Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6932
Gene name
LocationContig_378:3278..5162
Strand-
Gene length (bp)1884
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.4E-12 76 325
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 8.6E-08 123 513

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 15 588 2.0E-147
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 5 582 5.0E-90
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 14 550 2.0E-83
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 2 583 1.0E-68
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 42 553 3.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 15 588 2.0E-147
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 5 582 5.0E-90
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 14 550 2.0E-83
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 2 583 1.0E-68
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 42 553 3.0E-64
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 5 574 2.0E-51
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 32 587 3.0E-41
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 94 580 5.0E-40
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 7 559 8.0E-40
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 94 580 2.0E-39
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 48 557 3.0E-36
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 94 585 3.0E-36
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 3 575 3.0E-16
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 76 518 8.0E-14
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 101 580 8.0E-13
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 188 518 4.0E-11
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 98 337 3.0E-09
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 74 409 7.0E-08
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 99 347 3.0E-07
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 114 329 4.0E-07
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 208 440 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 67 89 22
2 104 123 19
3 135 152 17
4 162 181 19
5 194 216 22
6 221 243 22
7 279 301 22
8 306 328 22
9 348 370 22
10 385 407 22
11 414 436 22
12 440 462 22
13 475 497 22
14 554 573 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6932
MGHGSRELADEAQRPDPKLESVGDSSEPYARSASHGNDTGSDADAADVQAGVRNVEATTQVWTRNHVIAAYVLIW
LIYFVDSTHQVMAGGLDPYVTSAFRQHSLTPTTGILSQLVGGLFKLPLAKILDIWGRPQGFSLATLLLTVGLVMM
AACKNVETYAAAQVFYWVGFNGMGYTMSVFIADTSALENRALMFAFLYSPFIITSWIGGPVGSSFLYGAGWRWAF
GTFAIATPLVSVPLIALFLSNFRKAKARGLVPRREKTGRTWLESVRHYLVEFDVVGLLLITGGLALFLLSFSLYA
TQPGGWRSPMILCMLIFGLLLLISFGVYERFMAPVQFLPYKLLVDRTIAGGMVLAIARLASFSIWIRFFTSFLQV
VNGLSFTESLYVLRIQTVGSCLWALLVGLLIRQTGRFKWLALYCGVPLAVLGTGLMIHFRQPHVNVGYIVMCQIF
IAFAGGTLNVCSQMAVMAPVTHQHVAVVLAILTTCSSIGNSIGAAVASAVWSATFPQRLAELLPPESQANRTAIY
GSLSVQLSYPIGSPTREAISEAYGDAQRMLLIAATCAMSVGLVSVLFWRDIRVKDVKHVQGQVI*
Coding >Hirsu2|6932
ATGGGCCACGGGTCGCGAGAGCTCGCGGACGAGGCGCAGCGGCCCGACCCCAAGCTGGAGTCGGTCGGCGACAGC
AGCGAGCCCTACGCCCGTTCGGCCTCGCACGGCAACGACACCGGCTCCGATGCCGATGCGGCCGACGTCCAGGCC
GGCGTGCGCAACGTCGAGGCCACGACCCAGGTCTGGACTCGGAACCACGTCATCGCCGCCTACGTCCTCATCTGG
CTCATCTACTTTGTCGACTCGACCCACCAGGTCATGGCCGGCGGCTTGGATCCCTACGTCACCAGTGCCTTCCGA
CAGCACTCCCTCACGCCCACCACCGGCATCCTGTCTCAGCTCGTCGGCGGCCTTTTCAAACTGCCTCTGGCCAAG
ATCCTCGACATCTGGGGCCGGCCCCAGGGCTTCTCCCTCGCCACCTTGCTCCTGACCGTTGGCTTGGTCATGATG
GCTGCCTGCAAGAATGTCGAGACTTATGCCGCCGCTCAAGTCTTCTACTGGGTTGGCTTCAACGGCATGGGCTAC
ACCATGTCCGTCTTCATCGCCGACACGTCCGCCCTGGAGAACCGCGCCCTCATGTTCGCCTTCCTCTACTCGCCC
TTCATCATCACCTCCTGGATCGGTGGTCCGGTCGGCTCCAGCTTCCTCTACGGCGCCGGCTGGCGCTGGGCCTTT
GGCACCTTTGCCATCGCCACGCCCCTCGTCAGCGTGCCCCTCATCGCTCTCTTCTTATCCAACTTTCGCAAGGCC
AAGGCCAGGGGTCTCGTACCCCGCCGCGAAAAGACTGGCCGCACCTGGCTCGAGTCTGTCAGGCACTACCTGGTC
GAGTTTGATGTGGTCGGACTGCTGCTCATCACCGGCGGCCTTGCCCTTTTCCTCCTGTCCTTCAGCCTGTACGCC
ACCCAGCCCGGCGGCTGGCGCTCGCCCATGATTCTCTGCATGCTCATCTTTGGCCTGCTCCTCCTCATCTCCTTT
GGCGTGTACGAGAGGTTCATGGCCCCCGTACAGTTCCTCCCCTACAAGCTGCTCGTCGACCGCACCATTGCAGGC
GGCATGGTCTTGGCCATCGCCAGGCTGGCCTCCTTTTCCATCTGGATCCGCTTCTTCACCTCTTTTCTCCAGGTT
GTCAACGGACTGTCTTTTACCGAGTCCCTCTACGTCCTGCGGATCCAGACCGTCGGCTCCTGCCTCTGGGCCCTC
CTCGTCGGCCTGCTCATTCGCCAGACGGGCCGCTTCAAGTGGCTCGCCCTCTACTGCGGCGTGCCGCTCGCCGTT
CTCGGCACCGGCCTCATGATCCACTTCCGCCAGCCTCACGTCAACGTCGGCTACATCGTCATGTGCCAGATCTTC
ATCGCCTTCGCCGGCGGCACCCTCAACGTGTGCTCGCAGATGGCCGTCATGGCTCCCGTCACCCACCAGCACGTT
GCCGTGGTGCTCGCCATCTTGACCACGTGCTCCTCCATCGGCAACAGCATTGGAGCCGCCGTGGCCAGTGCCGTC
TGGTCTGCCACCTTTCCGCAACGGCTGGCCGAGCTGCTCCCGCCCGAGTCCCAGGCCAATCGGACGGCCATCTAC
GGCAGCCTTTCCGTCCAGCTCTCGTACCCCATCGGCTCGCCCACCCGCGAGGCCATCAGTGAGGCCTACGGCGAC
GCCCAAAGGATGTTGCTCATCGCTGCCACGTGCGCCATGTCCGTTGGCCTCGTTTCCGTCCTCTTCTGGCGCGAC
ATTCGGGTCAAGGATGTCAAACATGTCCAGGGTCAGGTGATTTGA
Transcript >Hirsu2|6932
ATGGGCCACGGGTCGCGAGAGCTCGCGGACGAGGCGCAGCGGCCCGACCCCAAGCTGGAGTCGGTCGGCGACAGC
AGCGAGCCCTACGCCCGTTCGGCCTCGCACGGCAACGACACCGGCTCCGATGCCGATGCGGCCGACGTCCAGGCC
GGCGTGCGCAACGTCGAGGCCACGACCCAGGTCTGGACTCGGAACCACGTCATCGCCGCCTACGTCCTCATCTGG
CTCATCTACTTTGTCGACTCGACCCACCAGGTCATGGCCGGCGGCTTGGATCCCTACGTCACCAGTGCCTTCCGA
CAGCACTCCCTCACGCCCACCACCGGCATCCTGTCTCAGCTCGTCGGCGGCCTTTTCAAACTGCCTCTGGCCAAG
ATCCTCGACATCTGGGGCCGGCCCCAGGGCTTCTCCCTCGCCACCTTGCTCCTGACCGTTGGCTTGGTCATGATG
GCTGCCTGCAAGAATGTCGAGACTTATGCCGCCGCTCAAGTCTTCTACTGGGTTGGCTTCAACGGCATGGGCTAC
ACCATGTCCGTCTTCATCGCCGACACGTCCGCCCTGGAGAACCGCGCCCTCATGTTCGCCTTCCTCTACTCGCCC
TTCATCATCACCTCCTGGATCGGTGGTCCGGTCGGCTCCAGCTTCCTCTACGGCGCCGGCTGGCGCTGGGCCTTT
GGCACCTTTGCCATCGCCACGCCCCTCGTCAGCGTGCCCCTCATCGCTCTCTTCTTATCCAACTTTCGCAAGGCC
AAGGCCAGGGGTCTCGTACCCCGCCGCGAAAAGACTGGCCGCACCTGGCTCGAGTCTGTCAGGCACTACCTGGTC
GAGTTTGATGTGGTCGGACTGCTGCTCATCACCGGCGGCCTTGCCCTTTTCCTCCTGTCCTTCAGCCTGTACGCC
ACCCAGCCCGGCGGCTGGCGCTCGCCCATGATTCTCTGCATGCTCATCTTTGGCCTGCTCCTCCTCATCTCCTTT
GGCGTGTACGAGAGGTTCATGGCCCCCGTACAGTTCCTCCCCTACAAGCTGCTCGTCGACCGCACCATTGCAGGC
GGCATGGTCTTGGCCATCGCCAGGCTGGCCTCCTTTTCCATCTGGATCCGCTTCTTCACCTCTTTTCTCCAGGTT
GTCAACGGACTGTCTTTTACCGAGTCCCTCTACGTCCTGCGGATCCAGACCGTCGGCTCCTGCCTCTGGGCCCTC
CTCGTCGGCCTGCTCATTCGCCAGACGGGCCGCTTCAAGTGGCTCGCCCTCTACTGCGGCGTGCCGCTCGCCGTT
CTCGGCACCGGCCTCATGATCCACTTCCGCCAGCCTCACGTCAACGTCGGCTACATCGTCATGTGCCAGATCTTC
ATCGCCTTCGCCGGCGGCACCCTCAACGTGTGCTCGCAGATGGCCGTCATGGCTCCCGTCACCCACCAGCACGTT
GCCGTGGTGCTCGCCATCTTGACCACGTGCTCCTCCATCGGCAACAGCATTGGAGCCGCCGTGGCCAGTGCCGTC
TGGTCTGCCACCTTTCCGCAACGGCTGGCCGAGCTGCTCCCGCCCGAGTCCCAGGCCAATCGGACGGCCATCTAC
GGCAGCCTTTCCGTCCAGCTCTCGTACCCCATCGGCTCGCCCACCCGCGAGGCCATCAGTGAGGCCTACGGCGAC
GCCCAAAGGATGTTGCTCATCGCTGCCACGTGCGCCATGTCCGTTGGCCTCGTTTCCGTCCTCTTCTGGCGCGAC
ATTCGGGTCAAGGATGTCAAACATGTCCAGGGTCAGGTGATTTGA
Gene >Hirsu2|6932
ATGGGCCACGGGTCGCGAGAGCTCGCGGACGAGGCGCAGCGGCCCGACCCCAAGCTGGAGTCGGTCGGCGACAGC
AGCGAGCCCTACGCCCGTTCGGCCTCGCACGGCAACGACACCGGCTCCGATGCCGATGCGGCCGACGTCCAGGCC
GGCGTGCGCAACGTCGAGGCCACGACCCAGGTCTGGACTCGGAACCACGTCATCGCCGCCTACGTCCTGTTCGTC
TCCTCTCCTGCCCCGTCTCTTCAGCCCGGCTAACCTTGGTCTCTCTAGCATCTGGCTCATCTACTTTGTCGACTC
GACCCACCAGGTCATGGCCGGCGGCTTGGATCCCTACGTCACCAGTGCCTTCCGACAGCACTCCCTCACGCCCAC
CACCGGCATCCTGTCTCAGCTCGTCGGCGGCCTTTTCAAACTGCCTCTGGCCAAGATCCTCGACATCTGGGGCCG
GCCCCAGGGCTTCTCCCTCGCCACCTTGCTCCTGACCGTTGGCTTGGTCATGATGGCTGCCTGCAAGAATGTCGA
GACTTATGCCGCCGCTCAAGTCTTCTACTGGGTTGGGTGAGTTGTTTTGGCTGCGCTCCCTGCGCCATCCTGCCC
CCCCTGCTGACACGGGCCAGCTTCAACGGCATGGGCTACACCATGTCCGTCTTCATCGCCGACACGTCCGCCCTG
GAGAACCGCGCCCTCATGTTCGCCTTCCTCTACTCGCCCTTCATCATCACCTCCTGGATCGGTGGTCCGGTCGGC
TCCAGCTTCCTCTACGGCGCCGGCTGGCGCTGGGCCTTTGGCACCTTTGCCATCGCCACGCCCCTCGTCAGCGTG
CCCCTCATCGCTCTCTTCTTATCCAACTTTCGCAAGGCCAAGGCCAGGGGTCTCGTACCCCGCCGCGAAAAGACT
GGCCGCACCTGGCTCGAGTCTGTCAGGCACTACCTGGTCGAGTTTGATGTGGTCGGACTGCTGCTCATCACCGGC
GGCCTTGCCCTTTTCCTCCTGTCCTTCAGCCTGTACGCCACCCAGCCCGGCGGCTGGCGCTCGCCCATGATTCTC
TGCATGCTCATCTTTGGCCTGCTCCTCCTCATCTCCTTTGGCGTGTACGAGAGGTTCATGGCCCCCGTACAGTTC
CTCCCCTACAAGCTGCTCGTCGACCGCACCATTGCAGGCGGCATGGTCTTGGCCATCGCCAGGCTGGCCTCCTTT
TCCATCTGGATCCGCTTCTTCACCTCTTTTCTCCAGGTTGTCAACGGACTGTCTTTTACCGAGTCCCTCTACGTC
CTGCGGATCCAGACCGTCGGCTCCTGCCTCTGGGCCCTCCTCGTCGGCCTGCTCATTCGCCAGACGGGCCGCTTC
AAGTGGCTCGCCCTCTACTGCGGCGTGCCGCTCGCCGTTCTCGGCACCGGCCTCATGATCCACTTCCGCCAGCCT
CACGTCAACGTCGGCTACATCGTCATGTGCCAGATCTTCATCGCCTTCGCCGGCGGCACCCTCAACGTGTGCTCG
CAGATGGCCGTCATGGCTCCCGTCACCCACCAGCACGTTGCCGTGGTGCTCGCCATCTTGACCACGTGCTCCTCC
ATCGGCAACAGCATTGGAGCCGCCGTGGCCAGTGCCGTCTGGTCTGCCACCTTTCCGCAACGGCTGGCCGAGCTG
CTCCCGCCCGAGTCCCAGGCCAATCGGACGGCCATCTACGGCAGCCTTTCCGTCCAGCTCTCGTACCCCATCGGC
TCGCCCACCCGCGAGGCCATCAGTGAGGCCTACGGCGACGCCCAAAGGATGTTGCTCATCGCTGCCACGTGCGCC
ATGTCCGTTGGCCTCGTTTCCGTCCTCTTCTGGCGCGACATTCGGGTCAAGGATGTCAAACATGTCCAGGGTCAG
GTGATTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail