Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6937
Gene name
LocationContig_379:3525..5719
Strand+
Gene length (bp)2194
Transcript length (bp)2046
Coding sequence length (bp)2046
Protein length (aa) 682

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 1.5E-27 11 157

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 12 155 3.0E-15
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 12 155 5.0E-15
sp|P01555|CHTA_VIBCH Cholera enterotoxin subunit A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ctxA PE=1 SV=1 12 151 8.0E-14
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 12 151 1.0E-13
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 12 151 1.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 12 155 3.0E-15
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 12 155 5.0E-15
sp|P01555|CHTA_VIBCH Cholera enterotoxin subunit A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ctxA PE=1 SV=1 12 151 8.0E-14
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 12 151 1.0E-13
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 12 151 1.0E-13
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 12 164 2.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2339 0.1816 0.5471 0.1257 0.6447 0.2122 0.132 0.0963 0.3061 0.1687

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup319
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|2443
Ophiocordyceps australis map64 (Brazil) OphauB2|5230
Ophiocordyceps australis map64 (Brazil) OphauB2|5625
Ophiocordyceps camponoti-rufipedis Ophun1|2420
Ophiocordyceps kimflemingae Ophio5|5926
Ophiocordyceps subramaniannii Hirsu2|2503
Ophiocordyceps subramaniannii Hirsu2|5702
Ophiocordyceps subramaniannii Hirsu2|6937 (this protein)
Ophiocordyceps subramaniannii Hirsu2|775
Ophiocordyceps subramaniannii Hirsu2|9312

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6937
MKVVTNERNGFSLYNHAGAGKKTEFVTHPATVYVPTTIRKGIAQEMLQSKPGYIYTIHATPNFIDLTQSLGGIRY
NPEAAEREFSALGGIRWDQVVGWNEMPQGQSTPASKAKFVRNKDYNPKYDLYIASPAQPQLAGFPKNHEAWTKEP
WRAFSEANGGKSLQEHGLKFMATNGEAVGWTGRPPLFVSPRKVGGSIFYEPLPVKAETLPPCKRDGLNCVNKRPS
QPKPGKGGENAAGDGAAVAKQRIAASVEQASAKEFAELSLRYQLKSFVETRFRQPLRSFRADKLQYRPVTSSRRR
LLGKSPSLAETALKSAGKSFKVLGAGLYVHGVVEAFADHVKTVDRVAALTAIVPVVGCVASLATDLSRDKVDALN
VVDDALCLVGDALLFTPLAPVGVAIHLVRLIMGLARGIVDYFSGPDPEMLRQVKAARDEPWNIFLRDHLYETLSS
KEFGARLGSALAVESLACISEGAETIGILQASQQEATQLTNETVEKGQLRDYFQAAVEHVRRRVSVEIVERQRQV
LIDLVNNVRDQHEEASLRALADQYNESFIEDRLAGADEEIIKYIRNERPPLPNRFAIAYLVGQSIGQDAELPTLS
PPDVEQALSSSAEPAQALEPVGGSDNIDWKIHPLTLSLTDYLQKKQEGISKEDADAISAQQIRAVMQLLDGKHKS
FSFWLR*
Coding >Hirsu2|6937
ATGAAGGTGGTAACCAACGAGCGGAACGGATTCAGCCTATACAACCACGCCGGCGCGGGCAAGAAGACCGAGTTC
GTAACCCATCCGGCAACCGTGTACGTCCCGACGACGATCCGGAAGGGCATTGCCCAGGAGATGCTCCAAAGTAAG
CCGGGATACATCTACACCATCCACGCGACGCCAAACTTCATCGACCTCACGCAAAGCCTCGGAGGGATCAGGTAC
AACCCAGAGGCGGCAGAGCGCGAGTTTTCGGCCCTCGGCGGCATCCGCTGGGATCAGGTGGTAGGCTGGAACGAG
ATGCCTCAGGGGCAGTCCACGCCCGCGTCCAAGGCCAAGTTCGTCAGGAACAAGGACTACAACCCAAAGTACGAT
TTATATATAGCCAGCCCGGCGCAGCCACAGCTCGCCGGCTTCCCTAAGAATCACGAGGCCTGGACCAAGGAGCCG
TGGAGGGCCTTCAGCGAAGCCAACGGGGGCAAGTCGCTGCAGGAGCACGGCCTAAAGTTTATGGCGACGAACGGC
GAGGCCGTGGGCTGGACCGGTCGTCCTCCCTTGTTCGTCTCACCTCGCAAAGTAGGTGGCAGCATCTTCTACGAG
CCCCTGCCTGTCAAGGCGGAGACCCTGCCGCCCTGCAAGAGAGACGGCCTCAATTGCGTCAATAAACGCCCCTCG
CAGCCGAAGCCCGGCAAGGGGGGCGAGAATGCGGCGGGGGATGGAGCCGCCGTGGCCAAACAGCGCATCGCGGCC
TCGGTCGAGCAGGCATCGGCAAAGGAGTTTGCCGAGCTCTCGTTGCGATACCAGCTCAAGTCGTTCGTCGAAACG
AGGTTCCGGCAGCCGCTTCGATCGTTCCGCGCCGACAAGCTCCAATACCGGCCCGTCACATCTTCCAGACGGCGC
CTCTTGGGCAAGTCCCCGTCGTTGGCCGAGACGGCGCTCAAGTCGGCGGGCAAATCGTTCAAGGTCCTTGGCGCG
GGCCTCTATGTCCACGGCGTGGTCGAGGCCTTTGCGGATCACGTCAAGACCGTGGACCGTGTCGCGGCGCTGACC
GCCATCGTGCCCGTCGTGGGCTGCGTCGCCTCGCTGGCGACGGACCTGTCCAGGGACAAGGTCGACGCGCTCAAC
GTGGTCGACGATGCCCTGTGCCTGGTCGGCGACGCGCTGCTGTTCACGCCCCTAGCCCCTGTCGGGGTCGCGATA
CACCTCGTCCGCTTGATCATGGGCTTGGCCAGAGGCATCGTCGACTACTTCTCGGGGCCGGATCCGGAGATGCTG
AGGCAGGTCAAGGCTGCCCGCGACGAGCCGTGGAACATTTTCCTGCGGGACCACCTGTACGAGACCCTGTCTTCG
AAGGAATTCGGCGCCAGGCTGGGCAGCGCTCTCGCCGTCGAGTCCTTGGCCTGCATCTCCGAGGGCGCGGAGACG
ATCGGCATCTTGCAGGCGAGCCAGCAGGAAGCCACGCAGCTCACTAACGAGACTGTGGAGAAGGGCCAACTGCGA
GATTACTTCCAGGCCGCGGTAGAGCATGTCCGAAGAAGAGTGTCCGTTGAGATAGTAGAGAGGCAACGGCAAGTC
CTCATCGATCTTGTCAACAACGTCCGGGACCAGCATGAGGAGGCCTCGTTACGGGCACTGGCCGACCAGTACAAC
GAAAGCTTCATCGAGGACAGACTGGCGGGTGCCGACGAGGAAATCATAAAGTACATACGTAACGAGAGGCCGCCG
CTGCCTAACCGCTTCGCCATCGCCTATCTTGTCGGACAGTCAATAGGGCAGGACGCGGAGCTACCGACGCTATCC
CCGCCCGATGTCGAGCAGGCGCTCTCGTCCTCCGCGGAGCCGGCCCAAGCCTTGGAGCCGGTGGGGGGGAGTGAC
AATATCGACTGGAAGATCCACCCCCTAACATTGAGCCTGACCGATTACTTGCAAAAGAAGCAAGAGGGGATATCC
AAAGAAGACGCCGATGCTATCAGCGCCCAGCAGATCCGAGCTGTTATGCAGCTCCTTGACGGTAAACACAAGAGT
TTCAGCTTCTGGTTGCGATGA
Transcript >Hirsu2|6937
ATGAAGGTGGTAACCAACGAGCGGAACGGATTCAGCCTATACAACCACGCCGGCGCGGGCAAGAAGACCGAGTTC
GTAACCCATCCGGCAACCGTGTACGTCCCGACGACGATCCGGAAGGGCATTGCCCAGGAGATGCTCCAAAGTAAG
CCGGGATACATCTACACCATCCACGCGACGCCAAACTTCATCGACCTCACGCAAAGCCTCGGAGGGATCAGGTAC
AACCCAGAGGCGGCAGAGCGCGAGTTTTCGGCCCTCGGCGGCATCCGCTGGGATCAGGTGGTAGGCTGGAACGAG
ATGCCTCAGGGGCAGTCCACGCCCGCGTCCAAGGCCAAGTTCGTCAGGAACAAGGACTACAACCCAAAGTACGAT
TTATATATAGCCAGCCCGGCGCAGCCACAGCTCGCCGGCTTCCCTAAGAATCACGAGGCCTGGACCAAGGAGCCG
TGGAGGGCCTTCAGCGAAGCCAACGGGGGCAAGTCGCTGCAGGAGCACGGCCTAAAGTTTATGGCGACGAACGGC
GAGGCCGTGGGCTGGACCGGTCGTCCTCCCTTGTTCGTCTCACCTCGCAAAGTAGGTGGCAGCATCTTCTACGAG
CCCCTGCCTGTCAAGGCGGAGACCCTGCCGCCCTGCAAGAGAGACGGCCTCAATTGCGTCAATAAACGCCCCTCG
CAGCCGAAGCCCGGCAAGGGGGGCGAGAATGCGGCGGGGGATGGAGCCGCCGTGGCCAAACAGCGCATCGCGGCC
TCGGTCGAGCAGGCATCGGCAAAGGAGTTTGCCGAGCTCTCGTTGCGATACCAGCTCAAGTCGTTCGTCGAAACG
AGGTTCCGGCAGCCGCTTCGATCGTTCCGCGCCGACAAGCTCCAATACCGGCCCGTCACATCTTCCAGACGGCGC
CTCTTGGGCAAGTCCCCGTCGTTGGCCGAGACGGCGCTCAAGTCGGCGGGCAAATCGTTCAAGGTCCTTGGCGCG
GGCCTCTATGTCCACGGCGTGGTCGAGGCCTTTGCGGATCACGTCAAGACCGTGGACCGTGTCGCGGCGCTGACC
GCCATCGTGCCCGTCGTGGGCTGCGTCGCCTCGCTGGCGACGGACCTGTCCAGGGACAAGGTCGACGCGCTCAAC
GTGGTCGACGATGCCCTGTGCCTGGTCGGCGACGCGCTGCTGTTCACGCCCCTAGCCCCTGTCGGGGTCGCGATA
CACCTCGTCCGCTTGATCATGGGCTTGGCCAGAGGCATCGTCGACTACTTCTCGGGGCCGGATCCGGAGATGCTG
AGGCAGGTCAAGGCTGCCCGCGACGAGCCGTGGAACATTTTCCTGCGGGACCACCTGTACGAGACCCTGTCTTCG
AAGGAATTCGGCGCCAGGCTGGGCAGCGCTCTCGCCGTCGAGTCCTTGGCCTGCATCTCCGAGGGCGCGGAGACG
ATCGGCATCTTGCAGGCGAGCCAGCAGGAAGCCACGCAGCTCACTAACGAGACTGTGGAGAAGGGCCAACTGCGA
GATTACTTCCAGGCCGCGGTAGAGCATGTCCGAAGAAGAGTGTCCGTTGAGATAGTAGAGAGGCAACGGCAAGTC
CTCATCGATCTTGTCAACAACGTCCGGGACCAGCATGAGGAGGCCTCGTTACGGGCACTGGCCGACCAGTACAAC
GAAAGCTTCATCGAGGACAGACTGGCGGGTGCCGACGAGGAAATCATAAAGTACATACGTAACGAGAGGCCGCCG
CTGCCTAACCGCTTCGCCATCGCCTATCTTGTCGGACAGTCAATAGGGCAGGACGCGGAGCTACCGACGCTATCC
CCGCCCGATGTCGAGCAGGCGCTCTCGTCCTCCGCGGAGCCGGCCCAAGCCTTGGAGCCGGTGGGGGGGAGTGAC
AATATCGACTGGAAGATCCACCCCCTAACATTGAGCCTGACCGATTACTTGCAAAAGAAGCAAGAGGGGATATCC
AAAGAAGACGCCGATGCTATCAGCGCCCAGCAGATCCGAGCTGTTATGCAGCTCCTTGACGGTAAACACAAGAGT
TTCAGCTTCTGGTTGCGATGA
Gene >Hirsu2|6937
ATGAAGGTGGTAACCAACGAGCGGAACGGATTCAGCCTATACAACCACGCCGGCGCGGGCAAGAAGACCGAGTTC
GTAACCCATCCGGCAACCGTGTACGTCCCGACGACGATCCGGAAGGGCATTGCCCAGGAGATGCTCCAAAGTAAG
CCGGGATACATCTACACCATCCACGCGACGCCAAACTTCATCGACCTCACGCAAAGCCTCGGAGGGATCAGGTAC
AACCCAGAGGCGGCAGAGCGCGAGTTTTCGGCCCTCGGCGGCATCCGCTGGGATCAGGTGGTAGGCTGGAACGAG
ATGCCTCAGGGGCAGTCCACGCCCGCGTCCAAGGCCAAGTTCGTCAGGAACAAGGACTACAACCCAAAGTACGAT
TTATATATAGCCAGCCCGGCGCAGCCACAGCTCGCCGGCTTCCCTAAGAATCACGAGGCCTGGACCAAGGAGCCG
TGGAGGGCCTTCAGCGAAGCCAACGGGGGCAAGTCGCTGCAGGAGCACGGCCTAAAGTTTATGGCGACGAACGGC
GAGGCCGTGGGCTGGACCGGTCGTCCTCCCTTGTTCGTCTCACCTCGCAAAGTAGGTGGCAGCATCTTCTACGAG
CCCCTGCCTGTCAAGGCGGAGACCCTGCCGCCCTGCAAGAGAGACGGCCTCAATTGCGTCAATAAACGCCCCTCG
CAGCCGAAGCCCGGCAAGGGGGGCGAGAATGCGGCGGGTAAGCCCCCTGGTCAGGGTGAAGCCGGTCCGGAGCCG
CCGTCGACGAAGAGCCAGCGTCCAAAAGGCGAACTGACTCCGCTCCATGGGCTGCCAGGGGATGGAGCCGCCGTG
GCCAAACAGCGCATCGCGGCCTCGGTCGAGCAGGCATCGGCAAAGGAGTTTGCCGAGCTCTCGTTGCGATACCAG
CTCAAGTCGTTCGTCGAAACGAGGTTCCGGCAGCCGCTTCGATCGTTCCGCGCCGACAAGCTCCAATACCGGCCC
GTCACATCTTCCAGACGGCGCCTCTTGGGCAAGTCCCCGTCGTTGGCCGAGACGGCGCTCAAGTCGGCGGGCAAA
TCGTTCAAGGTCCTTGGCGCGGGCCTCTATGTCCACGGCGTGGTCGAGGCCTTTGCGGATCACGTCAAGACCGTG
GACCGTGTCGCGGCGCTGACCGCCATCGTGCCCGTCGTGGGCTGCGTCGCCTCGCTGGCGACGGACCTGTCCAGG
GACAAGGTCGACGCGCTCAACGTGGTCGACGATGCCCTGTGCCTGGTCGGCGACGCGCTGCTGTTCACGCCCCTA
GCCCCTGTCGGGGTCGCGATACACCTCGTCCGCTTGATCATGGGCTTGGCCAGAGGCATCGTCGACTACTTCTCG
GGGCCGGATCCGGAGATGCTGAGGCAGGTCAAGGCTGCCCGCGACGAGCCGTGGAACATTTTCCTGCGGGACCAC
CTGTACGAGACCCTGTCTTCGAAGGAATTCGGCGCCAGGCTGGGCAGCGCTCTCGCCGTCGAGTCCTTGGCCTGC
ATCTCCGAGGGCGCGGAGACGATCGGCATCTTGCAGGCGAGCCAGCAGGAAGCCACGCAGCTCACTAACGAGACT
GTGGAGAAGGGCCAACTGCGAGATTACTTCCAGGCCGCGGTAGAGCATGTCCGAAGAAGAGTGTCCGTTGAGATA
GTAGAGAGGCAACGGCAAGTCCTCATCGATCTTGTCAACAACGTCCGGGACCAGCATGAGGAGGCCTCGTTACGG
GCACTGGCCGACCAGTACAACGAAAGCTTCATCGAGGACAGACTGGCGGGTGCCGACGAGGAAATCATAAAGTAC
ATACGTAACGAGAGGCCGCCGCTGCCTAACCGCTTCGCCATCGCCTATCTTGTCGGACAGTCAATAGGGCAGGAC
GCGGAGCTACCGACGCTATCCCCGCCCGATGTCGAGCAGGCGCTCTCGTCCTCCGCGGAGCCGGCCCAAGCCTTG
GAGCCGGTGGGGGGGAGTGACAATATCGACTGGAAGATCCACCCCCTAACATTGAGCCTGACCGATTACTTGCAA
AAGAAGCAAGAGGGGATATCCAAAGAAGACGCCGATGCTATCAGCGCCCAGCAGATCCGAGCTGTTATGCAGCTC
CTTGACGGTAAAGTGGGTGAAGACCACGTTGCCAGAGCCTCGCCCAAGCTGGACTCCTCGATAGCACAAGAGTTT
CAGCTTCTGGTTGCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail