Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6950
Gene name
LocationContig_38:20780..22084
Strand-
Gene length (bp)1304
Transcript length (bp)1233
Coding sequence length (bp)1233
Protein length (aa) 411

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 5.0E-30 187 366
PF05922 Inhibitor_I9 Peptidase inhibitor I9 7.7E-14 21 99

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CWF3|ORYZ_NEOFI Alkaline protease 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=alp1 PE=2 SV=1 18 403 6.0E-130
sp|A1CIA7|ORYZ_ASPCL Alkaline protease 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=alp1 PE=3 SV=1 6 403 8.0E-130
sp|P28296|ORYZ_ASPFU Alkaline protease 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alp1 PE=1 SV=2 18 403 5.0E-129
sp|B0Y708|ORYZ_ASPFC Alkaline protease 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alp1 PE=3 SV=1 18 403 5.0E-129
sp|Q00208|ORYZ_EMENI Alkaline protease 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alp1 PE=2 SV=1 7 406 2.0E-128
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CWF3|ORYZ_NEOFI Alkaline protease 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=alp1 PE=2 SV=1 18 403 6.0E-130
sp|A1CIA7|ORYZ_ASPCL Alkaline protease 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=alp1 PE=3 SV=1 6 403 8.0E-130
sp|P28296|ORYZ_ASPFU Alkaline protease 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alp1 PE=1 SV=2 18 403 5.0E-129
sp|B0Y708|ORYZ_ASPFC Alkaline protease 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alp1 PE=3 SV=1 18 403 5.0E-129
sp|Q00208|ORYZ_EMENI Alkaline protease 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alp1 PE=2 SV=1 7 406 2.0E-128
sp|P12547|ORYZ_ASPOR Alkaline protease 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alp1 PE=1 SV=2 18 403 1.0E-127
sp|B8N106|ORYZ_ASPFN Alkaline protease 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=alp1 PE=1 SV=1 18 403 1.0E-127
sp|P35211|ORYZ_ASPFL Alkaline protease 1 OS=Aspergillus flavus GN=alp1 PE=1 SV=1 18 403 2.0E-125
sp|Q03420|ALP_HYPAT Alkaline proteinase OS=Hypocrea atroviridis GN=prb1 PE=1 SV=1 18 403 2.0E-119
sp|P29118|ALP_ACRCH Alkaline proteinase OS=Acremonium chrysogenum GN=ALP PE=3 SV=1 10 403 3.0E-119
sp|Q9Y778|SMP1_MAGPO Subtilisin-like proteinase Mp1 OS=Magnaporthiopsis poae PE=1 SV=1 18 405 7.0E-99
sp|E4UZP9|SUB2_ARTGP Subtilisin-like protease 2 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB2 PE=3 SV=1 1 405 1.0E-78
sp|L8FSM5|SUB2_PSED2 Subtilisin-like protease 2 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP2 PE=3 SV=1 9 403 3.0E-78
sp|C5G168|SUB2_ARTOC Subtilisin-like protease 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB2 PE=3 SV=1 1 405 5.0E-78
sp|B6VA85|SUB2_TRIEQ Subtilisin-like protease 2 OS=Trichophyton equinum GN=SUB2 PE=3 SV=1 1 405 2.0E-77
sp|B8XGQ5|SUB2_TRITO Subtilisin-like protease 2 OS=Trichophyton tonsurans GN=SUB2 PE=3 SV=2 1 405 4.0E-77
sp|Q5VJ76|SUB2_TRIVC Subtilisin-like protease 2 OS=Trichophyton verrucosum GN=SUB2 PE=3 SV=2 1 405 4.0E-77
sp|D4DLI5|SUB2_TRIVH Subtilisin-like protease 2 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB2 PE=3 SV=2 1 405 5.0E-77
sp|Q64K35|SUB2_ARTBE Subtilisin-like protease 2 OS=Arthroderma benhamiae GN=SUB2 PE=3 SV=2 1 405 2.0E-76
sp|D4AZ75|SUB2_ARTBC Subtilisin-like protease 2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB2 PE=2 SV=2 1 405 2.0E-76
sp|C5PCX1|SUB7B_COCP7 Subtilisin-like protease CPC735_015300 OS=Coccidioides posadasii (strain C735) GN=CPC735_015300 PE=3 SV=1 10 370 1.0E-75
sp|Q69F57|SUB2_TRIRU Subtilisin-like protease 2 OS=Trichophyton rubrum GN=SUB2 PE=3 SV=2 1 405 2.0E-75
sp|C5NZ70|SUB2C_COCP7 Subtilisin-like protease CPC735_013710 OS=Coccidioides posadasii (strain C735) GN=CPC735_013710 PE=3 SV=1 4 405 4.0E-75
sp|Q8J0D8|SUB2_ARTOT Subtilisin-like protease 2 OS=Arthroderma otae GN=SUB2 PE=3 SV=2 1 405 6.0E-74
sp|Q9UTS0|PSP3_SCHPO Subtilase-type proteinase psp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psp3 PE=2 SV=1 18 406 2.0E-73
sp|P29138|CUDP_METAN Cuticle-degrading protease OS=Metarhizium anisopliae GN=PR1 PE=1 SV=1 62 403 6.0E-73
sp|C5P906|SUB2B_COCP7 Subtilisin-like protease CPC735_003880 OS=Coccidioides posadasii (strain C735) GN=CPC735_003880 PE=3 SV=1 1 405 9.0E-73
sp|Q64K36|SUB7_ARTBE Subtilisin-like protease 7 OS=Arthroderma benhamiae GN=SUB7 PE=1 SV=1 21 360 8.0E-72
sp|C5PCB1|SUB4A_COCP7 Subtilisin-like protease CPC735_066880 OS=Coccidioides posadasii (strain C735) GN=CPC735_066880 PE=3 SV=1 10 405 1.0E-71
sp|Q68GV9|ALP_LECPS Alkaline serine protease ver112 OS=Lecanicillium psalliotae PE=1 SV=1 8 369 2.0E-71
sp|D4APA9|SUB7_ARTBC Subtilisin-like protease 7 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB7 PE=1 SV=2 21 360 2.0E-71
sp|Q5VJ71|SUB7_TRIVC Subtilisin-like protease 7 OS=Trichophyton verrucosum GN=SUB7 PE=3 SV=1 21 360 3.0E-71
sp|D4B5N1|SUB9_ARTBC Subtilisin-like protease 9 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB9 PE=3 SV=1 13 398 6.0E-71
sp|E4UTU7|SUB9_ARTGP Subtilisin-like protease 9 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB9 PE=3 SV=1 18 402 6.0E-71
sp|D4CZQ4|SUB7_TRIVH Subtilisin-like protease 7 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB7 PE=3 SV=2 21 360 7.0E-71
sp|Q8NID9|SUB7_TRIRU Subtilisin-like protease 7 OS=Trichophyton rubrum GN=SUB7 PE=2 SV=1 21 360 1.0E-70
sp|A1XIH6|SUB7_TRIVO Subtilisin-like protease 7 OS=Trichophyton violaceum GN=SUB7 PE=1 SV=1 21 360 2.0E-70
sp|A1XIH4|SUB7_TRITO Subtilisin-like protease 7 OS=Trichophyton tonsurans GN=SUB7 PE=1 SV=1 21 403 2.0E-70
sp|L8G6I7|SUB1_PSED2 Subtilisin-like protease 1 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP1 PE=1 SV=1 9 403 2.0E-70
sp|A1XIH3|SUB7_TRIEQ Subtilisin-like protease 7 OS=Trichophyton equinum GN=SUB7 PE=1 SV=1 21 361 3.0E-70
sp|C5FJA5|SUB7_ARTOC Subtilisin-like protease 7 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB7 PE=3 SV=1 21 361 3.0E-70
sp|P40903|ISP6_SCHPO Sexual differentiation process putative subtilase-type proteinase isp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp6 PE=2 SV=1 14 361 6.0E-70
sp|A1XIH5|SUB7_TRISD Subtilisin-like protease 7 OS=Trichophyton soudanense GN=SUB7 PE=1 SV=1 21 360 9.0E-70
sp|P23653|PRTR_ENGAL Proteinase R OS=Engyodontium album GN=PROR PE=1 SV=1 3 407 6.0E-69
sp|G1X8P8|SPAZ_ARTOA Cuticle-degrading serine protease OS=Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) PE=1 SV=1 18 403 1.0E-68
sp|C5P5Q3|SUB9_COCP7 Subtilisin-like protease CPC735_033790 OS=Coccidioides posadasii (strain C735) GN=CPC735_033790 PE=3 SV=1 12 404 2.0E-68
sp|P06873|PRTK_ENGAL Proteinase K OS=Engyodontium album GN=PROK PE=1 SV=2 18 404 2.0E-68
sp|C5G1D1|SUB5_ARTOC Subtilisin-like protease 5 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB5 PE=3 SV=1 22 370 3.0E-68
sp|E4UN97|SUB3_ARTGP Subtilisin-like protease 3 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB3 PE=3 SV=1 18 386 6.0E-68
sp|D4D674|SUB9_TRIVH Subtilisin-like protease 9 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB9 PE=3 SV=1 13 402 4.0E-67
sp|C5NZ69|SUB7C_COCP7 Subtilisin-like protease CPC735_013700 OS=Coccidioides posadasii (strain C735) GN=CPC735_013700 PE=3 SV=1 18 404 5.0E-67
sp|B8XGQ6|SUB3_TRITO Subtilisin-like protease 3 OS=Trichophyton tonsurans GN=SUB3 PE=3 SV=1 18 382 5.0E-67
sp|C5P6D1|SUB2A_COCP7 Subtilisin-like protease CPC735_023170 OS=Coccidioides posadasii (strain C735) GN=CPC735_023170 PE=3 SV=1 18 403 7.0E-67
sp|C5PGK9|SUB7A_COCP7 Subtilisin-like protease CPC735_050320 OS=Coccidioides posadasii (strain C735) GN=CPC735_050320 PE=3 SV=1 10 360 1.0E-66
sp|Q8J0D7|SUB3_ARTOT Subtilisin-like protease 3 OS=Arthroderma otae GN=SUB3 PE=1 SV=1 18 386 2.0E-66
sp|C5FMY5|SUB3_ARTOC Subtilisin-like protease 3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB3 PE=3 SV=1 18 386 2.0E-66
sp|D4D6Q4|SUB4_TRIVH Subtilisin-like protease 4 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB4 PE=3 SV=1 18 403 2.0E-66
sp|Q5VJ74|SUB4_TRIVC Subtilisin-like protease 4 OS=Trichophyton verrucosum GN=SUB4 PE=3 SV=1 18 403 2.0E-66
sp|Q64K33|SUB4_ARTBE Subtilisin-like protease 4 OS=Arthroderma benhamiae GN=SUB4 PE=3 SV=1 18 403 2.0E-66
sp|D4AXW3|SUB4_ARTBC Subtilisin-like protease 4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB4 PE=1 SV=2 18 403 2.0E-66
sp|B6VA86|SUB3_TRIEQ Subtilisin-like protease 3 OS=Trichophyton equinum GN=SUB3 PE=3 SV=1 18 382 5.0E-66
sp|E4UPZ4|SUB1_ARTGP Subtilisin-like protease 1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB1 PE=3 SV=1 10 403 5.0E-66
sp|L8GD75|SUB3_PSED2 Subtilisin-like protease 3 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP3 PE=3 SV=1 55 361 8.0E-66
sp|D4DLA2|SUB3_TRIVH Subtilisin-like protease 3 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB3 PE=3 SV=1 18 382 9.0E-66
sp|Q5VJ75|SUB3_TRIVC Subtilisin-like protease 3 OS=Trichophyton verrucosum GN=SUB3 PE=3 SV=1 18 382 9.0E-66
sp|Q64K34|SUB3_ARTBE Subtilisin-like protease 3 OS=Arthroderma benhamiae GN=SUB3 PE=1 SV=1 18 382 9.0E-66
sp|D4AWY5|SUB3_ARTBC Subtilisin-like protease 3 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB3 PE=1 SV=1 18 382 9.0E-66
sp|B8XGQ7|SUB4_TRITO Subtilisin-like protease 4 OS=Trichophyton tonsurans GN=SUB4 PE=3 SV=1 18 403 2.0E-65
sp|A7UKV6|SUB4_TRIEQ Subtilisin-like protease 4 (Fragment) OS=Trichophyton equinum GN=SUB4 PE=3 SV=1 18 403 2.0E-65
sp|Q69F56|SUB3_TRIRU Subtilisin-like protease 3 OS=Trichophyton rubrum GN=SUB3 PE=1 SV=1 18 370 2.0E-65
sp|C5FXZ6|SUB4_ARTOC Subtilisin-like protease 4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB4 PE=3 SV=1 18 368 2.0E-65
sp|P87184|ALP2_ASPFU Alkaline protease 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alp2 PE=1 SV=1 8 403 4.0E-65
sp|B0Y473|ALP2_ASPFC Alkaline protease 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alp2 PE=3 SV=1 8 403 4.0E-65
sp|D4DKQ4|SUB8_TRIVH Subtilisin-like protease 8 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB8 PE=3 SV=1 2 403 7.0E-65
sp|C5P1W9|SU11A_COCP7 Subtilisin-like protease CPC735_035780 OS=Coccidioides posadasii (strain C735) GN=CPC735_035780 PE=3 SV=1 18 370 8.0E-65
sp|D4AX50|SUB8_ARTBC Subtilisin-like protease 8 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB8 PE=3 SV=1 2 403 9.0E-65
sp|Q5VJ77|SUB1_TRIVC Subtilisin-like protease 1 (Fragment) OS=Trichophyton verrucosum GN=SUB1 PE=3 SV=1 18 403 1.0E-64
sp|Q64K30|SUB1_ARTBE Subtilisin-like protease 1 (Fragment) OS=Arthroderma benhamiae GN=SUB1 PE=3 SV=1 18 403 1.0E-64
sp|P58371|SPM1_MAGO7 Subtilisin-like proteinase Spm1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SPM1 PE=3 SV=1 8 403 2.0E-64
sp|C5FQI3|SUB6_ARTOC Subtilisin-like protease 6 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB6 PE=3 SV=1 18 360 9.0E-64
sp|C5FII2|SUB8_ARTOC Subtilisin-like protease 8 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB8 PE=3 SV=1 8 403 1.0E-63
sp|D4DIW9|SUB1_TRIVH Subtilisin-like protease 1 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB1 PE=3 SV=1 18 403 1.0E-63
sp|E4UWA4|SUB4_ARTGP Subtilisin-like protease 4 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB4 PE=3 SV=1 13 360 1.0E-63
sp|D4AKU9|SUB1_ARTBC Subtilisin-like protease 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB1 PE=2 SV=2 18 403 2.0E-63
sp|E4V4J8|SUB6_ARTGP Subtilisin-like protease 6 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB6 PE=3 SV=1 18 385 3.0E-63
sp|C5P4Z8|SUB8_COCP7 Subtilisin-like protease CPC735_031240 OS=Coccidioides posadasii (strain C735) GN=CPC735_031240 PE=3 SV=1 8 403 4.0E-63
sp|Q69F58|SUB1_TRIRU Subtilisin-like protease 1 OS=Trichophyton rubrum GN=SUB1 PE=2 SV=1 18 403 4.0E-63
sp|C5FH27|SUB9_ARTOC Subtilisin-like protease 9 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB9 PE=3 SV=1 18 384 6.0E-63
sp|E4V2V9|SUB7_ARTGP Subtilisin-like protease 7 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB7 PE=3 SV=1 21 361 7.0E-63
sp|P33295|PEPC_ASPNG Subtilisin-like serine protease pepC OS=Aspergillus niger GN=pepC PE=3 SV=1 8 398 3.0E-62
sp|Q8J0D9|SUB1_ARTOT Subtilisin-like protease 1 OS=Arthroderma otae GN=SUB1 PE=3 SV=1 18 403 5.0E-62
sp|D4B194|SUB5_ARTBC Subtilisin-like protease 5 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB5 PE=3 SV=1 22 352 6.0E-62
sp|C5FPS1|SUB1_ARTOC Subtilisin-like protease 1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB1 PE=3 SV=1 18 403 7.0E-62
sp|G3FNQ9|SPAZ_ARTOL Cuticle-degrading serine protease OS=Arthrobotrys oligospora PE=1 SV=2 18 383 8.0E-62
sp|C5P6L5|SUB4C_COCP7 Subtilisin-like protease CPC735_024010 OS=Coccidioides posadasii (strain C735) GN=CPC735_024010 PE=3 SV=1 18 384 8.0E-62
sp|A1XIH1|SUB6_TRISD Subtilisin-like protease 6 OS=Trichophyton soudanense GN=SUB6 PE=1 SV=1 18 360 1.0E-61
sp|Q9UW97|SUB6_TRIRU Subtilisin-like protease 6 OS=Trichophyton rubrum GN=SUB6 PE=1 SV=1 18 360 1.0E-61
sp|Q3ZEJ8|SUB6_TRITO Subtilisin-like protease 6 OS=Trichophyton tonsurans GN=SUB6 PE=3 SV=1 18 360 2.0E-61
sp|A1XIH0|SUB6_TRIEQ Subtilisin-like protease 6 OS=Trichophyton equinum GN=SUB6 PE=1 SV=1 18 360 3.0E-61
sp|P80146|SEPR_THESR Extracellular serine proteinase OS=Thermus sp. (strain Rt41A) PE=1 SV=3 18 401 6.0E-61
sp|Q69F35|SUB4_TRIRU Subtilisin-like protease 4 OS=Trichophyton rubrum GN=SUB4 PE=1 SV=1 18 402 7.0E-61
sp|B8XGQ4|SUB1_TRITO Subtilisin-like protease 1 OS=Trichophyton tonsurans GN=SUB1 PE=3 SV=1 22 403 8.0E-61
sp|E4V2L6|SUB5_ARTGP Subtilisin-like protease 5 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB5 PE=3 SV=1 22 352 9.0E-61
sp|C5PFR5|SU11B_COCP7 Subtilisin-like protease CPC735_047380 OS=Coccidioides posadasii (strain C735) GN=CPC735_047380 PE=3 SV=1 13 366 1.0E-60
sp|D4D5H3|SUB6_TRIVH Subtilisin-like protease 6 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB6 PE=3 SV=1 18 403 1.0E-60
sp|E4UY04|SUB12_ARTGP Subtilisin-like protease 12 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB12 PE=3 SV=1 18 402 2.0E-60
sp|Q5VJ72|SUB6_TRIVC Subtilisin-like protease 6 OS=Trichophyton verrucosum GN=SUB6 PE=3 SV=1 18 403 2.0E-60
sp|C5NZT2|SUB4B_COCP7 Subtilisin-like protease CPC735_012930 OS=Coccidioides posadasii (strain C735) GN=CPC735_012930 PE=3 SV=1 18 370 3.0E-60
sp|B6VA84|SUB1_TRIEQ Subtilisin-like protease 1 OS=Trichophyton equinum GN=SUB1 PE=3 SV=1 22 403 4.0E-60
sp|Q8J077|SUB6_TRISH Subtilisin-like protease 6 (Fragment) OS=Trichophyton schoenleinii GN=SUB6 PE=1 SV=1 18 360 2.0E-59
sp|D4D1U5|SUB12_TRIVH Subtilisin-like protease 12 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB12 PE=3 SV=1 18 402 3.0E-59
sp|Q64K31|SUB6_ARTBE Subtilisin-like protease 6 OS=Arthroderma benhamiae GN=SUB6 PE=3 SV=1 18 403 4.0E-59
sp|D4ALV9|SUB6_ARTBC Subtilisin-like protease 6 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB6 PE=2 SV=1 18 403 4.0E-59
sp|P08594|AQL1_THEAQ Aqualysin-1 OS=Thermus aquaticus GN=pstI PE=1 SV=2 18 398 1.0E-58
sp|P20015|PRTT_ENGAL Proteinase T (Fragment) OS=Engyodontium album GN=PROT PE=1 SV=1 127 403 2.0E-58
sp|P09230|AEP_YARLI Alkaline extracellular protease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=XPR2 PE=1 SV=1 66 405 4.0E-56
sp|P09232|PRTB_YEAST Cerevisin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRB1 PE=1 SV=1 50 410 5.0E-56
sp|Q69F34|SUB5_TRIRU Subtilisin-like protease 5 OS=Trichophyton rubrum GN=SUB5 PE=2 SV=1 22 352 1.0E-55
sp|D4DIS6|SUB10_TRIVH Subtilisin-like protease 10 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB10 PE=3 SV=1 18 402 2.0E-55
sp|Q64K32|SUB5_ARTBE Subtilisin-like protease 5 OS=Arthroderma benhamiae GN=SUB5 PE=3 SV=1 22 352 2.0E-55
sp|D4D0F5|SUB5_TRIVH Subtilisin-like protease 5 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB5 PE=3 SV=1 22 352 2.0E-55
sp|Q5VJ73|SUB5_TRIVC Subtilisin-like protease 5 OS=Trichophyton verrucosum GN=SUB5 PE=3 SV=1 22 352 2.0E-55
sp|B8XGQ8|SUB5_TRITO Subtilisin-like protease 5 OS=Trichophyton tonsurans GN=SUB5 PE=3 SV=1 22 352 2.0E-55
sp|B6VA87|SUB5_TRIEQ Subtilisin-like protease 5 OS=Trichophyton equinum GN=SUB5 PE=3 SV=1 22 352 2.0E-55
sp|D4AQA9|SUB12_ARTBC Subtilisin-like protease 12 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB12 PE=3 SV=1 18 402 3.0E-55
sp|C5FX37|SUB10_ARTOC Subtilisin-like protease 10 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB10 PE=3 SV=1 18 402 6.0E-54
sp|D4AQG0|SUB10_ARTBC Subtilisin-like protease 10 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB10 PE=3 SV=2 18 402 8.0E-53
sp|P25036|YSP3_YEAST Subtilisin-like protease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP3 PE=2 SV=2 54 409 5.0E-52
sp|D4APE3|SUB11_ARTBC Subtilisin-like protease 11 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB11 PE=3 SV=1 3 370 6.0E-51
sp|D4CZ60|SUB11_TRIVH Subtilisin-like protease 11 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB11 PE=3 SV=1 3 381 1.0E-50
sp|P16588|PROA_VIBAL Alkaline serine exoprotease A OS=Vibrio alginolyticus GN=proA PE=3 SV=1 58 401 3.0E-47
sp|E4V5C5|SUB11_ARTGP Subtilisin-like protease 11 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB11 PE=3 SV=1 3 403 5.0E-47
sp|C5FZ39|SUB11_ARTOC Subtilisin-like protease 11 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB11 PE=3 SV=1 3 403 4.0E-46
sp|C5P9H3|SUB7D_COCP7 Subtilisin-like protease CPC735_005570 OS=Coccidioides posadasii (strain C735) GN=CPC735_005570 PE=3 SV=1 18 370 1.0E-43
sp|Q8SQJ3|SPL1_ENCCU Putative subtilisin-like proteinase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SPL1 PE=2 SV=1 67 359 1.0E-35
sp|P25381|RRT12_YEAST Subtilase-type proteinase RRT12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRT12 PE=1 SV=1 58 366 2.0E-35
sp|P59996|PCSK9_RAT Proprotein convertase subtilisin/kexin type 9 OS=Rattus norvegicus GN=Pcsk9 PE=1 SV=1 161 389 5.0E-28
sp|Q80W65|PCSK9_MOUSE Proprotein convertase subtilisin/kexin type 9 OS=Mus musculus GN=Pcsk9 PE=1 SV=2 161 400 9.0E-28
sp|A8T677|PCSK9_CALMO Proprotein convertase subtilisin/kexin type 9 OS=Callicebus moloch GN=PCSK9 PE=2 SV=1 133 380 6.0E-26
sp|A8T6A1|PCSK9_ATEGE Proprotein convertase subtilisin/kexin type 9 OS=Ateles geoffroyi GN=PCSK9 PE=2 SV=1 133 380 7.0E-26
sp|A8T6A6|PCSK9_LAGLA Proprotein convertase subtilisin/kexin type 9 OS=Lagothrix lagotricha GN=PCSK9 PE=2 SV=1 133 380 8.0E-26
sp|A8T672|PCSK9_COLGU Proprotein convertase subtilisin/kexin type 9 OS=Colobus guereza GN=PCSK9 PE=2 SV=1 133 380 9.0E-26
sp|A8T666|PCSK9_MACMU Proprotein convertase subtilisin/kexin type 9 OS=Macaca mulatta GN=PCSK9 PE=2 SV=1 133 380 1.0E-25
sp|A8T662|PCSK9_MACNE Proprotein convertase subtilisin/kexin type 9 OS=Macaca nemestrina GN=PCSK9 PE=2 SV=1 133 380 1.0E-25
sp|A8T658|PCSK9_PONPY Proprotein convertase subtilisin/kexin type 9 OS=Pongo pygmaeus GN=PCSK9 PE=2 SV=1 133 380 2.0E-25
sp|A8T695|PCSK9_SAIBB Proprotein convertase subtilisin/kexin type 9 OS=Saimiri boliviensis boliviensis GN=PCSK9 PE=2 SV=1 133 380 5.0E-25
sp|A8T688|PCSK9_CALJA Proprotein convertase subtilisin/kexin type 9 OS=Callithrix jacchus GN=PCSK9 PE=2 SV=1 133 351 5.0E-25
sp|A8T655|PCSK9_PANPA Proprotein convertase subtilisin/kexin type 9 OS=Pan paniscus GN=PCSK9 PE=2 SV=2 11 380 8.0E-25
sp|A8T644|PCSK9_PANTR Proprotein convertase subtilisin/kexin type 9 OS=Pan troglodytes GN=PCSK9 PE=2 SV=1 11 380 1.0E-24
sp|A8T650|PCSK9_GORGO Proprotein convertase subtilisin/kexin type 9 OS=Gorilla gorilla gorilla GN=PCSK9 PE=2 SV=1 11 380 1.0E-24
sp|Q8NBP7|PCSK9_HUMAN Proprotein convertase subtilisin/kexin type 9 OS=Homo sapiens GN=PCSK9 PE=1 SV=3 11 380 1.0E-24
sp|A8T682|PCSK9_SAGLB Proprotein convertase subtilisin/kexin type 9 OS=Saguinus labiatus GN=PCSK9 PE=2 SV=1 133 380 2.0E-24
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 70 385 4.0E-23
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 70 385 5.0E-23
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 70 385 7.0E-23
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 162 385 7.0E-23
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 70 385 7.0E-23
sp|P29599|SUBB_BACLE Subtilisin BL OS=Bacillus lentus PE=1 SV=1 152 361 2.0E-22
sp|P42780|BPRX_DICNO Extracellular subtilisin-like protease OS=Dichelobacter nodosus PE=3 SV=1 182 366 1.0E-21
sp|Q99405|PRTM_BACSK M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 126 361 4.0E-21
sp|P29600|SUBS_BACLE Subtilisin Savinase OS=Bacillus lentus PE=1 SV=1 152 361 5.0E-21
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 162 384 5.0E-21
sp|P54423|WPRA_BACSU Cell wall-associated protease OS=Bacillus subtilis (strain 168) GN=wprA PE=1 SV=2 162 390 1.0E-20
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 152 385 1.0E-20
sp|P41362|ELYA_BACCS Alkaline protease OS=Bacillus clausii PE=1 SV=1 126 361 1.0E-20
sp|P27693|ELYA_BACAO Alkaline protease OS=Bacillus alcalophilus PE=1 SV=1 126 361 1.0E-20
sp|P16396|SUBE_BACSU Minor extracellular protease Epr OS=Bacillus subtilis (strain 168) GN=epr PE=2 SV=1 58 360 6.0E-20
sp|P00780|SUBT_BACLI Subtilisin Carlsberg OS=Bacillus licheniformis GN=apr PE=1 SV=1 11 385 1.0E-19
sp|P41363|ELYA_BACHD Thermostable alkaline protease OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH0855 PE=1 SV=2 125 361 6.0E-19
sp|P20724|ELYA_BACYA Alkaline elastase YaB OS=Bacillus sp. (strain YaB) GN=ale PE=1 SV=1 125 361 9.0E-19
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 149 359 3.0E-18
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 142 361 4.0E-18
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 152 359 9.0E-18
sp|P29140|ISP_BACCS Intracellular alkaline protease OS=Bacillus clausii PE=3 SV=1 155 359 1.0E-17
sp|Q5JIZ5|TKSP_THEKO Subtilisin-like serine protease OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1689 PE=1 SV=1 170 361 8.0E-17
sp|P04072|THET_THEVU Thermitase OS=Thermoactinomyces vulgaris PE=1 SV=1 155 361 1.0E-16
sp|P23314|EXPR_XANCP Extracellular protease OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC0851 PE=3 SV=1 195 367 2.0E-16
sp|O31788|APRX_BACSU Serine protease AprX OS=Bacillus subtilis (strain 168) GN=aprX PE=1 SV=1 145 361 1.0E-15
sp|P42779|BPRV_DICNO Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 182 380 5.0E-15
sp|P00782|SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens GN=apr PE=1 SV=1 73 361 5.0E-15
sp|Q0WUG6|SBT61_ARATH Subtilisin-like protease SBT6.1 OS=Arabidopsis thaliana GN=SBT6.1 PE=1 SV=1 111 399 8.0E-15
sp|P58502|TKSU_THEKO Tk-subtilisin OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1675 PE=1 SV=1 162 360 1.0E-13
sp|P29143|HLY_NATA1 Halolysin OS=Natrialba asiatica (strain ATCC 700177 / DSM 12278 / JCM 9576 / FERM P-10747 / NBRC 102637 / 172P1) GN=hly PE=1 SV=1 162 384 1.0E-13
sp|Q5RLZ1|NEP_NATMA Halolysin-like extracellular serine protease Nep OS=Natrialba magadii GN=nep PE=1 SV=2 195 384 4.0E-12
sp|P28842|SUBT_BACS9 Subtilisin OS=Bacillus sp. (strain TA39) GN=sub1 PE=1 SV=1 42 361 1.0E-10
sp|Q8SS86|SPL2_ENCCU Putative subtilisin-like proteinase 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SPL2 PE=2 SV=1 58 353 2.0E-08
sp|P85156|ASE1_ACRSP Subtilisin-like serine protease AS-E1 (Fragment) OS=Acremonium sp. PE=1 SV=1 130 167 2.0E-07
sp|Q9RYM8|SUB2_DEIRA Probable subtilase-type serine protease DR_A0283 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_A0283 PE=1 SV=1 195 361 5.0E-07
sp|Q9WTZ2|MBTP1_MOUSE Membrane-bound transcription factor site-1 protease OS=Mus musculus GN=Mbtps1 PE=1 SV=1 152 359 5.0E-07
sp|Q9Z2A8|MBTP1_CRIGR Membrane-bound transcription factor site-1 protease OS=Cricetulus griseus GN=MBTPS1 PE=1 SV=2 152 359 7.0E-07
sp|Q9WTZ3|MBTP1_RAT Membrane-bound transcription factor site-1 protease OS=Rattus norvegicus GN=Mbtps1 PE=1 SV=2 152 359 8.0E-07
sp|Q9ZSP5|AIR3_ARATH Subtilisin-like protease SBT5.3 OS=Arabidopsis thaliana GN=AIR3 PE=2 SV=1 61 312 8.0E-07
sp|Q14703|MBTP1_HUMAN Membrane-bound transcription factor site-1 protease OS=Homo sapiens GN=MBTPS1 PE=1 SV=1 152 359 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0004175 endopeptidase activity No
GO:0071704 organic substance metabolic process No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0008236 serine-type peptidase activity No
GO:0003674 molecular_function No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0017171 serine hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6950
MVAANRRPQPAAQDGIPIKGKYLIALKPGRKSVDLESHIGWVEGVHKRGLSAHQFRGVERTYSGHFQGYAGHFDA
DTISEIRRNPDVAMVEEDKIWELALLQPEAEEERREEGGDKSMLLHRRTLTTQTNCSWGLGAISHRQQGASDYVY
NGKAGEGTYAYIVDSGIRLSHREFEGRAEFAYTAFEEEKTDTFGHGTHVAGTIGGRTFGVAKKAKLLSVKVFQGR
RSATSVILAGFNWAANDIIQKRRTRSAVINMSLGGSYSNLFNLAVETAAGSGVVAIVAAGNEAVDAADVSPASAP
SAVTVAALSREYTMADYSNYGRVVDIFGPGSKITSAWIGNDTDTNTISGTSMATPHVVGIALSAMSVDGVVELGD
LTDWLKESATSGAIEGDLKESPNLLVNNNIDGSWN*
Coding >Hirsu2|6950
ATGGTCGCGGCGAATAGGCGCCCTCAGCCCGCCGCACAAGACGGAATCCCCATCAAGGGCAAGTATCTCATTGCC
CTCAAGCCTGGCCGGAAATCCGTCGACCTCGAGTCCCACATCGGCTGGGTCGAGGGTGTCCACAAGCGCGGCCTC
AGCGCCCATCAGTTCCGGGGGGTCGAGAGGACATACTCGGGCCACTTCCAGGGCTACGCGGGTCACTTCGATGCA
GACACCATCTCCGAGATTCGACGGAATCCAGACGTCGCGATGGTCGAGGAGGATAAGATTTGGGAGCTGGCCCTA
CTTCAGCCAGAGGCGGAGGAGGAGAGGCGGGAAGAAGGCGGCGACAAGAGCATGCTCCTCCACAGGAGGACGCTG
ACGACGCAGACGAACTGCAGCTGGGGCCTGGGGGCCATCAGCCACCGCCAGCAGGGCGCCAGCGACTACGTGTAC
AACGGAAAGGCGGGCGAGGGCACGTACGCCTACATCGTCGACAGCGGAATCCGGCTCAGCCACCGCGAGTTCGAG
GGCCGGGCTGAATTCGCCTACACGGCCTTCGAGGAGGAGAAGACGGACACGTTCGGGCACGGGACGCACGTTGCC
GGCACCATCGGCGGCCGGACGTTCGGCGTCGCCAAGAAGGCCAAGCTGCTGTCCGTCAAGGTGTTCCAGGGCCGG
CGGTCGGCAACGTCGGTCATCCTGGCCGGTTTCAACTGGGCGGCCAACGACATCATCCAGAAGCGGCGGACGCGG
TCGGCCGTCATCAACATGTCCCTCGGCGGCTCCTACTCCAACCTGTTCAACCTGGCGGTCGAGACGGCGGCCGGG
TCGGGCGTGGTGGCCATCGTGGCCGCCGGCAACGAGGCCGTCGACGCGGCCGACGTGTCGCCGGCCTCGGCGCCC
AGCGCCGTCACCGTCGCCGCCCTGAGCCGCGAGTACACCATGGCCGACTACTCCAACTACGGCCGCGTCGTCGAC
ATCTTCGGCCCGGGCTCCAAGATCACGTCGGCCTGGATTGGCAACGATACCGACACCAACACCATCTCCGGCACC
AGCATGGCCACCCCGCACGTCGTCGGCATCGCCCTCTCCGCCATGTCCGTCGACGGCGTCGTCGAGCTCGGCGAC
CTGACCGACTGGCTCAAGGAGAGCGCGACGAGCGGGGCCATCGAGGGCGACCTGAAGGAATCGCCGAACCTGCTC
GTCAACAACAACATTGACGGTTCGTGGAACTGA
Transcript >Hirsu2|6950
ATGGTCGCGGCGAATAGGCGCCCTCAGCCCGCCGCACAAGACGGAATCCCCATCAAGGGCAAGTATCTCATTGCC
CTCAAGCCTGGCCGGAAATCCGTCGACCTCGAGTCCCACATCGGCTGGGTCGAGGGTGTCCACAAGCGCGGCCTC
AGCGCCCATCAGTTCCGGGGGGTCGAGAGGACATACTCGGGCCACTTCCAGGGCTACGCGGGTCACTTCGATGCA
GACACCATCTCCGAGATTCGACGGAATCCAGACGTCGCGATGGTCGAGGAGGATAAGATTTGGGAGCTGGCCCTA
CTTCAGCCAGAGGCGGAGGAGGAGAGGCGGGAAGAAGGCGGCGACAAGAGCATGCTCCTCCACAGGAGGACGCTG
ACGACGCAGACGAACTGCAGCTGGGGCCTGGGGGCCATCAGCCACCGCCAGCAGGGCGCCAGCGACTACGTGTAC
AACGGAAAGGCGGGCGAGGGCACGTACGCCTACATCGTCGACAGCGGAATCCGGCTCAGCCACCGCGAGTTCGAG
GGCCGGGCTGAATTCGCCTACACGGCCTTCGAGGAGGAGAAGACGGACACGTTCGGGCACGGGACGCACGTTGCC
GGCACCATCGGCGGCCGGACGTTCGGCGTCGCCAAGAAGGCCAAGCTGCTGTCCGTCAAGGTGTTCCAGGGCCGG
CGGTCGGCAACGTCGGTCATCCTGGCCGGTTTCAACTGGGCGGCCAACGACATCATCCAGAAGCGGCGGACGCGG
TCGGCCGTCATCAACATGTCCCTCGGCGGCTCCTACTCCAACCTGTTCAACCTGGCGGTCGAGACGGCGGCCGGG
TCGGGCGTGGTGGCCATCGTGGCCGCCGGCAACGAGGCCGTCGACGCGGCCGACGTGTCGCCGGCCTCGGCGCCC
AGCGCCGTCACCGTCGCCGCCCTGAGCCGCGAGTACACCATGGCCGACTACTCCAACTACGGCCGCGTCGTCGAC
ATCTTCGGCCCGGGCTCCAAGATCACGTCGGCCTGGATTGGCAACGATACCGACACCAACACCATCTCCGGCACC
AGCATGGCCACCCCGCACGTCGTCGGCATCGCCCTCTCCGCCATGTCCGTCGACGGCGTCGTCGAGCTCGGCGAC
CTGACCGACTGGCTCAAGGAGAGCGCGACGAGCGGGGCCATCGAGGGCGACCTGAAGGAATCGCCGAACCTGCTC
GTCAACAACAACATTGACGGTTCGTGGAACTGA
Gene >Hirsu2|6950
ATGGTCGCGGCGAATAGGCGCCCTCAGCCCGCCGCACAAGACGGAATCCCCATCAAGGGCAAGTATCTCATTGCC
CTCAAGCCTGGCCGGAAATCCGTCGACCTCGAGTCCCACATCGGCTGGGTCGAGGGTGTCCACAAGCGCGGCCTC
AGCGCCCATCAGTTCCGGGGGGTCGAGAGGACATACTCGGGCCACTTCCAGGGCTACGCGGGTCACTTCGATGCA
GACACCATCTCCGAGATTCGACGGAATCCAGACGTGAGTGAGCCCCCGGCGCCCTGATAGTCACAATGATGGAAG
CAAACGGTCTGACATTGTTCGGCCCACAGGTCGCGATGGTCGAGGAGGATAAGATTTGGGAGCTGGCCCTACTTC
AGCCAGAGGCGGAGGAGGAGAGGCGGGAAGAAGGCGGCGACAAGAGCATGCTCCTCCACAGGAGGACGCTGACGA
CGCAGACGAACTGCAGCTGGGGCCTGGGGGCCATCAGCCACCGCCAGCAGGGCGCCAGCGACTACGTGTACAACG
GAAAGGCGGGCGAGGGCACGTACGCCTACATCGTCGACAGCGGAATCCGGCTCAGCCACCGCGAGTTCGAGGGCC
GGGCTGAATTCGCCTACACGGCCTTCGAGGAGGAGAAGACGGACACGTTCGGGCACGGGACGCACGTTGCCGGCA
CCATCGGCGGCCGGACGTTCGGCGTCGCCAAGAAGGCCAAGCTGCTGTCCGTCAAGGTGTTCCAGGGCCGGCGGT
CGGCAACGTCGGTCATCCTGGCCGGTTTCAACTGGGCGGCCAACGACATCATCCAGAAGCGGCGGACGCGGTCGG
CCGTCATCAACATGTCCCTCGGCGGCTCCTACTCCAACCTGTTCAACCTGGCGGTCGAGACGGCGGCCGGGTCGG
GCGTGGTGGCCATCGTGGCCGCCGGCAACGAGGCCGTCGACGCGGCCGACGTGTCGCCGGCCTCGGCGCCCAGCG
CCGTCACCGTCGCCGCCCTGAGCCGCGAGTACACCATGGCCGACTACTCCAACTACGGCCGCGTCGTCGACATCT
TCGGCCCGGGCTCCAAGATCACGTCGGCCTGGATTGGCAACGATACCGACACCAACACCATCTCCGGCACCAGCA
TGGCCACCCCGCACGTCGTCGGCATCGCCCTCTCCGCCATGTCCGTCGACGGCGTCGTCGAGCTCGGCGACCTGA
CCGACTGGCTCAAGGAGAGCGCGACGAGCGGGGCCATCGAGGGCGACCTGAAGGAATCGCCGAACCTGCTCGTCA
ACAACAACATTGACGGTTCGTGGAACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail