCGTCGAGCCCCGTTCGGCTGAGAGTGTTCGTGGAGGGTCCGTACGGCCACACG
ACGGCCCTGGATCGCTACGACCGGGTCGTGTTCCTCGCCGGCGGCAGCGGCGTCTCCGTCTTCCTTTCGTATCAG
CGGCTCCTCGCCGGCTCCGGATCGGCAGTGCAGCTCCACTGGGCCGTCCGCGAGCCGGCATTCGCGACCGAGGTT
CTGGCGACTGACATGGATGAAGACTGGATCGGGCGGGAGGACTTCTCCGTCGACCTCTACGTCCCCGCCTCGATG
CCGGCAACGGACGCCGCGGATGGCCGACCGCGAGCCGGGGTCCGGCACCACGCCACGCGACTGGACGTCGATACC
GTGGTCCAGACCGCCGTCGCCGCCGCGGGGCGAGGACAGAGGCTGTGCGTCGTGGCTTGCGGGCCGTCAAGTATC
AAAGACGAGACGCGAGCGGCGGTCGTTGCCGCCCTGAGAGGCGCCGAATGCCGGCTTGACTTTGTCGAGGAGAGC
TGGTGA
Transcript >Hirsu2|6958
ATGCTGCGAGCAGCACTGCTCCCGTGCTTGCTTCTGTCGACGCCGTCTGTCTCCACGGCCGCCGCCCGCGGCCAC
GGCGACAACTGCGCGAGGGCCTGCGACAAGTGCCTGCAACCCGTGCGCTTCAACGACTCGCTGCCGACCGATCCT
GCTGCCGTTCACCTGTGTCGCAGCCGGCTCGCGCTGTCATCTCGCCATCTGTGCCTCCAGAACTACTGCGGCCCG
GAGGCGGCAGGCCTGGCCCTCGGCGCATGGAACGCCACTTGTTCGGAGCTCGTCGGCTCTCCGCTTCCGCCCTTG
CTCGTCAACCACTCACGCGAGGCCCTTGCCCGCCTGCCCAGGATTCACAAGGGCGACGCCCTGGGCGCGGACGGA
CCGCTGGTCGAGGCTGTCATCCCGTCGGCCGGCTTCTTCCGGGCCTGGGCCGAGACACTGGACTCTGTGGACTTC
GTGAAAAGGCATCATTCACTCTACGCGCTCGCCACGGGGCTCTTCTGGGCCGGCGTCGTCCTGATCGGCTTCGTC
CATAAGCTATGTCTCGCATTTTCGCGCATGCGCCGAGGTCGACACCAGAGGCGTCCGCCATCCACACCACGCCTC
GTCGACGCCGGCCGAAGATGGTTCCAGCGTAACGTCACGATCCCGGCCGCATTTGGCTACCGTTGCGCCGAGGCC
GTCTGGTGGGCGAGCATCCCGCCGCGGATGCAAGCCATGACCATCGCCGTCTTCCTCCTGATGAACCTCTTCTTC
GGCGTCCACGGCTACATGATCGTTTCGGAGAATATGTACCTCCCGTCGTGGGAACAGCAGGTCCTCCGTTACGCC
TCGGACAGGATGGGAATCATGGCCTTTGCCAACTTTCCCCTGATATGGCTATTTGGGATGAGAAACAACGTGGCG
ATATGGCTGACGGGATGGAGCGCCCAGACTTATAATCACTTCCACCGCTGGGTTGCTCGCGCCGCCACGCTGCAG
GCTCTTGTGCACGCTTTTGGATACACGGCGTTTATCTTAAGAAGCCATGGCTGGAAGTCTCTGCTGTGGTTGTAT
TCTACCCTTTTCTTCAGTGCCGGCCAAGTCGCCGCCGTGCTCATGTGCGCTTTGGTCGCTTGCTCCTTCTGCTGG
ATCCGTCGACGACACTACGAAACCTTTCTCGTCCTTCACATCGGAATGTCAGTCTTGCTCTTGGTTGCCATGCTC
GGCCACGTTTCGATATTCCATGGAAGATTGAACAGCCTCTTCTGGATCCCGGTTTATATATGGGTTCTCGATAGA
TCGATTCGCCTGCTGCGGCTGATTGCGTTCAACCCGCTGCGAATCTACGCCGACGCGTATGCCTCGTTCAGTGCC
GAAACGAACATCGTTCGATTGAATGTGTCAATCGGCAAGGGTACCTACAAAGTTCGCCCCGGAACGTACTACTAC
CTGACCTTGCTGGAAGACGCGCACTTCTGGGAGAGCCATCCGTTCAGCGTCGCCTCCGTCTCGAGCCACTCGCTG
AAAAGCACGGACGAGCTCTCGCCACTGCTGACGGCGGAACGGCCCCGGCGCCTCGAGGCGGGCGACGGCAGTGGG
CCGGGACGACGTGGGCGCGGCGGAAAGCAGATGACCTTCCTCATCCGGCCCTACAACGGTTTCACGAAGCGCCTC
AAGCGCCTGGCGTCGGACGAGCCGTCGAGCCCCGTTCGGCTGAGAGTGTTCGTGGAGGGTCCGTACGGCCACACG
ACGGCCCTGGATCGCTACGACCGGGTCGTGTTCCTCGCCGGCGGCAGCGGCGTCTCCGTCTTCCTTTCGTATCAG
CGGCTCCTCGCCGGCTCCGGATCGGCAGTGCAGCTCCACTGGGCCGTCCGCGAGCCGGCATTCGCGACCGAGGTT
CTGGCGACTGACATGGATGAAGACTGGATCGGGCGGGAGGACTTCTCCGTCGACCTCTACGTCCCCGCCTCGATG
CCGGCAACGGACGCCGCGGATGGCCGACCGCGAGCCGGGGTCCGGCACCACGCCACGCGACTGGACGTCGATACC
GTGGTCCAGACCGCCGTCGCCGCCGCGGGGCGAGGACAGAGGCTGTGCGTCGTGGCTTGCGGGCCGTCAAGTATC
AAAGACGAGACGCGAGCGGCGGTCGTTGCCGCCCTGAGAGGCGCCGAATGCCGGCTTGACTTTGTCGAGGAGAGC
TGGTGA
Gene >Hirsu2|6958
ATGCTGCGAGCAGCACTGCTCCCGTGCTTGCTTCTGTCGACGCCGTCTGTCTCCACGGCCGCCGCCCGCGGCCAC
GGCGACAACTGCGCGAGGGCCTGCGACAAGTGCCTGCAACCCGTGCGCTTCAACGACTCGCTGCCGACCGATCCT
GCTGCCGTTCACCTGTGTCGCAGCCGGCTCGCGCTGTCATCTCGCCATCTGTGCCTCCAGAACTACTGCGGCCCG
GAGGCGGCAGGCCTGGCCCTCGGCGCATGGAACGCCACTTGTTCGGAGCTCGTCGGCTCTCCGCTTCCGCCCTTG
CTCGTCAACCACTCACGCGAGGCCCTTGCCCGCCTGCCCAGGATTCACAAGGGCGACGCCCTGGGCGCGGACGGA
CCGCTGGTCGAGGCTGTCATCCCGTCGGCCGGCTTCTTCCGGGCCTGGGCCGAGACACTGGTATATTCCTCACGG
CCTTTCCTCGCGCCGCGAGAGAACAGACGACTGAGCTCGATGGCGTCGCCGCAGGACTCTGTGGACTTCGTGAAA
AGGCATCATTCACTCTACGCGTAAGCCCGGTCCCGGCCGCACGCTTCTCGGAGTCGAGCTGATGGCGTCCCCGTC
ACCGTCCGCAGGCTCGCCACGGGGCTCTTCTGGGCCGGCGTCGTCCTGATCGGCTTCGTCCATAAGCTATGTCTC
GCATTTTCGCGCATGCGCCGAGGTCGACACCAGAGGCGTCCGCCATCCACACCACGCCTCGTCGACGCCGGCCGA
AGATGGTTCCAGCGTAACGTCACGATCCCGGCCGCATTTGGCTACCGTTGCGCCGAGGCCGTCTGGTGGGCGAGC
ATCCCGCCGCGGATGCAAGCCATGACCATCGCCGTCTTCCTCCTGATGAACCTCTTCTTCGGCGTCCACGGCTAC
ATGATCGTTTCGGAGAATATGTAGTACGCGCCACCGCAACTGCCGCGGGCCCCGTTGAAACAGAGTTCTAACTGG
CGCGTGGGCCGTCAGCCTCCCGTCGTGGGAACAGCAGGTCCTCCGTTACGCCTCGGACAGGATGGGAATCATGGC
CTTTGCCAACTTTCCCCTGATATGGCTATTTGGGATGAGAAACAACGTGGCGATATGGCTGACGGGATGGAGCGC
CCAGACTTATAATCACTTCCACCGCTGGGTTGCTCGCGCCGCCACGCTGCAGGCTCTTGTGCACGCTTTTGGATA
CACGGCGTTTATCTTAAGAAGTAGGTCAATTCCGTAATGCTGTGTTTCATCTCTCTTCCCCCTTCTTCCCGCCGT
GACCGGCCTGCCCGTCACCTTCACGTCCCTCGGATGATCGACATTCTCGCTCAGCTTTTTTCGCCTATACGTGAA
AGAGTCTATACATGCACCTTCAGGCTGACACCAGCGTCCTCAGGCCATGGCTGGAAGTCTCTGCTGTGGTTGTAT
TCTACCCTTTTCTTCAGTGCCGGCCAAGTCGTACGTTGATCCGTTGAAGCTTGGTCCCGCCCGCGCCACGTCGGA
CGCTGACCGAATTCGCTGCAGGCCGCCGTGCTCATGTGCGCTTTGGTCGCTTGCTCCTTCTGCTGGATCCGTCGA
CGACACTACGAAACCTTTCTCGTCCTTCACATCGGAATGTCAGTCTTGCTCTTGGTTGCCATGCTCGGGTAAGCG
TCGCCGTCCCGCCCGCGTCCCGCAGCTTGTCGTAATCAAGGTCACTGACCTTGTGTCGAAATGCCGAAGCCACGT
TTCGATATTCCATGGAAGATTGAACAGCCTCTTCTGGATCCCGGTTTATATATGGGTTCTCGATAGATCGATTCG
CCTGCTGCGGCTGATTGCGTTCAACCCGCTGCGAATCTACGCCGACGCGTATGCCTCGTTCAGTGCCGAAACGAA
CATCGTTCGATTGAATGTGTCAATCGGCAAGGGTACCTACAAAGTTCGCCCCGGAACGTACTACTACCTGACCTT
GCTGGAAGACGCGCACTTCTGGGAGAGCCATCCGTTCAGCGTCGCCTCCGTCTCGAGCCACTCGCTGAAAAGCAC
GGACGAGCTCTCGCCACTGCTGACGGCGGAACGGCCCCGGCGCCTCGAGGCGGGCGACGGCAGTGGGCCGGGACG
ACGTGGGCGCGGCGGAAAGCAGATGACCTTCCTCATCCGGCCCTACAACGGTTTCACGAAGCGCCTCAAGCGCCT
GGCGTCGGACGAGCCGTCGAGCCCCGTTCGGCTGAGAGTGTTCGTGGAGGGTCCGTACGGCCACACGACGGCCCT
GGATCGCTACGACCGGGTCGTGTTCCTCGCCGGCGGCAGCGGCGTCTCCGTCTTCCTTTCGTATCAGCGGCTCCT
CGCCGGCTCCGGATCGGCAGTGCAGCTCCACTGGGCCGTCCGCGAGCCGGCATTCGCGACCGAGGTTCTGGCGAC
TGACATGGATGAAGACTGGATCGGGCGGGAGGACTTCTCCGTCGACCTCTACGTCCCCGCCTCGATGCCGGCAAC
GGACGCCGCGGATGGCCGACCGCGAGCCGGGGTCCGGCACCACGCCACGCGACTGGACGTCGATACCGTGGTCCA
GACCGCCGTCGCCGCCGCGGGGCGAGGACAGAGGCTGTGCGTCGTGGCTTGCGGGCCGTCAAGTATCAAAGACGA
GACGCGAGCGGCGGTCGTTGCCGCCCTGAGAGGCGCCGAATGCCGGCTTGACTTTGTCGAGGAGAGCTGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail