Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6939
Gene name
LocationContig_379:9334..11285
Strand+
Gene length (bp)1951
Transcript length (bp)831
Coding sequence length (bp)831
Protein length (aa) 277

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01929 Ribosomal_L14e Ribosomal protein L14 4.9E-29 187 262

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36105|RL14A_YEAST 60S ribosomal protein L14-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL14A PE=1 SV=1 132 271 8.0E-39
sp|P38754|RL14B_YEAST 60S ribosomal protein L14-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL14B PE=1 SV=1 132 271 2.0E-38
sp|O94238|RL14_SCHPO 60S ribosomal protein L14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl14 PE=2 SV=1 141 271 5.0E-28
sp|Q9CR57|RL14_MOUSE 60S ribosomal protein L14 OS=Mus musculus GN=Rpl14 PE=1 SV=3 141 261 1.0E-24
sp|Q63507|RL14_RAT 60S ribosomal protein L14 OS=Rattus norvegicus GN=Rpl14 PE=1 SV=3 141 261 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36105|RL14A_YEAST 60S ribosomal protein L14-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL14A PE=1 SV=1 132 271 8.0E-39
sp|P38754|RL14B_YEAST 60S ribosomal protein L14-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL14B PE=1 SV=1 132 271 2.0E-38
sp|O94238|RL14_SCHPO 60S ribosomal protein L14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl14 PE=2 SV=1 141 271 5.0E-28
sp|Q9CR57|RL14_MOUSE 60S ribosomal protein L14 OS=Mus musculus GN=Rpl14 PE=1 SV=3 141 261 1.0E-24
sp|Q63507|RL14_RAT 60S ribosomal protein L14 OS=Rattus norvegicus GN=Rpl14 PE=1 SV=3 141 261 2.0E-24
sp|Q3T0U2|RL14_BOVIN 60S ribosomal protein L14 OS=Bos taurus GN=RPL14 PE=2 SV=3 141 261 1.0E-23
sp|A1XQU3|RL14_PIG 60S ribosomal protein L14 OS=Sus scrofa GN=RPL14 PE=1 SV=1 141 261 2.0E-23
sp|P50914|RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens GN=RPL14 PE=1 SV=4 141 261 3.0E-23
sp|O46160|RL14_LUMRU 60S ribosomal protein L14 OS=Lumbricus rubellus GN=RPL14 PE=3 SV=1 141 261 6.0E-17
sp|P55841|RL14_DROME 60S ribosomal protein L14 OS=Drosophila melanogaster GN=RpL14 PE=1 SV=1 141 261 9.0E-17
sp|Q95ZE8|RL14_DROVI 60S ribosomal protein L14 OS=Drosophila virilis GN=RpL14 PE=3 SV=1 141 261 2.0E-16
sp|Q24C27|RL14_TETTS 60S ribosomal protein L14 OS=Tetrahymena thermophila (strain SB210) GN=RPL14 PE=1 SV=2 141 260 2.0E-15
sp|Q7XYA7|RL14_GRIJA 60S ribosomal protein L14 OS=Griffithsia japonica GN=RPL14 PE=2 SV=1 141 274 3.0E-15
sp|Q9SIM4|RL141_ARATH 60S ribosomal protein L14-1 OS=Arabidopsis thaliana GN=RPL14A PE=2 SV=1 141 273 8.0E-15
sp|Q9T043|RL142_ARATH 60S ribosomal protein L14-2 OS=Arabidopsis thaliana GN=RPL14B PE=2 SV=1 141 273 9.0E-15
sp|P55844|RL14_PEA Probable 60S ribosomal protein L14 OS=Pisum sativum PE=2 SV=1 141 276 2.0E-13
sp|Q54Z09|RL14_DICDI 60S ribosomal protein L14 OS=Dictyostelium discoideum GN=rpl14 PE=3 SV=1 142 253 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006412 translation Yes
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0034645 cellular macromolecule biosynthetic process No
GO:0008150 biological_process No
GO:0043228 non-membrane-bounded organelle No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043226 organelle No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0019538 protein metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043229 intracellular organelle No
GO:0044260 cellular macromolecule metabolic process No
GO:0009987 cellular process No
GO:0043043 peptide biosynthetic process No
GO:0005198 structural molecule activity No
GO:0006807 nitrogen compound metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0044238 primary metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0005575 cellular_component No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0043604 amide biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6327 0.3148 0.0285 0.0256 0.3809 0.018 0.1587 0.0191 0.0087 0.0064

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3598
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6620
Ophiocordyceps australis map64 (Brazil) OphauB2|3098
Ophiocordyceps camponoti-floridani Ophcf2|00821
Ophiocordyceps camponoti-rufipedis Ophun1|3895
Ophiocordyceps kimflemingae Ophio5|599
Ophiocordyceps subramaniannii Hirsu2|6939 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6939
MSGNSSVGTRSLYEAGDQRNVKRSEMETAERFEEGKPGSHLANDSKDQRSIANRLAAEERKSEPSDDKETAMSKK
DPTLPARAHGNEPSKGAKIDAEIQAEEEEMLRRKDSTQLRSDNTPSTNGQTSVTMGEALIEGSNWRLVEVGRVVL
IEGDHPFAGCLATIVEIVDHKRVLVDGPSSDRELAVPRQSVPLSKCLLSQFTIEGLLRGSRHGTVKKLWEKAEID
AKWKASNWAKKRDQIKRRKNLTDFDRFKVMRLKKQRRFEERKALAKIKAAA*
Coding >Hirsu2|6939
ATGTCCGGAAACTCGAGCGTGGGAACCCGAAGCCTGTACGAGGCTGGCGACCAGCGCAACGTGAAGCGGTCGGAA
ATGGAAACCGCCGAGCGATTCGAAGAGGGAAAGCCTGGCTCGCATCTGGCCAATGACTCCAAGGATCAGAGGTCA
ATCGCGAACCGGTTGGCGGCTGAAGAGCGCAAATCGGAACCAAGTGACGACAAGGAGACTGCCATGTCCAAGAAA
GATCCGACCCTGCCGGCCAGGGCTCACGGTAACGAGCCATCGAAAGGAGCGAAGATCGATGCCGAGATCCAGGCT
GAAGAGGAGGAGATGCTGAGGCGAAAGGACAGCACCCAACTCCGGAGCGACAACACGCCTTCGACTAACGGGCAG
ACCAGCGTCACAATGGGCGAAGCACTGATCGAGGGATCCAACTGGCGCCTCGTCGAGGTCGGCCGTGTCGTCCTC
ATCGAGGGCGACCACCCCTTCGCCGGCTGCCTGGCCACGATTGTCGAGATCGTCGACCACAAGCGGGTTCTCGTC
GACGGCCCCTCCTCAGACCGCGAGCTGGCCGTGCCCCGGCAATCCGTTCCCCTGTCCAAGTGCCTCCTGTCTCAG
TTCACCATCGAGGGCCTGCTTCGCGGCTCTCGCCACGGCACCGTCAAGAAGCTCTGGGAAAAGGCCGAGATCGAC
GCCAAGTGGAAGGCGAGCAACTGGGCCAAGAAGCGGGATCAGATCAAGCGACGGAAGAACCTGACCGACTTCGAC
CGCTTCAAGGTCATGCGACTCAAGAAGCAGCGACGATTCGAGGAGCGCAAGGCTCTGGCCAAGATCAAGGCCGCG
GCATAA
Transcript >Hirsu2|6939
ATGTCCGGAAACTCGAGCGTGGGAACCCGAAGCCTGTACGAGGCTGGCGACCAGCGCAACGTGAAGCGGTCGGAA
ATGGAAACCGCCGAGCGATTCGAAGAGGGAAAGCCTGGCTCGCATCTGGCCAATGACTCCAAGGATCAGAGGTCA
ATCGCGAACCGGTTGGCGGCTGAAGAGCGCAAATCGGAACCAAGTGACGACAAGGAGACTGCCATGTCCAAGAAA
GATCCGACCCTGCCGGCCAGGGCTCACGGTAACGAGCCATCGAAAGGAGCGAAGATCGATGCCGAGATCCAGGCT
GAAGAGGAGGAGATGCTGAGGCGAAAGGACAGCACCCAACTCCGGAGCGACAACACGCCTTCGACTAACGGGCAG
ACCAGCGTCACAATGGGCGAAGCACTGATCGAGGGATCCAACTGGCGCCTCGTCGAGGTCGGCCGTGTCGTCCTC
ATCGAGGGCGACCACCCCTTCGCCGGCTGCCTGGCCACGATTGTCGAGATCGTCGACCACAAGCGGGTTCTCGTC
GACGGCCCCTCCTCAGACCGCGAGCTGGCCGTGCCCCGGCAATCCGTTCCCCTGTCCAAGTGCCTCCTGTCTCAG
TTCACCATCGAGGGCCTGCTTCGCGGCTCTCGCCACGGCACCGTCAAGAAGCTCTGGGAAAAGGCCGAGATCGAC
GCCAAGTGGAAGGCGAGCAACTGGGCCAAGAAGCGGGATCAGATCAAGCGACGGAAGAACCTGACCGACTTCGAC
CGCTTCAAGGTCATGCGACTCAAGAAGCAGCGACGATTCGAGGAGCGCAAGGCTCTGGCCAAGATCAAGGCCGCG
GCATAA
Gene >Hirsu2|6939
ATGTCCGGAAACTCGAGCGTGGGAACCCGAAGCCTGTACGAGGCTGGCGACCAGCGCAACGTGAAGCGGTCGGAA
ATGGAAACCGCCGAGCGATTCGAAGAGGGAAAGCCTGGCTCGCATCTGGCCAATGACTCCAGTAAGAGCGACTCT
CACTGCTGCACAGACGAGCGGCCAAGACTAACGACGCGCCAGAGGATCAGAGGTCAATCGCGAACCGGTTGGCGG
CTGAAGAGGTGTGCTATGCCCTTCACTCAATTGTTCACGGAGTCGACAGGCTGACCCGGCCCGTAGCGCAAATCG
GAACCAAGTGACGACAAGGAGACTGCCATGTCCAAGAAAGATCCGACCCTGCCGGTCAGTCTTGGCCGCCCTCAG
CTGTCACTTATTCCCAAAGCTAACACCGCCACAGGCCAGGGCTCACGGTAACGAGCCATCGAAAGGAGCGAAGAT
CGATGCCGAGATCCAGGCTGAAGAGGAGGAGATGCTGAGGCGAAAGGGTAAAGCTTGAACATCAAATGGCGAGGC
AACGGCGTTATTGGTAGACACGAACGGCTGAATTCATATGAAATTTGCATATATTTTCAACGGCAAGCATGTGCA
GTATATAAGCTACCCGCTGTGAGAAGTCTATGATGTGATACAGCCTCGAATAGAACGTTTGAACATGCCAGTGCG
AGATGCGGCGCGCGAGCCTCGAAGGGTATGCAGGACCTGAACACGACCGGAAATATCTCTGATGAGAACTATCCG
AGAAGACCATCGGACGCACCAGTGCCTAGTTGCCCAGTCAGTGTGAGCCCTGAACGGCAAGTCTGTTGTGTGGAC
GAAAGGAGTGGGAGCGTAGCAAGAAAAATCAGAATATGTAAGAATTGAATATCAAGTTACAACACGATATAACTA
CTCCGGCGAAAGAGAGTCATCGGGAGGAATCAATCGCAAATTAACCTCATCACAAGGTCTTGCGTTTGGATGAAA
AGAAGGGAAAGTCGGTATGGCTTACCTCTGCCGATGGCTTTGCTCGGTACGCCTCCAACGCGAACCGGTGCACGG
CGGTTGACGAGGCAAGGAAACATGAGGGAAGAAGGAATGAAAAAAAAAAAAAAAGTTGCGCTGGGATGAATGAAG
AAAGCTAGCCGTCTGACCCGTGTGCCAGCAGCTTCTTGGCGCGCGGGCGGCGGGTCGGCGAAATGGATTTTCCGA
CAATTTTGCTTAGGGCAAAGGGCGAATTTCAGCCCGCACACTCGAGTAGCCGAGCGAACAAAAAGTCTAGGCGAC
TCGTCGGTGACAACATCCGCAGACAGCACCCAACTCCGGAGCGACAACACGCCTTCGACTAACGGTACGTCGGCC
CCTTACGACTGGCGGCGGACTCGCGCGAAGCCTTCGCCTCTCGACACGAATCGAACTGACAAAGGGGCGCACAGG
GCAGACCAGCGTCACAATGGGCGAAGCACTGATCGAGGGATCCAACTGGCGCCTCGTCGAGGTCGGCCGTGTCGT
CCTCATCGAGGGCGACCACCCCTTCGCCGGCTGCCTGGCCACGATTGTCGAGATCGTCGACCACAAGCGGGTACG
TTGACGCGCACCGCATCCGAGCCGTACCCCGATCGAGCCCCAAATAACGCGTCCGTCGCAGGTTCTCGTCGACGG
CCCCTCCTCAGACCGCGAGCTGGCCGTGCCCCGGCAATCCGTTCCCCTGTCCAAGTGCCTCCTGTCTCAGTTCAC
CATCGAGGGCCTGCTTCGCGGCTCTCGCCACGGCACCGTCAAGAAGCTCTGGGAAAAGGCCGAGATCGACGCCAA
GTGGAAGGCGAGCAACTGGGCCAAGAAGCGGGATCAGATCAAGCGACGGAAGAACCTGACCGACTTCGACCGCTT
CAAGGTCATGCGACTCAAGAAGCAGCGACGATTCGAGGAGCGCAAGGCTCTGGCCAAGATCAAGGCCGCGGCATA
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail