Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6915
Gene name
LocationContig_376:13555..14632
Strand-
Gene length (bp)1077
Transcript length (bp)1077
Coding sequence length (bp)1077
Protein length (aa) 359

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 3.0E-12 189 337

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0090729 toxin activity Yes
GO:0005615 extracellular space Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1939 0.0974 0.8142 0.1765 0.0717 0.0265 0.5736 0.387 0.3659 0.0043

SignalP

SignalP signal predicted Location Score
Yes 1 - 27 0.99968

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup302
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|04574
Ophiocordyceps camponoti-rufipedis Ophun1|6775
Ophiocordyceps subramaniannii Hirsu2|10481
Ophiocordyceps subramaniannii Hirsu2|10922
Ophiocordyceps subramaniannii Hirsu2|1355
Ophiocordyceps subramaniannii Hirsu2|4943
Ophiocordyceps subramaniannii Hirsu2|5941
Ophiocordyceps subramaniannii Hirsu2|6284
Ophiocordyceps subramaniannii Hirsu2|6707
Ophiocordyceps subramaniannii Hirsu2|6915 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8820

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6915
MPVYPRWTALVLFLGLCLLHWPRLSFGLDQKLGEISDAEPKSVHVDSQSSESLSPEKLHESPDTPTSSISPSTTK
RPGWKDVGFKPKGPPPLGPPPKIVYRSGKLSPDEIKARGGIYEGTGKPSTNENHGFSIWAHHCELFTDPDTGEYG
CDFAGLAPDRYPKRKTYTAYTATSRAFGTSLGFATTGGPGWVYKIQATPNMIDVDGTLLDYRFYENEYEFVALGG
VHYGQILGSIPVPGGLTTQDFIEGSNCRACIVNVTTEMFMKKFPDRKFTANPDYDPKFDNFEASPGQPQLAGWLD
KAKVLNNVEPWSKYQNSNKTLEDFAREFMDNMSDEAKAAVGWNGTFPLKFKTYPDHRG*
Coding >Hirsu2|6915
ATGCCTGTCTACCCGCGATGGACTGCGTTGGTCCTTTTTCTAGGACTGTGTTTGCTACACTGGCCACGTCTCAGC
TTTGGTCTCGATCAAAAGCTGGGTGAAATATCTGATGCTGAACCGAAGTCTGTCCATGTGGATAGTCAGTCGTCT
GAATCTTTGAGTCCTGAGAAACTGCATGAATCTCCCGATACCCCGACATCATCGATATCTCCGAGTACCACGAAA
AGACCGGGCTGGAAAGATGTCGGATTCAAGCCGAAGGGACCTCCCCCGTTGGGGCCGCCGCCAAAAATTGTCTAT
CGCAGCGGCAAATTGTCCCCAGATGAGATTAAAGCGCGGGGCGGAATCTACGAGGGCACGGGCAAGCCTTCAACA
AACGAGAACCACGGGTTCAGCATATGGGCTCATCATTGCGAGCTATTTACCGATCCAGACACTGGAGAGTATGGG
TGCGATTTCGCGGGGTTGGCTCCTGATAGGTATCCGAAACGGAAAACCTATACAGCTTATACTGCAACCTCGCGA
GCGTTTGGTACATCATTGGGGTTCGCCACCACTGGAGGTCCGGGCTGGGTCTATAAGATTCAGGCTACACCAAAC
ATGATTGATGTGGACGGAACACTTCTTGATTATCGGTTCTACGAAAACGAATATGAATTCGTGGCCCTGGGAGGA
GTACACTACGGCCAAATCCTGGGTTCTATACCTGTTCCCGGGGGCCTAACCACTCAGGACTTTATCGAAGGCTCA
AACTGCCGCGCGTGCATCGTTAACGTAACCACCGAAATGTTTATGAAAAAATTTCCCGACCGCAAATTCACTGCT
AACCCGGATTATGACCCAAAGTTCGATAACTTCGAGGCCAGCCCAGGGCAGCCGCAGTTAGCTGGCTGGCTCGAC
AAAGCAAAGGTGTTAAACAATGTGGAACCATGGAGCAAGTATCAGAACTCGAACAAGACGTTGGAAGATTTCGCC
AGGGAATTCATGGACAACATGAGCGACGAGGCCAAGGCCGCCGTGGGTTGGAATGGTACTTTCCCGCTGAAGTTC
AAGACGTATCCCGATCACCGTGGATGA
Transcript >Hirsu2|6915
ATGCCTGTCTACCCGCGATGGACTGCGTTGGTCCTTTTTCTAGGACTGTGTTTGCTACACTGGCCACGTCTCAGC
TTTGGTCTCGATCAAAAGCTGGGTGAAATATCTGATGCTGAACCGAAGTCTGTCCATGTGGATAGTCAGTCGTCT
GAATCTTTGAGTCCTGAGAAACTGCATGAATCTCCCGATACCCCGACATCATCGATATCTCCGAGTACCACGAAA
AGACCGGGCTGGAAAGATGTCGGATTCAAGCCGAAGGGACCTCCCCCGTTGGGGCCGCCGCCAAAAATTGTCTAT
CGCAGCGGCAAATTGTCCCCAGATGAGATTAAAGCGCGGGGCGGAATCTACGAGGGCACGGGCAAGCCTTCAACA
AACGAGAACCACGGGTTCAGCATATGGGCTCATCATTGCGAGCTATTTACCGATCCAGACACTGGAGAGTATGGG
TGCGATTTCGCGGGGTTGGCTCCTGATAGGTATCCGAAACGGAAAACCTATACAGCTTATACTGCAACCTCGCGA
GCGTTTGGTACATCATTGGGGTTCGCCACCACTGGAGGTCCGGGCTGGGTCTATAAGATTCAGGCTACACCAAAC
ATGATTGATGTGGACGGAACACTTCTTGATTATCGGTTCTACGAAAACGAATATGAATTCGTGGCCCTGGGAGGA
GTACACTACGGCCAAATCCTGGGTTCTATACCTGTTCCCGGGGGCCTAACCACTCAGGACTTTATCGAAGGCTCA
AACTGCCGCGCGTGCATCGTTAACGTAACCACCGAAATGTTTATGAAAAAATTTCCCGACCGCAAATTCACTGCT
AACCCGGATTATGACCCAAAGTTCGATAACTTCGAGGCCAGCCCAGGGCAGCCGCAGTTAGCTGGCTGGCTCGAC
AAAGCAAAGGTGTTAAACAATGTGGAACCATGGAGCAAGTATCAGAACTCGAACAAGACGTTGGAAGATTTCGCC
AGGGAATTCATGGACAACATGAGCGACGAGGCCAAGGCCGCCGTGGGTTGGAATGGTACTTTCCCGCTGAAGTTC
AAGACGTATCCCGATCACCGTGGATGA
Gene >Hirsu2|6915
ATGCCTGTCTACCCGCGATGGACTGCGTTGGTCCTTTTTCTAGGACTGTGTTTGCTACACTGGCCACGTCTCAGC
TTTGGTCTCGATCAAAAGCTGGGTGAAATATCTGATGCTGAACCGAAGTCTGTCCATGTGGATAGTCAGTCGTCT
GAATCTTTGAGTCCTGAGAAACTGCATGAATCTCCCGATACCCCGACATCATCGATATCTCCGAGTACCACGAAA
AGACCGGGCTGGAAAGATGTCGGATTCAAGCCGAAGGGACCTCCCCCGTTGGGGCCGCCGCCAAAAATTGTCTAT
CGCAGCGGCAAATTGTCCCCAGATGAGATTAAAGCGCGGGGCGGAATCTACGAGGGCACGGGCAAGCCTTCAACA
AACGAGAACCACGGGTTCAGCATATGGGCTCATCATTGCGAGCTATTTACCGATCCAGACACTGGAGAGTATGGG
TGCGATTTCGCGGGGTTGGCTCCTGATAGGTATCCGAAACGGAAAACCTATACAGCTTATACTGCAACCTCGCGA
GCGTTTGGTACATCATTGGGGTTCGCCACCACTGGAGGTCCGGGCTGGGTCTATAAGATTCAGGCTACACCAAAC
ATGATTGATGTGGACGGAACACTTCTTGATTATCGGTTCTACGAAAACGAATATGAATTCGTGGCCCTGGGAGGA
GTACACTACGGCCAAATCCTGGGTTCTATACCTGTTCCCGGGGGCCTAACCACTCAGGACTTTATCGAAGGCTCA
AACTGCCGCGCGTGCATCGTTAACGTAACCACCGAAATGTTTATGAAAAAATTTCCCGACCGCAAATTCACTGCT
AACCCGGATTATGACCCAAAGTTCGATAACTTCGAGGCCAGCCCAGGGCAGCCGCAGTTAGCTGGCTGGCTCGAC
AAAGCAAAGGTGTTAAACAATGTGGAACCATGGAGCAAGTATCAGAACTCGAACAAGACGTTGGAAGATTTCGCC
AGGGAATTCATGGACAACATGAGCGACGAGGCCAAGGCCGCCGTGGGTTGGAATGGTACTTTCCCGCTGAAGTTC
AAGACGTATCCCGATCACCGTGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail