Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|693
Gene name
LocationContig_114:25337..26584
Strand+
Gene length (bp)1247
Transcript length (bp)1185
Coding sequence length (bp)1185
Protein length (aa) 395

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01331 mRNA_cap_enzyme mRNA capping enzyme, catalytic domain 1.6E-54 46 241
PF03919 mRNA_cap_C mRNA capping enzyme, C-terminal domain 6.1E-32 245 368
PF01068 DNA_ligase_A_M ATP dependent DNA ligase domain 3.6E-06 135 241

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SB53|MCE1_NEUCR mRNA-capping enzyme subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnp-2 PE=3 SV=1 1 385 3.0E-168
sp|P40997|MCE1_SCHPO mRNA-capping enzyme subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ceg1 PE=1 SV=1 4 383 1.0E-102
sp|Q6C783|MCE1_YARLI mRNA-capping enzyme subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CEG1 PE=3 SV=1 15 392 7.0E-92
sp|Q6BT58|MCE1_DEBHA mRNA-capping enzyme subunit alpha OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CEG1 PE=3 SV=2 15 391 1.0E-81
sp|P78587|MCE1_CANAX mRNA-capping enzyme subunit alpha OS=Candida albicans GN=CGT1 PE=1 SV=1 15 383 2.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SB53|MCE1_NEUCR mRNA-capping enzyme subunit alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rnp-2 PE=3 SV=1 1 385 3.0E-168
sp|P40997|MCE1_SCHPO mRNA-capping enzyme subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ceg1 PE=1 SV=1 4 383 1.0E-102
sp|Q6C783|MCE1_YARLI mRNA-capping enzyme subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CEG1 PE=3 SV=1 15 392 7.0E-92
sp|Q6BT58|MCE1_DEBHA mRNA-capping enzyme subunit alpha OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CEG1 PE=3 SV=2 15 391 1.0E-81
sp|P78587|MCE1_CANAX mRNA-capping enzyme subunit alpha OS=Candida albicans GN=CGT1 PE=1 SV=1 15 383 2.0E-81
sp|Q6FQ31|MCE1_CANGA mRNA-capping enzyme subunit alpha OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CEG1 PE=3 SV=1 15 386 2.0E-74
sp|Q6CWR0|MCE1_KLULA mRNA-capping enzyme subunit alpha OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CEG1 PE=3 SV=1 15 383 3.0E-72
sp|Q755D0|MCE1_ASHGO mRNA-capping enzyme subunit alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CEG1 PE=3 SV=1 15 393 6.0E-72
sp|Q01159|MCE1_YEAST mRNA-capping enzyme subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEG1 PE=1 SV=2 15 392 1.0E-71
sp|O60942|MCE1_HUMAN mRNA-capping enzyme OS=Homo sapiens GN=RNGTT PE=1 SV=1 24 369 9.0E-32
sp|Q6NY98|MCE1_DANRE mRNA-capping enzyme OS=Danio rerio GN=rngtt PE=2 SV=1 39 368 2.0E-30
sp|O55236|MCE1_MOUSE mRNA-capping enzyme OS=Mus musculus GN=Rngtt PE=1 SV=1 24 369 2.0E-30
sp|Q17607|MCE1_CAEEL mRNA-capping enzyme OS=Caenorhabditis elegans GN=cel-1 PE=1 SV=2 27 368 3.0E-25
sp|Q84424|MCE_PBCV1 mRNA-capping enzyme OS=Paramecium bursaria Chlorella virus 1 GN=A103R PE=1 SV=1 42 368 2.0E-12
sp|Q5UQX1|MCE_MIMIV Probable mRNA-capping enzyme OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R382 PE=1 SV=1 26 349 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006310 DNA recombination Yes
GO:0006281 DNA repair Yes
GO:0004484 mRNA guanylyltransferase activity Yes
GO:0006370 7-methylguanosine mRNA capping Yes
GO:0005524 ATP binding Yes
GO:0003910 DNA ligase (ATP) activity Yes
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0030554 adenyl nucleotide binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0008192 RNA guanylyltransferase activity No
GO:0016874 ligase activity No
GO:1901363 heterocyclic compound binding No
GO:0016886 ligase activity, forming phosphoric ester bonds No
GO:0044260 cellular macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0036260 RNA capping No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0036094 small molecule binding No
GO:0006950 response to stress No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0051716 cellular response to stimulus No
GO:0032555 purine ribonucleotide binding No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0140097 catalytic activity, acting on DNA No
GO:0050896 response to stimulus No
GO:0003909 DNA ligase activity No
GO:0017076 purine nucleotide binding No
GO:0016071 mRNA metabolic process No
GO:0009452 7-methylguanosine RNA capping No
GO:0097367 carbohydrate derivative binding No
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006396 RNA processing No
GO:0044237 cellular metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0003674 molecular_function No
GO:0016779 nucleotidyltransferase activity No
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:0006259 DNA metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0000166 nucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032559 adenyl ribonucleotide binding No
GO:0070568 guanylyltransferase activity No
GO:0043167 ion binding No
GO:0044238 primary metabolic process No
GO:0033554 cellular response to stress No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006397 mRNA processing No
GO:0016070 RNA metabolic process No
GO:0016740 transferase activity No
GO:1901265 nucleoside phosphate binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.4998 0.631 0.1909 0.0109 0.1536 0.0069 0.2555 0.0221 0.0235 0.0189

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5536
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4519
Ophiocordyceps australis map64 (Brazil) OphauB2|6160
Ophiocordyceps camponoti-floridani Ophcf2|06474
Ophiocordyceps kimflemingae Ophio5|6748
Ophiocordyceps subramaniannii Hirsu2|693 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|693
MEQPPDGPISSIAEPGVKAGGQLLYSMRKEVADLLGRHQTSFPGAQPVSFARQHVDELTKQDYYVCEKSDGIRYL
LYSTADENGEEAHYLIDRKNDYWFITNRNLHFPLVNDLSAFHTATLVDGELVWDSLPNDKKEPRFLVFDCLVMDG
NKLMDRTLDKRLAYFKERFYTPYKKLFKEFPNELQFQPFFVEMKPFQLAYGIEMMFKQVLPSLKHGNDGLIFTCR
NTPYKHGTDPHILKWKPPEENTIDFRLKLTFPTVEPDEWERREGIAEPFVDYDSVPKAELMIFKGDSGDRYELFS
PLHLTEEEWEALKGLNDPLNDRIVECNQDDQGRWRLVRFRDDKSEANHKSTVVSVLESISDRVSEKDLYRAAGPM
RDSWKARQARADHESRRGR*
Coding >Hirsu2|693
ATGGAGCAGCCCCCCGACGGCCCCATCAGCTCCATCGCCGAGCCGGGCGTCAAGGCCGGCGGCCAGCTCCTCTAC
TCGATGCGCAAGGAAGTGGCCGACTTGCTGGGCAGACACCAGACGAGCTTCCCCGGCGCGCAACCGGTCAGCTTC
GCGAGGCAGCACGTGGACGAGCTGACGAAGCAAGATTACTACGTGTGCGAGAAGTCGGACGGCATCCGCTATCTC
CTCTACTCGACGGCCGACGAGAACGGCGAGGAGGCCCACTACCTGATTGACCGCAAGAATGACTACTGGTTCATC
ACCAACAGGAACCTCCATTTCCCCCTCGTCAACGACCTCAGTGCCTTCCACACGGCGACGCTCGTCGACGGCGAG
CTCGTCTGGGACAGCCTGCCCAACGACAAGAAGGAGCCGCGCTTTCTCGTCTTTGACTGCCTCGTCATGGACGGG
AACAAGCTCATGGATCGCACCTTGGACAAGCGCCTGGCCTATTTCAAAGAACGCTTCTACACGCCCTATAAGAAG
CTATTCAAGGAGTTCCCCAACGAGCTCCAGTTCCAGCCCTTCTTCGTCGAGATGAAGCCCTTCCAGCTCGCGTAC
GGCATCGAAATGATGTTCAAGCAGGTCCTGCCGAGCCTCAAGCACGGCAACGACGGGCTCATCTTCACCTGTCGC
AACACGCCCTACAAGCACGGCACGGATCCCCACATCCTCAAGTGGAAGCCGCCCGAGGAGAACACCATCGACTTT
CGCCTCAAGCTGACCTTCCCCACCGTCGAGCCGGACGAGTGGGAGAGGAGGGAGGGCATAGCCGAGCCCTTTGTC
GACTACGACAGCGTCCCCAAGGCCGAGCTGATGATTTTCAAGGGAGACAGTGGCGACCGCTACGAGCTGTTCAGC
CCGCTGCACCTCACCGAGGAGGAGTGGGAGGCGCTCAAGGGCCTCAACGACCCCCTGAACGACCGCATCGTCGAA
TGCAACCAAGACGACCAGGGGCGCTGGCGCCTGGTCCGCTTCCGCGACGACAAGAGCGAGGCGAACCACAAGAGC
ACCGTCGTCAGCGTCCTCGAGAGCATCAGCGACCGCGTGTCGGAGAAGGACCTCTACCGGGCGGCAGGGCCCATG
CGGGACAGCTGGAAAGCCCGCCAGGCCCGAGCAGATCACGAGAGCAGACGTGGACGGTAA
Transcript >Hirsu2|693
ATGGAGCAGCCCCCCGACGGCCCCATCAGCTCCATCGCCGAGCCGGGCGTCAAGGCCGGCGGCCAGCTCCTCTAC
TCGATGCGCAAGGAAGTGGCCGACTTGCTGGGCAGACACCAGACGAGCTTCCCCGGCGCGCAACCGGTCAGCTTC
GCGAGGCAGCACGTGGACGAGCTGACGAAGCAAGATTACTACGTGTGCGAGAAGTCGGACGGCATCCGCTATCTC
CTCTACTCGACGGCCGACGAGAACGGCGAGGAGGCCCACTACCTGATTGACCGCAAGAATGACTACTGGTTCATC
ACCAACAGGAACCTCCATTTCCCCCTCGTCAACGACCTCAGTGCCTTCCACACGGCGACGCTCGTCGACGGCGAG
CTCGTCTGGGACAGCCTGCCCAACGACAAGAAGGAGCCGCGCTTTCTCGTCTTTGACTGCCTCGTCATGGACGGG
AACAAGCTCATGGATCGCACCTTGGACAAGCGCCTGGCCTATTTCAAAGAACGCTTCTACACGCCCTATAAGAAG
CTATTCAAGGAGTTCCCCAACGAGCTCCAGTTCCAGCCCTTCTTCGTCGAGATGAAGCCCTTCCAGCTCGCGTAC
GGCATCGAAATGATGTTCAAGCAGGTCCTGCCGAGCCTCAAGCACGGCAACGACGGGCTCATCTTCACCTGTCGC
AACACGCCCTACAAGCACGGCACGGATCCCCACATCCTCAAGTGGAAGCCGCCCGAGGAGAACACCATCGACTTT
CGCCTCAAGCTGACCTTCCCCACCGTCGAGCCGGACGAGTGGGAGAGGAGGGAGGGCATAGCCGAGCCCTTTGTC
GACTACGACAGCGTCCCCAAGGCCGAGCTGATGATTTTCAAGGGAGACAGTGGCGACCGCTACGAGCTGTTCAGC
CCGCTGCACCTCACCGAGGAGGAGTGGGAGGCGCTCAAGGGCCTCAACGACCCCCTGAACGACCGCATCGTCGAA
TGCAACCAAGACGACCAGGGGCGCTGGCGCCTGGTCCGCTTCCGCGACGACAAGAGCGAGGCGAACCACAAGAGC
ACCGTCGTCAGCGTCCTCGAGAGCATCAGCGACCGCGTGTCGGAGAAGGACCTCTACCGGGCGGCAGGGCCCATG
CGGGACAGCTGGAAAGCCCGCCAGGCCCGAGCAGATCACGAGAGCAGACGTGGACGGTAA
Gene >Hirsu2|693
ATGGAGCAGCCCCCCGACGGCCCCATCAGCTCCATCGCCGAGCCGGGCGTCAAGGCCGGCGGCCAGCTCCTCTAC
TCGATGCGCAAGGAAGTGGCCGACTTGCTGGGCAGACACCAGACGAGCTTCCCCGGCGCGCAACCGGTCAGCTTC
GCGAGGCAGCACGTGGACGAGCTGACGAAGCAAGAGTAGGGCTCCGGCAGCGCATCGAGGGCCGGACGCGAGCGA
TGCTGACGTCGCGCCTCTCCAGTTACTACGTGTGCGAGAAGTCGGACGGCATCCGCTATCTCCTCTACTCGACGG
CCGACGAGAACGGCGAGGAGGCCCACTACCTGATTGACCGCAAGAATGACTACTGGTTCATCACCAACAGGAACC
TCCATTTCCCCCTCGTCAACGACCTCAGTGCCTTCCACACGGCGACGCTCGTCGACGGCGAGCTCGTCTGGGACA
GCCTGCCCAACGACAAGAAGGAGCCGCGCTTTCTCGTCTTTGACTGCCTCGTCATGGACGGGAACAAGCTCATGG
ATCGCACCTTGGACAAGCGCCTGGCCTATTTCAAAGAACGCTTCTACACGCCCTATAAGAAGCTATTCAAGGAGT
TCCCCAACGAGCTCCAGTTCCAGCCCTTCTTCGTCGAGATGAAGCCCTTCCAGCTCGCGTACGGCATCGAAATGA
TGTTCAAGCAGGTCCTGCCGAGCCTCAAGCACGGCAACGACGGGCTCATCTTCACCTGTCGCAACACGCCCTACA
AGCACGGCACGGATCCCCACATCCTCAAGTGGAAGCCGCCCGAGGAGAACACCATCGACTTTCGCCTCAAGCTGA
CCTTCCCCACCGTCGAGCCGGACGAGTGGGAGAGGAGGGAGGGCATAGCCGAGCCCTTTGTCGACTACGACAGCG
TCCCCAAGGCCGAGCTGATGATTTTCAAGGGAGACAGTGGCGACCGCTACGAGCTGTTCAGCCCGCTGCACCTCA
CCGAGGAGGAGTGGGAGGCGCTCAAGGGCCTCAACGACCCCCTGAACGACCGCATCGTCGAATGCAACCAAGACG
ACCAGGGGCGCTGGCGCCTGGTCCGCTTCCGCGACGACAAGAGCGAGGCGAACCACAAGAGCACCGTCGTCAGCG
TCCTCGAGAGCATCAGCGACCGCGTGTCGGAGAAGGACCTCTACCGGGCGGCAGGGCCCATGCGGGACAGCTGGA
AAGCCCGCCAGGCCCGAGCAGATCACGAGAGCAGACGTGGACGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail