Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6904
Gene name
LocationContig_375:3531..5108
Strand-
Gene length (bp)1577
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04188 Mannosyl_trans2 Mannosyltransferase (PIG-V) 5.7E-51 83 424

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I0K3|GPI18_GIBZE GPI mannosyltransferase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GPI18 PE=3 SV=1 29 435 5.0E-146
sp|Q2GSI6|GPI18_CHAGB GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=GPI18 PE=3 SV=1 29 439 1.0E-99
sp|Q2UJS7|GPI18_ASPOR GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpi18 PE=3 SV=1 18 413 2.0E-85
sp|Q4WQ21|GPI18_ASPFU GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gpi18 PE=3 SV=1 24 426 5.0E-77
sp|Q6C216|GPI18_YARLI GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPI18 PE=3 SV=1 34 414 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I0K3|GPI18_GIBZE GPI mannosyltransferase 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GPI18 PE=3 SV=1 29 435 5.0E-146
sp|Q2GSI6|GPI18_CHAGB GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=GPI18 PE=3 SV=1 29 439 1.0E-99
sp|Q2UJS7|GPI18_ASPOR GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpi18 PE=3 SV=1 18 413 2.0E-85
sp|Q4WQ21|GPI18_ASPFU GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gpi18 PE=3 SV=1 24 426 5.0E-77
sp|Q6C216|GPI18_YARLI GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPI18 PE=3 SV=1 34 414 1.0E-38
sp|Q09712|GPI18_SCHPO GPI mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi18 PE=3 SV=2 87 424 3.0E-32
sp|Q5KR61|PIGV_RAT GPI mannosyltransferase 2 OS=Rattus norvegicus GN=Pigv PE=2 SV=1 78 430 2.0E-28
sp|Q59VN0|GPI18_CANAL GPI mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPI18 PE=3 SV=1 41 420 3.0E-26
sp|Q7TPN3|PIGV_MOUSE GPI mannosyltransferase 2 OS=Mus musculus GN=Pigv PE=2 SV=2 78 426 1.0E-25
sp|Q9NUD9|PIGV_HUMAN GPI mannosyltransferase 2 OS=Homo sapiens GN=PIGV PE=1 SV=1 78 426 1.0E-25
sp|Q6BRZ9|GPI18_DEBHA GPI mannosyltransferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GPI18 PE=3 SV=1 30 434 2.0E-25
sp|Q6FWN4|GPI18_CANGA GPI mannosyltransferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPI18 PE=3 SV=1 49 425 2.0E-25
sp|Q290J8|PIGV_DROPS GPI mannosyltransferase 2 OS=Drosophila pseudoobscura pseudoobscura GN=GA19757 PE=3 SV=1 83 414 1.0E-24
sp|P0CP62|GPI18_CRYNJ GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GPI18 PE=3 SV=1 87 417 3.0E-24
sp|P0CP63|GPI18_CRYNB GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GPI18 PE=3 SV=1 87 417 9.0E-24
sp|Q757K7|GPI18_ASHGO GPI mannosyltransferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI18 PE=3 SV=1 56 419 2.0E-23
sp|Q9V7W1|PIGV_DROME GPI mannosyltransferase 2 OS=Drosophila melanogaster GN=CG44239 PE=1 SV=1 83 433 4.0E-23
sp|Q6CMW6|GPI18_KLULA GPI mannosyltransferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GPI18 PE=3 SV=1 49 435 7.0E-20
sp|P38211|GPI18_YEAST GPI mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI18 PE=1 SV=2 60 427 1.0E-13
sp|O02164|PIGV1_CAEEL GPI mannosyltransferase pigv-1 OS=Caenorhabditis elegans GN=pigv-1 PE=1 SV=1 84 243 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006506 GPI anchor biosynthetic process Yes
GO:0004584 dolichyl-phosphate-mannose-glycolipid alpha-mannosyltransferase activity Yes
GO:0006644 phospholipid metabolic process No
GO:0006464 cellular protein modification process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0016758 transferase activity, transferring hexosyl groups No
GO:1903509 liposaccharide metabolic process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0046467 membrane lipid biosynthetic process No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0009058 biosynthetic process No
GO:0019538 protein metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0006664 glycolipid metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0006497 protein lipidation No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0044267 cellular protein metabolic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0008610 lipid biosynthetic process No
GO:0008654 phospholipid biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0006505 GPI anchor metabolic process No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0046486 glycerolipid metabolic process No
GO:0000030 mannosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 135 157 22
3 164 183 19
4 188 205 17
5 212 231 19
6 259 281 22
7 335 354 19
8 374 396 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6904
MGERAGHHGALASSRLEAMSRPSLFFSPSQPIRSLTALFALWKGFLLAVALGAAALGPGYDTSTSLFAQRLYGSR
ARVPAVAAALTRWDALYYMHYVRSGYVYEQEWAFGAAMPLLVRALAAAIPSAGHQLEPLLAVVVAHASHLAAVLA
LYRLTAVVCGDARIAFISSALHILSPAGLFLSAPYAESPFAALSFVGCLLFALGIKNKHRAATRAAAVIGAGVVF
GLATAFRSNGLSSGLLFAVGALRCLVVFARSPTWSRLLALAAPVIGGLCVALGSVIPQALAWKRYCRDSPAELEV
RPWCLRTVPSIYTFVQSEYWNVGFLRYWTLNQLPLFLLASPMLAILITSGFAVLRNPESGLPFLKHKPGQDYGMF
ARALALSQTLVALLAITNYHVQVITRLSSGYPLWYWWVAACLVDPEKRRRAQAVAFFMILAMLETLFDQQDVPAR
QPWASADDGAE*
Coding >Hirsu2|6904
ATGGGGGAGCGAGCAGGGCATCACGGAGCCCTCGCCAGCTCGAGGCTCGAGGCCATGAGCCGGCCGAGCCTGTTC
TTCTCGCCGTCCCAGCCCATCCGGTCCCTGACGGCCCTGTTCGCGCTCTGGAAAGGCTTCCTGCTGGCGGTCGCG
CTCGGTGCCGCCGCCCTCGGGCCCGGATACGACACGTCCACCTCGCTCTTCGCCCAGCGCCTGTACGGCAGCCGG
GCGCGCGTGCCGGCAGTGGCCGCGGCGCTGACGCGATGGGATGCCCTCTATTACATGCACTACGTCCGCAGCGGC
TACGTCTACGAGCAGGAGTGGGCGTTTGGGGCGGCCATGCCGCTGCTCGTCCGCGCCCTCGCCGCTGCCATCCCG
TCGGCCGGCCACCAGCTGGAGCCTCTGCTGGCCGTCGTCGTCGCTCACGCCTCCCACCTGGCGGCCGTCCTGGCC
CTTTATCGATTGACGGCTGTCGTCTGCGGCGACGCGAGGATCGCCTTTATCTCGTCCGCGCTCCACATCCTTTCG
CCCGCCGGCCTCTTCCTCTCTGCTCCCTACGCCGAGAGCCCCTTTGCCGCCCTGTCCTTCGTCGGCTGCCTGCTG
TTTGCCCTCGGCATCAAGAACAAGCATAGAGCGGCGACGCGGGCGGCCGCCGTCATCGGCGCCGGCGTCGTCTTC
GGCCTGGCCACCGCGTTCCGGAGCAACGGCCTGTCCAGCGGCCTCCTCTTCGCCGTCGGGGCCCTCCGCTGCCTT
GTCGTCTTCGCGAGGAGTCCTACCTGGTCGAGGCTCTTGGCCCTTGCCGCCCCCGTCATCGGCGGACTCTGTGTC
GCCCTCGGTTCCGTGATCCCGCAAGCCTTGGCGTGGAAGCGCTACTGCCGTGACTCTCCAGCGGAGCTTGAAGTG
CGGCCTTGGTGTTTGCGCACCGTGCCCAGCATCTACACCTTCGTACAAAGCGAGTATTGGAATGTCGGCTTTTTG
AGATACTGGACCCTGAACCAGCTGCCACTGTTCCTGCTTGCCAGCCCCATGCTCGCCATCCTCATCACGTCGGGT
TTTGCCGTCCTGCGAAATCCAGAATCGGGGCTTCCGTTCCTGAAACACAAACCCGGCCAGGACTACGGCATGTTC
GCTCGCGCACTGGCGTTGAGCCAGACGCTGGTGGCCCTGCTGGCCATCACCAACTACCACGTCCAGGTCATCACT
CGCCTGTCTTCGGGCTACCCGCTATGGTACTGGTGGGTTGCGGCCTGCCTTGTGGACCCGGAGAAGCGGCGACGG
GCACAGGCCGTGGCCTTCTTCATGATACTAGCAATGCTGGAGACGCTATTTGACCAGCAAGACGTGCCCGCCCGC
CAGCCTTGGGCGTCGGCCGATGATGGAGCAGAATGA
Transcript >Hirsu2|6904
ATGGGGGAGCGAGCAGGGCATCACGGAGCCCTCGCCAGCTCGAGGCTCGAGGCCATGAGCCGGCCGAGCCTGTTC
TTCTCGCCGTCCCAGCCCATCCGGTCCCTGACGGCCCTGTTCGCGCTCTGGAAAGGCTTCCTGCTGGCGGTCGCG
CTCGGTGCCGCCGCCCTCGGGCCCGGATACGACACGTCCACCTCGCTCTTCGCCCAGCGCCTGTACGGCAGCCGG
GCGCGCGTGCCGGCAGTGGCCGCGGCGCTGACGCGATGGGATGCCCTCTATTACATGCACTACGTCCGCAGCGGC
TACGTCTACGAGCAGGAGTGGGCGTTTGGGGCGGCCATGCCGCTGCTCGTCCGCGCCCTCGCCGCTGCCATCCCG
TCGGCCGGCCACCAGCTGGAGCCTCTGCTGGCCGTCGTCGTCGCTCACGCCTCCCACCTGGCGGCCGTCCTGGCC
CTTTATCGATTGACGGCTGTCGTCTGCGGCGACGCGAGGATCGCCTTTATCTCGTCCGCGCTCCACATCCTTTCG
CCCGCCGGCCTCTTCCTCTCTGCTCCCTACGCCGAGAGCCCCTTTGCCGCCCTGTCCTTCGTCGGCTGCCTGCTG
TTTGCCCTCGGCATCAAGAACAAGCATAGAGCGGCGACGCGGGCGGCCGCCGTCATCGGCGCCGGCGTCGTCTTC
GGCCTGGCCACCGCGTTCCGGAGCAACGGCCTGTCCAGCGGCCTCCTCTTCGCCGTCGGGGCCCTCCGCTGCCTT
GTCGTCTTCGCGAGGAGTCCTACCTGGTCGAGGCTCTTGGCCCTTGCCGCCCCCGTCATCGGCGGACTCTGTGTC
GCCCTCGGTTCCGTGATCCCGCAAGCCTTGGCGTGGAAGCGCTACTGCCGTGACTCTCCAGCGGAGCTTGAAGTG
CGGCCTTGGTGTTTGCGCACCGTGCCCAGCATCTACACCTTCGTACAAAGCGAGTATTGGAATGTCGGCTTTTTG
AGATACTGGACCCTGAACCAGCTGCCACTGTTCCTGCTTGCCAGCCCCATGCTCGCCATCCTCATCACGTCGGGT
TTTGCCGTCCTGCGAAATCCAGAATCGGGGCTTCCGTTCCTGAAACACAAACCCGGCCAGGACTACGGCATGTTC
GCTCGCGCACTGGCGTTGAGCCAGACGCTGGTGGCCCTGCTGGCCATCACCAACTACCACGTCCAGGTCATCACT
CGCCTGTCTTCGGGCTACCCGCTATGGTACTGGTGGGTTGCGGCCTGCCTTGTGGACCCGGAGAAGCGGCGACGG
GCACAGGCCGTGGCCTTCTTCATGATACTAGCAATGCTGGAGACGCTATTTGACCAGCAAGACGTGCCCGCCCGC
CAGCCTTGGGCGTCGGCCGATGATGGAGCAGAATGA
Gene >Hirsu2|6904
ATGGGGGAGCGAGCAGGGCATCACGGAGCCCTCGCCAGCTCGAGGCTCGAGGCCATGAGCCGGCCGAGCCTGTTC
TTCTCGCCGTCCCAGCCCATCCGGTCCCTGACGGCCCTGTTCGCGCTCTGGAAAGGCTTCCTGCTGGCGGTCGCG
CTCGGTGCCGCCGCCCTCGGGCCCGGATACGACACGTCCACCTCGCTCTTCGCCCAGCGCCTGTACGGCAGCCGG
GCGCGCGTGCCGGCAGTGGCCGCGGCGCTGACGCGATGGGATGCCCTCTATTACATGCACTACGTCCGCAGCGGC
TACGTCTACGAGCAGGAGTGGGCGTTTGGGGCGGCCATGCCGCTGCTCGTCCGCGCCCTCGCCGCTGCCATCCCG
TCGGCCGGCCACCAGCTGGAGCCTCTGCTGGCCGTCGTCGTCGCTCACGCCTCCCACCTGGCGGCCGTCCTGGCC
CTTTATCGATTGACGGCTGTCGTCTGCGGCGACGCGAGGATCGCCTTTATCTCGTCCGCGCTCCACATCCTTTCG
CCCGCCGGCCTCTTCCTCTCTGCTCCCTACGCCGAGAGCCCCTTTGCCGCCCTGTCCTTCGTCGGCTGCCTGCTG
TTTGCCCTCGGCATCAAGAACAAGCATAGAGCGGCGACGCGGGCGGCCGCCGTCATCGGCGCCGGCGTCGTCTTC
GGCCTGGCCACCGCGTTCCGGAGCAACGGCCTGTCCAGCGGCCTCCTCTTCGCCGTCGGGGCCCTCCGCTGCCTT
GTCGTCTTCGCGAGGAGTCCTACCTGGTCGAGGCTCTTGGCCCTTGCCGCCCCCGTCATCGGCGGACTCTGTGTC
GCCCTCGGTTCCGTGATCCCGCAAGCCTTGGCGTGGAAGCGCTACTGCCGTGACTCTCCAGCGGAGCTTGAAGTG
CGGCCTTGGTGTTTGCGCACCGTGCCCAGCATCTACACCTTCGTACAAAGCGAGTATTGGTGAGTTTGTCTCGGC
CCATCCCAGCCACAGTGCCCTCTTCTCACCAGCCGGCCCGTCCCTTTCCAGGAATGTCGGCTTTTTGAGATACTG
GACCCTGAACCAGCTGCCACTGTTCCTGCTTGCCAGCCCCATGCTCGCCATCCTCATCACGTCGGGTTTTGCCGT
CCTGCGAAATCCAGAATCGGGGCTTCCGTTCCTGAAACACAAACCCGGCCAGGACTACGGCATGTTCGCTCGCGC
ACTGGCGTTGAGCCAGACGCTGGTGGCCCTGCTGGCCATCACCAACTACCACGTCCAGGTCATCACTCGCCTGTC
TTCGGGCTACCCGCTATGGTACTGGTGGGTTGCGGCCTGCCTTGTGGACCCGGAGAAGCGGCGACGGGCACAGGC
CGTGGCCTTCTTCATGATACTGTATGCCGGCGTTCAGGGCGCTTTGTTTGCGTCTTTCCTCCCCCCCGCATGAAG
ATCTAGACAAGAGCAATGCTGGAGACGCTATTTGACCAGGTAGAAGGACTCGTGAATGATGAAGCAGTTTGGTTG
GTGACGCTGACGGTGTGTCGCAGCAAGACGTGCCCGCCCGCCAGCCTTGGGCGTCGGCCGATGATGGAGCAGAAT
GA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail