Protein ID | Hirsu2|6934 |
Gene name | |
Location | Contig_378:12714..13775 |
Strand | + |
Gene length (bp) | 1061 |
Transcript length (bp) | 1017 |
Coding sequence length (bp) | 1017 |
Protein length (aa) | 339 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00501 | AMP-binding | AMP-binding enzyme | 3.5E-32 | 11 | 154 |
PF00550 | PP-binding | Phosphopantetheine attachment site | 4.4E-05 | 294 | 330 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q4WR82|NRPS2_ASPFU | Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 | 1 | 330 | 7.0E-66 |
sp|Q9P7T1|SIB1_SCHPO | Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 | 1 | 331 | 2.0E-48 |
sp|O43103|SID2_USTMA | Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 | 1 | 336 | 9.0E-45 |
sp|Q4WZ44|NRPS7_ASPFU | Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 | 1 | 331 | 7.0E-37 |
sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 1 | 329 | 7.0E-35 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q4WR82|NRPS2_ASPFU | Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 | 1 | 330 | 7.0E-66 |
sp|Q9P7T1|SIB1_SCHPO | Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 | 1 | 331 | 2.0E-48 |
sp|O43103|SID2_USTMA | Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 | 1 | 336 | 9.0E-45 |
sp|Q4WZ44|NRPS7_ASPFU | Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 | 1 | 331 | 7.0E-37 |
sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 1 | 329 | 7.0E-35 |
sp|Q4WF61|NRPS3_ASPFU | Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 | 1 | 334 | 6.0E-34 |
sp|Q4WYG2|NRPS5_ASPFU | Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 | 2 | 330 | 2.0E-33 |
sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 1 | 301 | 6.0E-33 |
sp|P09095|TYCA_BREPA | Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 | 1 | 260 | 2.0E-32 |
sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 1 | 330 | 7.0E-32 |
sp|A1DA59|FTMA_NEOFI | Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 | 1 | 330 | 9.0E-32 |
sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 40 | 330 | 1.0E-31 |
sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 1 | 301 | 1.0E-30 |
sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 1 | 328 | 1.0E-30 |
sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 3 | 260 | 1.0E-30 |
sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 1 | 337 | 4.0E-30 |
sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 1 | 260 | 8.0E-30 |
sp|B9WZX0|FTMA_ASPFM | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 | 1 | 330 | 9.0E-30 |
sp|Q4WAW3|FTMA_ASPFU | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 | 1 | 330 | 9.0E-30 |
sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 12 | 267 | 9.0E-30 |
sp|P0C061|GRSA_ANEMI | Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 | 1 | 260 | 2.0E-29 |
sp|O43103|SID2_USTMA | Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 | 24 | 330 | 3.0E-29 |
sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 1 | 299 | 5.0E-29 |
sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 3 | 330 | 7.0E-29 |
sp|P0C062|GRSA_BREBE | Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 | 1 | 260 | 8.0E-29 |
sp|P39846|PPSB_BACSU | Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 | 13 | 260 | 8.0E-29 |
sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 1 | 330 | 3.0E-28 |
sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 1 | 330 | 4.0E-28 |
sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 37 | 260 | 6.0E-28 |
sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 1 | 299 | 6.0E-28 |
sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 37 | 330 | 8.0E-28 |
sp|Q9L9G0|NOVH_STRNV | Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 | 1 | 330 | 8.0E-28 |
sp|Q4WR82|NRPS2_ASPFU | Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 | 17 | 331 | 9.0E-28 |
sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 2 | 260 | 3.0E-27 |
sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 1 | 334 | 5.0E-27 |
sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 5 | 270 | 7.0E-27 |
sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 5 | 270 | 9.0E-27 |
sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 41 | 260 | 1.0E-26 |
sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 39 | 260 | 1.0E-26 |
sp|P45745|DHBF_BACSU | Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 | 2 | 260 | 1.0E-26 |
sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 39 | 260 | 2.0E-26 |
sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 16 | 260 | 3.0E-26 |
sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 1 | 260 | 5.0E-26 |
sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 13 | 260 | 8.0E-26 |
sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 1 | 260 | 8.0E-26 |
sp|O43103|SID2_USTMA | Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 | 16 | 337 | 9.0E-26 |
sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 17 | 260 | 1.0E-25 |
sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 13 | 261 | 1.0E-25 |
sp|P39846|PPSB_BACSU | Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 | 12 | 260 | 2.0E-25 |
sp|Q08787|SRFAC_BACSU | Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 | 41 | 269 | 2.0E-25 |
sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 16 | 260 | 3.0E-25 |
sp|Q4WMK2|NRPS9_ASPFU | Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 | 1 | 330 | 3.0E-25 |
sp|Q9R9I9|MYCC_BACIU | Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 | 16 | 260 | 3.0E-25 |
sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 2 | 336 | 3.0E-25 |
sp|Q4WR82|NRPS2_ASPFU | Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 | 2 | 330 | 5.0E-25 |
sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 1 | 328 | 6.0E-25 |
sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 40 | 260 | 6.0E-25 |
sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 2 | 336 | 6.0E-25 |
sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 1 | 256 | 1.0E-24 |
sp|Q70LM7|LGRA_BREPA | Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 | 6 | 265 | 1.0E-24 |
sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 17 | 260 | 1.0E-24 |
sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 9 | 260 | 2.0E-24 |
sp|Q4WLW8|NRP11_ASPFU | Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 | 1 | 330 | 2.0E-24 |
sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 17 | 260 | 3.0E-24 |
sp|Q4L4U5|DLTA_STAHJ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 | 2 | 260 | 3.0E-24 |
sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 1 | 330 | 5.0E-24 |
sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 14 | 260 | 7.0E-24 |
sp|P40806|PKSJ_BACSU | Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 | 24 | 263 | 8.0E-24 |
sp|Q70LM7|LGRA_BREPA | Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 | 12 | 260 | 1.0E-23 |
sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 1 | 330 | 1.0E-23 |
sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 13 | 260 | 1.0E-23 |
sp|O68007|BACB_BACLI | Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 | 41 | 260 | 2.0E-23 |
sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 16 | 260 | 4.0E-23 |
sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 13 | 260 | 4.0E-23 |
sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 38 | 260 | 4.0E-23 |
sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 38 | 260 | 4.0E-23 |
sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 1 | 330 | 6.0E-23 |
sp|B9WZX0|FTMA_ASPFM | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 | 1 | 260 | 6.0E-23 |
sp|Q4WAW3|FTMA_ASPFU | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 | 1 | 260 | 6.0E-23 |
sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 1 | 260 | 7.0E-23 |
sp|A1DA59|FTMA_NEOFI | Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 | 1 | 260 | 2.0E-22 |
sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 1 | 260 | 2.0E-22 |
sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 41 | 260 | 2.0E-22 |
sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 2 | 260 | 2.0E-22 |
sp|Q9R9J1|MYCA_BACIU | Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 | 9 | 260 | 2.0E-22 |
sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 43 | 260 | 3.0E-22 |
sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 16 | 256 | 4.0E-22 |
sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 1 | 260 | 4.0E-22 |
sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 17 | 260 | 6.0E-22 |
sp|Q4WYP0|NRPS6_ASPFU | Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 | 1 | 260 | 6.0E-22 |
sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 15 | 260 | 7.0E-22 |
sp|Q9P7T1|SIB1_SCHPO | Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 | 1 | 328 | 9.0E-22 |
sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 1 | 260 | 9.0E-22 |
sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 1 | 318 | 1.0E-21 |
sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 39 | 260 | 2.0E-21 |
sp|Q0VZ70|CHSAD_CHOCO | Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 | 17 | 260 | 2.0E-21 |
sp|Q4WF53|NRPS4_ASPFU | Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 | 1 | 330 | 2.0E-21 |
sp|Q4WF61|NRPS3_ASPFU | Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 | 17 | 329 | 3.0E-21 |
sp|P45745|DHBF_BACSU | Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 | 16 | 260 | 3.0E-21 |
sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 36 | 260 | 3.0E-21 |
sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 6 | 260 | 4.0E-21 |
sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 51 | 330 | 6.0E-21 |
sp|O31782|PKSN_BACSU | Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 | 10 | 260 | 9.0E-21 |
sp|Q8CT93|DLTA_STAES | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 | 2 | 264 | 1.0E-20 |
sp|A7ZA74|DLTA_BACMF | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 | 1 | 260 | 1.0E-20 |
sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 14 | 260 | 2.0E-20 |
sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 13 | 260 | 3.0E-20 |
sp|P39847|PPSC_BACSU | Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 | 14 | 260 | 3.0E-20 |
sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 1 | 260 | 4.0E-20 |
sp|Q5HQN0|DLTA_STAEQ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 | 2 | 264 | 4.0E-20 |
sp|Q9R9I9|MYCC_BACIU | Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 | 27 | 260 | 5.0E-20 |
sp|E2JA29|DDAD_ENTAG | Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 | 15 | 330 | 6.0E-20 |
sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 14 | 260 | 7.0E-20 |
sp|Q00869|ESYN_FUSEQ | Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 | 2 | 330 | 1.0E-19 |
sp|B7IN64|DLTA_BACC2 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 | 2 | 261 | 1.0E-19 |
sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 1 | 337 | 2.0E-19 |
sp|O68007|BACB_BACLI | Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 | 13 | 330 | 2.0E-19 |
sp|P39847|PPSC_BACSU | Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 | 6 | 260 | 2.0E-19 |
sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 2 | 256 | 2.0E-19 |
sp|Q81G39|DLTA_BACCR | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 | 2 | 261 | 2.0E-19 |
sp|B7HHC6|DLTA_BACC4 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 | 2 | 261 | 2.0E-19 |
sp|A7GMR0|DLTA_BACCN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 | 2 | 261 | 2.0E-19 |
sp|Q63E02|DLTA_BACCZ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 | 2 | 261 | 2.0E-19 |
sp|B9IUW2|DLTA_BACCQ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 | 2 | 261 | 2.0E-19 |
sp|Q73BD2|DLTA_BACC1 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 | 2 | 261 | 2.0E-19 |
sp|B7HK95|DLTA_BACC7 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 | 2 | 261 | 2.0E-19 |
sp|Q81T97|DLTA_BACAN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 | 2 | 261 | 2.0E-19 |
sp|C3LAH8|DLTA_BACAC | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 | 2 | 261 | 2.0E-19 |
sp|C3P4I7|DLTA_BACAA | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 | 2 | 261 | 2.0E-19 |
sp|Q6HLH7|DLTA_BACHK | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 | 2 | 261 | 2.0E-19 |
sp|C1EM80|DLTA_BACC3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 | 2 | 261 | 2.0E-19 |
sp|B7JFV5|DLTA_BACC0 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 | 2 | 261 | 2.0E-19 |
sp|A0RBJ0|DLTA_BACAH | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 | 2 | 261 | 2.0E-19 |
sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 9 | 260 | 3.0E-19 |
sp|P68878|DLTA_STAAW | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 | 2 | 264 | 3.0E-19 |
sp|A8Z1J1|DLTA_STAAT | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 | 2 | 264 | 3.0E-19 |
sp|Q6GAZ4|DLTA_STAAS | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 | 2 | 264 | 3.0E-19 |
sp|A6QFE3|DLTA_STAAE | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 | 2 | 264 | 3.0E-19 |
sp|Q5HHF2|DLTA_STAAC | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 | 2 | 264 | 3.0E-19 |
sp|Q2FZW6|DLTA_STAA8 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 | 2 | 264 | 3.0E-19 |
sp|Q2FIE3|DLTA_STAA3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 | 2 | 264 | 3.0E-19 |
sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 2 | 260 | 4.0E-19 |
sp|Q2YWQ8|DLTA_STAAB | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 | 2 | 264 | 4.0E-19 |
sp|Q6GIF6|DLTA_STAAR | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 | 2 | 264 | 5.0E-19 |
sp|Q65DH1|DLTA_BACLD | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 | 1 | 260 | 6.0E-19 |
sp|Q4WMJ7|NRP10_ASPFU | Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 | 1 | 262 | 7.0E-19 |
sp|P39845|PPSA_BACSU | Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 | 6 | 260 | 8.0E-19 |
sp|Q88VM6|DLTA_LACPL | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 | 41 | 261 | 8.0E-19 |
sp|P0C397|DLTA_STAAU | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 | 2 | 264 | 1.0E-18 |
sp|P99107|DLTA_STAAN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 | 2 | 264 | 1.0E-18 |
sp|P68876|DLTA_STAAM | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 | 2 | 264 | 1.0E-18 |
sp|A5IRB0|DLTA_STAA9 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 | 2 | 264 | 1.0E-18 |
sp|A6U039|DLTA_STAA2 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 | 2 | 264 | 1.0E-18 |
sp|A7X0D6|DLTA_STAA1 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 | 2 | 264 | 1.0E-18 |
sp|A9VKV6|DLTA_BACWK | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 | 2 | 261 | 1.0E-18 |
sp|Q4WAZ9|NRP14_ASPFU | Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 | 18 | 260 | 1.0E-18 |
sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 31 | 260 | 2.0E-18 |
sp|P39581|DLTA_BACSU | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 | 24 | 260 | 2.0E-18 |
sp|B3WC77|DLTA_LACCB | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 | 40 | 261 | 2.0E-18 |
sp|Q4WYG2|NRPS5_ASPFU | Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 | 1 | 261 | 3.0E-18 |
sp|Q03AZ2|DLTA_LACC3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 | 40 | 261 | 3.0E-18 |
sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 6 | 260 | 4.0E-18 |
sp|P35854|DLTA_LACRH | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 | 40 | 261 | 4.0E-18 |
sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 31 | 260 | 1.0E-17 |
sp|O31827|PPSE_BACSU | Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 | 14 | 260 | 1.0E-17 |
sp|Q48SZ3|DLTA_STRPM | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 | 2 | 262 | 1.0E-17 |
sp|A2RE45|DLTA_STRPG | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 | 2 | 262 | 1.0E-17 |
sp|Q1JGF0|DLTA_STRPD | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 | 2 | 262 | 1.0E-17 |
sp|Q8P0J9|DLTA_STRP8 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 | 2 | 262 | 1.0E-17 |
sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 17 | 260 | 2.0E-17 |
sp|B5XLX5|DLTA_STRPZ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 | 2 | 262 | 2.0E-17 |
sp|Q1J667|DLTA_STRPF | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 | 2 | 262 | 2.0E-17 |
sp|Q1JLB7|DLTA_STRPC | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 | 2 | 262 | 2.0E-17 |
sp|Q5XBN5|DLTA_STRP6 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 | 2 | 262 | 2.0E-17 |
sp|Q99ZA6|DLTA_STRP1 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 | 2 | 262 | 2.0E-17 |
sp|P0DA65|DLTA_STRPQ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 | 2 | 262 | 2.0E-17 |
sp|P0DA64|DLTA_STRP3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 | 2 | 262 | 2.0E-17 |
sp|Q9CG49|DLTA_LACLA | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 | 24 | 260 | 2.0E-17 |
sp|Q4WZ44|NRPS7_ASPFU | Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 | 1 | 256 | 3.0E-17 |
sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 6 | 260 | 3.0E-17 |
sp|Q8XBV9|ENTF_ECO57 | Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 | 16 | 163 | 3.0E-17 |
sp|P29698|ENTF_SHIFL | Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 | 16 | 163 | 5.0E-17 |
sp|C1CB20|DLTA_STRP7 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 | 2 | 262 | 6.0E-17 |
sp|P11454|ENTF_ECOLI | Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 | 16 | 163 | 6.0E-17 |
sp|P39845|PPSA_BACSU | Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 | 31 | 260 | 7.0E-17 |
sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 2 | 260 | 1.0E-16 |
sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 2 | 260 | 1.0E-16 |
sp|Q6W4T3|ANGR_VIBA7 | Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 | 1 | 260 | 3.0E-16 |
sp|P0DJH0|ANGR_VIBAN | Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 | 1 | 260 | 3.0E-16 |
sp|Q53526|DLTA_STRMU | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 | 2 | 261 | 4.0E-16 |
sp|C1CNE9|DLTA_STRZP | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 | 2 | 262 | 4.0E-16 |
sp|P0A399|DLTA_STRR6 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 | 2 | 262 | 4.0E-16 |
sp|P0A398|DLTA_STRPN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 | 2 | 262 | 4.0E-16 |
sp|Q04HZ7|DLTA_STRP2 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 | 2 | 262 | 4.0E-16 |
sp|Q0VZ70|CHSAD_CHOCO | Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 | 1 | 185 | 5.0E-16 |
sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 6 | 330 | 6.0E-16 |
sp|C1CU95|DLTA_STRZT | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 | 2 | 262 | 7.0E-16 |
sp|B8ZQ14|DLTA_STRPJ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 | 2 | 262 | 7.0E-16 |
sp|P59591|DLTA_STRA5 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 | 2 | 261 | 7.0E-16 |
sp|Q8VM67|DLTA_STRA3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 | 2 | 261 | 7.0E-16 |
sp|Q3JZ94|DLTA_STRA1 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 | 2 | 261 | 7.0E-16 |
sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 6 | 330 | 9.0E-16 |
sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 2 | 260 | 9.0E-16 |
sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 2 | 330 | 2.0E-15 |
sp|C0MBD6|DLTA_STRE4 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 | 43 | 262 | 2.0E-15 |
sp|Q9I4X3|PQSA_PSEAE | Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 | 14 | 267 | 2.0E-15 |
sp|B8DEG2|DLTA_LISMH | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 | 2 | 260 | 3.0E-15 |
sp|Q92D47|DLTA_LISIN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 | 2 | 260 | 3.0E-15 |
sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 16 | 263 | 4.0E-15 |
sp|Q6FMI5|LYS2_CANGA | L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 | 37 | 330 | 6.0E-15 |
sp|Q8H151|AAE13_ARATH | Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 | 17 | 260 | 7.0E-15 |
sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 2 | 264 | 9.0E-15 |
sp|Q01757|ACVS_STRCL | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 | 15 | 296 | 9.0E-15 |
sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 2 | 264 | 1.0E-14 |
sp|Q8Y8D4|DLTA_LISMO | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 | 2 | 260 | 4.0E-14 |
sp|Q9X2N4|DLTA_STAXY | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 | 2 | 265 | 9.0E-14 |
sp|A0AH92|DLTA_LISW6 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 | 2 | 260 | 1.0E-13 |
sp|Q721J2|DLTA_LISMF | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 | 2 | 260 | 2.0E-13 |
sp|C1L1P5|DLTA_LISMC | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 | 2 | 260 | 2.0E-13 |
sp|P40976|LYS2_SCHPO | L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 | 89 | 260 | 3.0E-13 |
sp|O07610|LCFB_BACSU | Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 | 10 | 264 | 3.0E-13 |
sp|P07702|LYS2_YEAST | L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 | 29 | 330 | 3.0E-13 |
sp|Q7TYQ4|MBTB_MYCBO | Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 | 46 | 267 | 3.0E-13 |
sp|P9WQ62|MBTB_MYCTO | Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 | 46 | 267 | 4.0E-13 |
sp|P9WQ63|MBTB_MYCTU | Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 | 46 | 267 | 4.0E-13 |
sp|P69451|LCFA_ECOLI | Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 | 13 | 262 | 7.0E-13 |
sp|P69452|LCFA_ECOL6 | Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 | 13 | 262 | 7.0E-13 |
sp|Q5SKN9|LCFCS_THET8 | Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 | 14 | 260 | 8.0E-13 |
sp|Q8XDR6|LCFA_ECO57 | Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 | 13 | 262 | 8.0E-13 |
sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 1 | 257 | 2.0E-12 |
sp|Q5KVX9|MENE_GEOKA | 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 | 15 | 260 | 2.0E-12 |
sp|Q6NUN0|ACSM5_HUMAN | Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 | 14 | 260 | 4.0E-12 |
sp|Q1AXQ5|ACSA_RUBXD | Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 | 13 | 260 | 5.0E-12 |
sp|Q3UNX5|ACSM3_MOUSE | Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 | 14 | 260 | 6.0E-12 |
sp|Q0K844|SAUT_CUPNH | Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 | 32 | 262 | 1.0E-11 |
sp|F4K1G2|AEE19_ARATH | Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 | 15 | 260 | 2.0E-11 |
sp|Q80W40|ACSM4_MOUSE | Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 | 9 | 262 | 4.0E-11 |
sp|A7Z809|MENE_BACMF | 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 | 15 | 263 | 4.0E-11 |
sp|P46450|LCFA_HAEIN | Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 | 9 | 262 | 4.0E-11 |
sp|Q6SKG1|ACSM3_RAT | Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 | 14 | 260 | 5.0E-11 |
sp|B7JDD6|MENE_BACC0 | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 | 15 | 260 | 6.0E-11 |
sp|Q6HC29|MENE_BACHK | 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 | 15 | 260 | 6.0E-11 |
sp|Q82SI5|ACSA_NITEU | Acetyl-coenzyme A synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=acsA PE=3 SV=1 | 30 | 260 | 6.0E-11 |
sp|Q9BEA2|ACSM1_BOVIN | Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 | 14 | 260 | 8.0E-11 |
sp|Q72YK9|MENE_BACC1 | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 | 15 | 260 | 8.0E-11 |
sp|Q6AYT9|ACSM5_RAT | Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 | 14 | 260 | 1.0E-10 |
sp|P63521|LCFA_SALTY | Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 | 13 | 262 | 1.0E-10 |
sp|P63522|LCFA_SALTI | Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 | 13 | 262 | 1.0E-10 |
sp|Q81K97|MENE_BACAN | 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 | 15 | 260 | 1.0E-10 |
sp|C3LB87|MENE_BACAC | 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 | 15 | 260 | 1.0E-10 |
sp|C3PCK3|MENE_BACAA | 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 | 15 | 260 | 1.0E-10 |
sp|Q00869|ESYN_FUSEQ | Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 | 41 | 163 | 2.0E-10 |
sp|Q8BGA8|ACSM5_MOUSE | Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 | 14 | 260 | 2.0E-10 |
sp|O74298|LYS2_PENCH | L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 | 89 | 260 | 2.0E-10 |
sp|Q73XY1|MBTB_MYCPA | Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 | 92 | 260 | 2.0E-10 |
sp|A0RK73|MENE_BACAH | 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 | 15 | 260 | 2.0E-10 |
sp|Q12572|LYS2_CANAX | L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 | 89 | 260 | 2.0E-10 |
sp|Q8KBY0|ACSA_CHLTE | Acetyl-coenzyme A synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acsA PE=3 SV=2 | 71 | 281 | 3.0E-10 |
sp|Q8ZES9|LCFA_YERPE | Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 | 13 | 262 | 3.0E-10 |
sp|B9J2F2|MENE_BACCQ | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 | 15 | 260 | 3.0E-10 |
sp|P23971|MENE_BACSU | 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 | 16 | 262 | 4.0E-10 |
sp|A1CLY8|CCSA_ASPCL | Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 | 36 | 260 | 4.0E-10 |
sp|Q7TN78|ACSM4_RAT | Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 | 9 | 262 | 4.0E-10 |
sp|A9VM74|MENE_BACWK | 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 | 15 | 260 | 5.0E-10 |
sp|Q75BB3|LYS2_ASHGO | L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 | 1 | 260 | 5.0E-10 |
sp|Q816I1|MENE_BACCR | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 | 15 | 260 | 5.0E-10 |
sp|Q3URE1|ACSF3_MOUSE | Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 | 17 | 262 | 5.0E-10 |
sp|A0R5G1|ACSA_MYCS2 | Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 | 13 | 263 | 9.0E-10 |
sp|Q632I5|MENE_BACCZ | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 | 16 | 260 | 1.0E-09 |
sp|Q9RRL7|ACSA_DEIRA | Acetyl-coenzyme A synthetase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=acsA PE=3 SV=1 | 64 | 266 | 1.0E-09 |
sp|Q8GQN9|BCLA_THAAR | Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 | 17 | 260 | 1.0E-09 |
sp|P59872|ACSA_RHOBA | Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 | 92 | 266 | 1.0E-09 |
sp|P38135|FADK_ECOLI | Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 | 13 | 264 | 1.0E-09 |
sp|Q53FZ2|ACSM3_HUMAN | Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 | 14 | 260 | 1.0E-09 |
sp|B7HTW3|MENE_BACC7 | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 | 15 | 260 | 1.0E-09 |
sp|P0C7M7|ACSM4_HUMAN | Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 | 9 | 262 | 1.0E-09 |
sp|Q58DN7|ACSF3_BOVIN | Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 | 17 | 261 | 1.0E-09 |
sp|Q5REV5|ACSM3_PONAB | Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 | 14 | 260 | 2.0E-09 |
sp|P55912|PRPE_SALTY | Propionate--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prpE PE=3 SV=2 | 13 | 263 | 2.0E-09 |
sp|Q4G176|ACSF3_HUMAN | Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 | 9 | 261 | 3.0E-09 |
sp|A6WXV8|ACSA_OCHA4 | Acetyl-coenzyme A synthetase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=acsA PE=3 SV=1 | 15 | 295 | 3.0E-09 |
sp|A7GU88|MENE_BACCN | 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 | 15 | 254 | 5.0E-09 |
sp|A6UED8|ACSA_SINMW | Acetyl-coenzyme A synthetase OS=Sinorhizobium medicae (strain WSM419) GN=acsA PE=3 SV=1 | 100 | 287 | 5.0E-09 |
sp|P94547|LCFA_BACSU | Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 | 9 | 262 | 6.0E-09 |
sp|Q53005|4HBCL_RHOPA | 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 | 15 | 263 | 8.0E-09 |
sp|P40871|DHBE_BACSU | 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 | 6 | 265 | 8.0E-09 |
sp|B9JEV4|ACSA_AGRRK | Acetyl-coenzyme A synthetase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=acsA PE=3 SV=1 | 71 | 295 | 9.0E-09 |
sp|Q92KX2|ACSA_RHIME | Acetyl-coenzyme A synthetase OS=Rhizobium meliloti (strain 1021) GN=acsA1 PE=3 SV=1 | 29 | 279 | 1.0E-08 |
sp|B7KPN8|ACSA_METC4 | Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=acsA PE=3 SV=1 | 9 | 295 | 1.0E-08 |
sp|Q08AH1|ACSM1_HUMAN | Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 | 13 | 260 | 2.0E-08 |
sp|Q8XBV3|ENTE_ECO57 | Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 | 16 | 266 | 2.0E-08 |
sp|P10378|ENTE_ECOLI | Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 | 16 | 266 | 2.0E-08 |
sp|Q84P24|4CLL6_ARATH | 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 | 14 | 264 | 2.0E-08 |
sp|Q1B6A7|MBTB_MYCSS | Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 | 92 | 260 | 2.0E-08 |
sp|Q9F7R5|ACSA_PRB01 | Acetyl-coenzyme A synthetase OS=Gamma-proteobacterium EBAC31A08 GN=acsA PE=3 SV=1 | 122 | 267 | 2.0E-08 |
sp|C0SPB0|YTCI_BACSU | Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 | 9 | 260 | 2.0E-08 |
sp|B1ZB59|ACSA_METPB | Acetyl-coenzyme A synthetase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=acsA PE=3 SV=1 | 100 | 295 | 2.0E-08 |
sp|A9W5V0|ACSA_METEP | Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain PA1) GN=acsA PE=3 SV=1 | 9 | 295 | 3.0E-08 |
sp|O68040|ACSA_RHOCB | Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 | 124 | 279 | 3.0E-08 |
sp|Q8ZKF6|ACSA_SALTY | Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 | 124 | 279 | 4.0E-08 |
sp|Q8FAY8|ACSA_ECOL6 | Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 | 124 | 279 | 4.0E-08 |
sp|Q8YJ48|ACSA_BRUME | Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=acsA PE=3 SV=2 | 124 | 295 | 4.0E-08 |
sp|P27550|ACSA_ECOLI | Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 | 124 | 279 | 4.0E-08 |
sp|Q8Z1R0|ACSA_SALTI | Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 | 124 | 279 | 4.0E-08 |
sp|C0RF62|ACSA_BRUMB | Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=acsA PE=3 SV=1 | 124 | 295 | 4.0E-08 |
sp|Q84HC5|NCSB2_STRCZ | 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 | 41 | 260 | 4.0E-08 |
sp|A9WWT6|ACSA_BRUSI | Acetyl-coenzyme A synthetase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=acsA PE=3 SV=1 | 124 | 295 | 4.0E-08 |
sp|C3MAS0|ACSA_RHISN | Acetyl-coenzyme A synthetase OS=Rhizobium sp. (strain NGR234) GN=acsA PE=3 SV=1 | 100 | 287 | 4.0E-08 |
sp|Q8FYQ3|ACSA_BRUSU | Acetyl-coenzyme A synthetase OS=Brucella suis biovar 1 (strain 1330) GN=acsA PE=3 SV=1 | 124 | 295 | 4.0E-08 |
sp|A9M849|ACSA_BRUC2 | Acetyl-coenzyme A synthetase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=acsA PE=3 SV=1 | 124 | 295 | 4.0E-08 |
sp|Q57B76|ACSA_BRUAB | Acetyl-coenzyme A synthetase OS=Brucella abortus biovar 1 (strain 9-941) GN=acsA PE=3 SV=1 | 124 | 295 | 4.0E-08 |
sp|Q2YLH5|ACSA_BRUA2 | Acetyl-coenzyme A synthetase OS=Brucella abortus (strain 2308) GN=acsA PE=3 SV=1 | 124 | 295 | 4.0E-08 |
sp|B2S7N5|ACSA_BRUA1 | Acetyl-coenzyme A synthetase OS=Brucella abortus (strain S19) GN=acsA PE=3 SV=1 | 124 | 295 | 4.0E-08 |
sp|Q98ET8|ACSA_RHILO | Acetyl-coenzyme A synthetase OS=Rhizobium loti (strain MAFF303099) GN=acsA PE=3 SV=1 | 9 | 295 | 4.0E-08 |
sp|A8AN29|ACSA_CITK8 | Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 | 124 | 279 | 4.0E-08 |
sp|B5ZV36|ACSA_RHILW | Acetyl-coenzyme A synthetase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=acsA PE=3 SV=1 | 71 | 295 | 5.0E-08 |
sp|Q0VSR6|ACSA_ALCBS | Acetyl-coenzyme A synthetase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=acsA PE=3 SV=1 | 16 | 295 | 6.0E-08 |
sp|Q3E6Y4|4CLL3_ARATH | 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 | 13 | 266 | 7.0E-08 |
sp|Q3IFM6|ACSA_PSEHT | Acetyl-coenzyme A synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=acsA PE=3 SV=1 | 126 | 287 | 7.0E-08 |
sp|Q84P25|4CLL2_ARATH | 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 | 13 | 266 | 7.0E-08 |
sp|Q69RG7|4CLL7_ORYSJ | 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 | 17 | 262 | 8.0E-08 |
sp|Q4ZQG8|ACSA_PSEU2 | Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1 | 124 | 279 | 8.0E-08 |
sp|Q99NB1|ACS2L_MOUSE | Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 | 127 | 266 | 1.0E-07 |
sp|A0B8F1|ACSA_METTP | Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 | 10 | 258 | 1.0E-07 |
sp|Q7NSY7|ACSA_CHRVO | Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 | 89 | 267 | 1.0E-07 |
sp|Q72J95|ACSA_THET2 | Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=acsA PE=3 SV=1 | 126 | 267 | 1.0E-07 |
sp|O74976|FAT2_SCHPO | Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 | 45 | 262 | 1.0E-07 |
sp|Q68CK6|ACS2B_HUMAN | Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 | 9 | 262 | 1.0E-07 |
sp|Q54P79|4CL3_DICDI | Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 | 24 | 189 | 1.0E-07 |
sp|Q9M0X9|4CLL7_ARATH | 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 | 7 | 261 | 1.0E-07 |
sp|Q5SIW6|ACSA_THET8 | Acetyl-coenzyme A synthetase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=acsA PE=3 SV=1 | 126 | 267 | 1.0E-07 |
sp|Q08AH3|ACS2A_HUMAN | Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 | 9 | 262 | 1.0E-07 |
sp|A7MPJ7|ACSA_CROS8 | Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 | 124 | 279 | 1.0E-07 |
sp|B1M0M1|ACSA_METRJ | Acetyl-coenzyme A synthetase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=acsA PE=3 SV=1 | 127 | 295 | 1.0E-07 |
sp|A5VSF3|ACSA_BRUO2 | Acetyl-coenzyme A synthetase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=acsA PE=3 SV=1 | 124 | 295 | 1.0E-07 |
sp|Q15YI8|ACSA_PSEA6 | Acetyl-coenzyme A synthetase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=acsA PE=3 SV=1 | 127 | 286 | 1.0E-07 |
sp|Q4WF53|NRPS4_ASPFU | Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 | 55 | 266 | 2.0E-07 |
sp|Q82EL5|ACSA_STRAW | Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 | 13 | 263 | 2.0E-07 |
sp|Q885K7|ACSA_PSESM | Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=acsA PE=3 SV=1 | 124 | 279 | 2.0E-07 |
sp|A1RIK1|ACSA_SHESW | Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain W3-18-1) GN=acsA PE=3 SV=1 | 124 | 276 | 2.0E-07 |
sp|A4Y7Y7|ACSA_SHEPC | Acetyl-coenzyme A synthetase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=acsA PE=3 SV=1 | 124 | 276 | 2.0E-07 |
sp|Q48G09|ACSA_PSE14 | Acetyl-coenzyme A synthetase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=acsA PE=3 SV=1 | 124 | 279 | 2.0E-07 |
sp|A1JIK3|ACSA_YERE8 | Acetyl-coenzyme A synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acs PE=3 SV=1 | 124 | 279 | 2.0E-07 |
sp|P80436|TRS1_STRTI | Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 | 85 | 266 | 2.0E-07 |
sp|Q3SLF4|ACSA_THIDA | Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 | 71 | 267 | 2.0E-07 |
sp|Q7XXL2|4CLL9_ORYSJ | 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 | 64 | 262 | 2.0E-07 |
sp|A4G3L8|ACSA_HERAR | Acetyl-coenzyme A synthetase OS=Herminiimonas arsenicoxydans GN=acsA PE=3 SV=1 | 71 | 267 | 2.0E-07 |
sp|Q9NUB1|ACS2L_HUMAN | Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 | 127 | 267 | 2.0E-07 |
sp|O70490|ACSM2_RAT | Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 | 24 | 260 | 2.0E-07 |
sp|A1SZA2|ACSA_PSYIN | Acetyl-coenzyme A synthetase OS=Psychromonas ingrahamii (strain 37) GN=acsA PE=3 SV=1 | 124 | 267 | 2.0E-07 |
sp|O93730|ACSA_PYRAE | Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 | 13 | 260 | 2.0E-07 |
sp|P36333|ACSA_PENCH | Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 | 122 | 287 | 3.0E-07 |
sp|Q1H0J2|ACSA_METFK | Acetyl-coenzyme A synthetase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=acsA PE=3 SV=1 | 30 | 260 | 3.0E-07 |
sp|Q8X5T5|ACSA_ECO57 | Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 | 124 | 279 | 3.0E-07 |
sp|Q00868|ESYN_GIBPU | Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 | 41 | 196 | 3.0E-07 |
sp|A8G8G7|ACSA_SERP5 | Acetyl-coenzyme A synthetase OS=Serratia proteamaculans (strain 568) GN=acs PE=3 SV=1 | 124 | 267 | 3.0E-07 |
sp|Q8EDK3|ACSA_SHEON | Acetyl-coenzyme A synthetase OS=Shewanella oneidensis (strain MR-1) GN=acsA PE=3 SV=1 | 124 | 276 | 3.0E-07 |
sp|A0KY83|ACSA_SHESA | Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain ANA-3) GN=acsA PE=3 SV=1 | 124 | 276 | 3.0E-07 |
sp|Q0HTY6|ACSA_SHESR | Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-7) GN=acsA PE=3 SV=1 | 124 | 276 | 4.0E-07 |
sp|Q0HHN4|ACSA_SHESM | Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-4) GN=acsA PE=3 SV=1 | 124 | 276 | 4.0E-07 |
sp|Q2K2T1|ACSA_RHIEC | Acetyl-coenzyme A synthetase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=acsA PE=3 SV=1 | 71 | 295 | 4.0E-07 |
sp|Q8VZF1|AEE7_ARATH | Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 | 92 | 260 | 4.0E-07 |
sp|Q2NR28|ACSA_SODGM | Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 | 105 | 267 | 4.0E-07 |
sp|Q6GLK6|ACSF3_XENLA | Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 | 17 | 261 | 4.0E-07 |
sp|Q2G512|ACSA_NOVAD | Acetyl-coenzyme A synthetase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=acsA PE=3 SV=1 | 9 | 286 | 4.0E-07 |
sp|A9IYZ3|ACSA_BART1 | Acetyl-coenzyme A synthetase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=acsA PE=3 SV=1 | 71 | 276 | 5.0E-07 |
sp|A3QD52|ACSA_SHELP | Acetyl-coenzyme A synthetase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=acsA PE=3 SV=1 | 90 | 276 | 5.0E-07 |
sp|Q8UBV5|ACSA_AGRFC | Acetyl-coenzyme A synthetase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=acsA PE=3 SV=2 | 127 | 276 | 5.0E-07 |
sp|Q8DCZ9|ACSA_VIBVU | Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 | 88 | 287 | 5.0E-07 |
sp|Q65FT5|MENE_BACLD | 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 | 15 | 260 | 5.0E-07 |
sp|Q7MGU3|ACSA_VIBVY | Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 | 88 | 287 | 6.0E-07 |
sp|C5D6U5|MENE_GEOSW | 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 | 16 | 267 | 6.0E-07 |
sp|P39062|ACSA_BACSU | Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 | 13 | 260 | 6.0E-07 |
sp|P9WQD1|ACSA_MYCTU | Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 | 13 | 263 | 6.0E-07 |
sp|P9WQD0|ACSA_MYCTO | Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 | 13 | 263 | 6.0E-07 |
sp|P59871|ACSA_MYCBO | Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 | 13 | 263 | 6.0E-07 |
sp|C8VTR6|Y0074_EMENI | Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 | 10 | 262 | 6.0E-07 |
sp|Q1QEB6|ACSA_PSYCK | Acetyl-coenzyme A synthetase OS=Psychrobacter cryohalolentis (strain K5) GN=acsA PE=3 SV=1 | 127 | 287 | 6.0E-07 |
sp|Q84P21|4CLL5_ARATH | 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 | 92 | 267 | 7.0E-07 |
sp|A4TS06|ACSA_YERPP | Acetyl-coenzyme A synthetase OS=Yersinia pestis (strain Pestoides F) GN=acs PE=3 SV=1 | 124 | 267 | 7.0E-07 |
sp|Q1CE37|ACSA_YERPN | Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acs PE=3 SV=1 | 124 | 267 | 7.0E-07 |
sp|Q8D1G8|ACSA_YERPE | Acetyl-coenzyme A synthetase OS=Yersinia pestis GN=acs PE=3 SV=2 | 124 | 267 | 7.0E-07 |
sp|Q1C0N0|ACSA_YERPA | Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acs PE=3 SV=1 | 124 | 267 | 7.0E-07 |
sp|Q7MBA6|ACSA_PHOLL | Acetyl-coenzyme A synthetase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=acs PE=3 SV=1 | 124 | 267 | 7.0E-07 |
sp|P0C5B6|4CLL4_ARATH | 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 | 13 | 266 | 7.0E-07 |
sp|Q66FM8|ACSA_YERPS | Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acs PE=3 SV=1 | 124 | 267 | 7.0E-07 |
sp|A7FNG1|ACSA_YERP3 | Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acs PE=3 SV=1 | 124 | 267 | 7.0E-07 |
sp|A6WM52|ACSA_SHEB8 | Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS185) GN=acsA PE=3 SV=1 | 124 | 276 | 7.0E-07 |
sp|A3D3E8|ACSA_SHEB5 | Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=acsA PE=3 SV=1 | 124 | 276 | 7.0E-07 |
sp|A1S7C8|ACSA_SHEAM | Acetyl-coenzyme A synthetase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=acsA PE=3 SV=1 | 13 | 276 | 8.0E-07 |
sp|Q0AFF1|ACSA_NITEC | Acetyl-coenzyme A synthetase OS=Nitrosomonas eutropha (strain C91) GN=acsA PE=3 SV=1 | 71 | 260 | 9.0E-07 |
sp|A9KY56|ACSA_SHEB9 | Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS195) GN=acsA PE=3 SV=1 | 124 | 276 | 9.0E-07 |
sp|Q4FVA1|ACSA_PSYA2 | Acetyl-coenzyme A synthetase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=acsA PE=3 SV=1 | 82 | 287 | 1.0E-06 |
sp|B3PS41|ACSA_RHIE6 | Acetyl-coenzyme A synthetase OS=Rhizobium etli (strain CIAT 652) GN=acsA PE=3 SV=1 | 71 | 295 | 1.0E-06 |
sp|Q8ENZ7|MENE_OCEIH | 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 | 15 | 260 | 1.0E-06 |
sp|C1AA44|ACSA_GEMAT | Acetyl-coenzyme A synthetase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acsA PE=3 SV=1 | 9 | 263 | 1.0E-06 |
sp|Q6FXI2|ACS2_CANGA | Acetyl-coenzyme A synthetase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS2 PE=3 SV=1 | 127 | 267 | 1.0E-06 |
sp|Q91VA0|ACSM1_MOUSE | Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 | 14 | 260 | 1.0E-06 |
sp|B2HHZ8|FAC17_MYCMM | Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD17 PE=3 SV=1 | 36 | 260 | 1.0E-06 |
sp|Q9CMW1|ACSA_PASMU | Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 | 71 | 269 | 2.0E-06 |
sp|P58730|MENE_LISMO | 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 | 9 | 260 | 2.0E-06 |
sp|Q10S72|4CLL4_ORYSJ | 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 | 14 | 266 | 2.0E-06 |
sp|Q9KWA3|ACSA_AGRRH | Acetyl-coenzyme A synthetase OS=Agrobacterium rhizogenes GN=acsA PE=3 SV=1 | 86 | 295 | 2.0E-06 |
sp|Q9VP61|ACSA_DROME | Acetyl-coenzyme A synthetase OS=Drosophila melanogaster GN=AcCoAS PE=2 SV=1 | 127 | 292 | 3.0E-06 |
sp|C1D6V9|ACSA_LARHH | Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 | 10 | 304 | 3.0E-06 |
sp|P77495|PRPE_ECOLI | Propionate--CoA ligase OS=Escherichia coli (strain K12) GN=prpE PE=3 SV=1 | 7 | 263 | 3.0E-06 |
sp|A7IFD4|ACSA_XANP2 | Acetyl-coenzyme A synthetase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acsA PE=3 SV=1 | 9 | 279 | 3.0E-06 |
sp|P27095|ACSA_METCN | Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 | 13 | 258 | 3.0E-06 |
sp|Q9L9F6|NOVL_STRNV | 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 | 41 | 265 | 3.0E-06 |
sp|A6VZN8|ACSA_MARMS | Acetyl-coenzyme A synthetase OS=Marinomonas sp. (strain MWYL1) GN=acsA PE=3 SV=1 | 51 | 292 | 4.0E-06 |
sp|Q27549|ACSA_CRYPV | Acetyl-coenzyme A synthetase OS=Cryptosporidium parvum GN=ACS PE=3 SV=1 | 125 | 281 | 4.0E-06 |
sp|Q6LLZ1|ACSA_PHOPR | Acetyl-coenzyme A synthetase OS=Photobacterium profundum GN=acsA PE=3 SV=1 | 9 | 287 | 4.0E-06 |
sp|Q7WSH3|FADD3_COMTE | 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 | 9 | 264 | 5.0E-06 |
sp|A4YGR1|HPCAS_METS5 | 3-hydroxypropionyl-coenzyme A synthetase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1456 PE=1 SV=1 | 69 | 264 | 5.0E-06 |
sp|Q12MK0|ACSA_SHEDO | Acetyl-coenzyme A synthetase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=acsA PE=3 SV=1 | 71 | 276 | 5.0E-06 |
sp|Q8RU95|4CLL6_ORYSJ | 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 | 46 | 266 | 7.0E-06 |
sp|Q9A2I0|ACSA_CAUCR | Acetyl-coenzyme A synthetase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=acsA PE=3 SV=1 | 71 | 292 | 8.0E-06 |
sp|Q42982|4CL2_ORYSJ | Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 | 13 | 180 | 8.0E-06 |
sp|Q9AJS8|3HBCL_THAAR | 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 | 24 | 264 | 1.0E-05 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 12 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|6934 MTPTFASTLKVTDFNTLKVVTMEGEALPQPLADEWRDHVTLYNTYGPAETAISMTARRVRPNVKSYNIGWPMPTV ETWVMRDNRPLLRGAVGELVIAGPQLSPGYWDNDEATKATFAWSQLLQRRIYHTGDMVRQVSDGSFEFVGRNDDL VKIRGMRVELSEIAAVCCVGHPSVVHAEVLLTSLPESAERSIVCFLDSGRPQHDSDSRPHLLANDLAKDISNAVA QHAASQLPQYMVPDLFVMLSSFPRTRSDKVDRRQLLDIMASDWVCLSTADTGLVVNGSPVDEEWNNQHRQLLDVI KEFAKIRTRALSPTTSLVELGLDSITAIKLNPWVPEHR* |
Coding | >Hirsu2|6934 ATGACACCGACCTTTGCCAGCACGCTAAAAGTGACCGACTTCAACACGTTGAAAGTCGTCACCATGGAGGGCGAA GCCCTTCCACAGCCCTTGGCGGATGAGTGGAGAGACCATGTCACGCTCTACAACACTTATGGCCCAGCAGAAACT GCCATCAGTATGACCGCTCGCAGGGTGCGGCCCAATGTCAAGAGCTACAACATTGGCTGGCCCATGCCGACTGTG GAGACATGGGTGATGCGAGACAACCGGCCGCTGCTCCGCGGCGCGGTCGGCGAGCTCGTAATAGCCGGGCCACAG CTGTCTCCCGGCTACTGGGACAATGACGAGGCAACCAAGGCCACATTCGCGTGGAGCCAGCTCCTGCAAAGGCGA ATCTACCACACGGGTGACATGGTCAGGCAGGTAAGTGACGGCAGCTTTGAATTTGTCGGCCGTAACGACGACCTA GTCAAGATCAGGGGCATGCGAGTCGAGTTGAGCGAAATTGCCGCCGTCTGCTGCGTCGGCCACCCCTCGGTGGTC CATGCTGAGGTACTCCTGACCTCGCTCCCGGAATCGGCAGAGCGCTCGATTGTCTGCTTCCTGGACTCTGGAAGA CCCCAGCATGATTCGGACAGCAGGCCGCATCTGCTGGCCAATGACCTTGCGAAAGACATATCAAATGCGGTGGCC CAGCATGCCGCTTCTCAGCTACCGCAATACATGGTTCCCGACCTGTTTGTCATGCTTAGCTCCTTTCCCAGGACG CGCTCGGACAAAGTCGACCGACGACAGCTGCTGGACATAATGGCTTCGGACTGGGTATGCTTGTCTACTGCAGAT ACCGGACTGGTTGTCAATGGGTCGCCCGTGGATGAGGAATGGAACAATCAACACCGACAGTTGCTCGACGTGATC AAGGAATTTGCCAAGATCCGGACCCGTGCCCTCAGCCCGACCACCTCCTTGGTCGAGCTGGGACTCGACTCTATC ACGGCCATCAAGCTCAATCCTTGGGTGCCGGAGCATCGGTGA |
Transcript | >Hirsu2|6934 ATGACACCGACCTTTGCCAGCACGCTAAAAGTGACCGACTTCAACACGTTGAAAGTCGTCACCATGGAGGGCGAA GCCCTTCCACAGCCCTTGGCGGATGAGTGGAGAGACCATGTCACGCTCTACAACACTTATGGCCCAGCAGAAACT GCCATCAGTATGACCGCTCGCAGGGTGCGGCCCAATGTCAAGAGCTACAACATTGGCTGGCCCATGCCGACTGTG GAGACATGGGTGATGCGAGACAACCGGCCGCTGCTCCGCGGCGCGGTCGGCGAGCTCGTAATAGCCGGGCCACAG CTGTCTCCCGGCTACTGGGACAATGACGAGGCAACCAAGGCCACATTCGCGTGGAGCCAGCTCCTGCAAAGGCGA ATCTACCACACGGGTGACATGGTCAGGCAGGTAAGTGACGGCAGCTTTGAATTTGTCGGCCGTAACGACGACCTA GTCAAGATCAGGGGCATGCGAGTCGAGTTGAGCGAAATTGCCGCCGTCTGCTGCGTCGGCCACCCCTCGGTGGTC CATGCTGAGGTACTCCTGACCTCGCTCCCGGAATCGGCAGAGCGCTCGATTGTCTGCTTCCTGGACTCTGGAAGA CCCCAGCATGATTCGGACAGCAGGCCGCATCTGCTGGCCAATGACCTTGCGAAAGACATATCAAATGCGGTGGCC CAGCATGCCGCTTCTCAGCTACCGCAATACATGGTTCCCGACCTGTTTGTCATGCTTAGCTCCTTTCCCAGGACG CGCTCGGACAAAGTCGACCGACGACAGCTGCTGGACATAATGGCTTCGGACTGGGTATGCTTGTCTACTGCAGAT ACCGGACTGGTTGTCAATGGGTCGCCCGTGGATGAGGAATGGAACAATCAACACCGACAGTTGCTCGACGTGATC AAGGAATTTGCCAAGATCCGGACCCGTGCCCTCAGCCCGACCACCTCCTTGGTCGAGCTGGGACTCGACTCTATC ACGGCCATCAAGCTCAATCCTTGGGTGCCGGAGCATCGGTGA |
Gene | >Hirsu2|6934 ATGACACCGACCTTTGCCAGCACGCTAAAAGTGACCGACTTCAACACGTTGAAAGTCGTCACCATGGAGGGCGAA GCCCTTCCACAGCCCTTGGCGGATGAGTGGAGAGACCATGTCACGCTCTACAACACTTATGGCCCAGCAGAAACT GCCATCAGTATGACCGCTCGCAGGGTGCGGCCCAATGTCAAGAGCTACAACATTGGCTGGCCCATGCCGACTGTG GAGACATGGGTGATGCGAGACAACCGGCCGCTGCTCCGCGGCGCGGTCGGCGAGCTCGTAATAGCCGGGCCACAG CTGTCTCCCGGCTACTGGGACAATGACGAGGCAACCAAGGCCACATTCGCGTGGAGCCAGCTCCTGCAAAGGCGA ATCTACCACACGGGTGACATGGTCAGGCAGGTAAGTGACGGCAGCTTTGAATTTGTCGGCCGTAACGACGACCTA GTCAAGATCAGGGGCATGCGAGTCGAGTTGAGCGAAATTGCCGCCGTCTGCTGCGTCGGCCACCCCTCGGTGGTC CATGCTGAGGTACTCCTGACCTCGCTCCCGGAATCGGCAGAGCGCTCGATTGTCTGCTTCCTGGACTCTGGAAGA CCCCAGCATGATTCGGACAGCAGGCCGCATCTGCTGGCCAATGACCTTGCGAAAGACATATCAAATGCGGTGGCC CAGCATGCCGCTTCTCAGCTACCGCAATACATGGTTCCCGACCTGTTTGTCATGCTTAGCTCCTTTCCCAGGACG CGCTCGGACAAAGTCGACCGACGACAGCTGCTGGACATAATGGCTTCGGACTGGGTATGCTTGTCTACTGCAGAT ACCGGACTGGTTGTCAATGGGTCGCCCGTGGATGAGGAATGGAACAATCAACACCGACAGTTGCTCGACGTGATC AAGGAATTTGCCAAGATCCGGACCCGTGCCCTCAGCCCGACCACCTCCTTGGTCGAGCTGGGACTCGACTCTATC ACGGCCATCAAGCTCAGTTCCAGGCTGAGATCTGACGGATACAATGTTTCTGTTGTGCAGATCCTTGGGTGCCGG AGCATCGGTGA |