Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6903
Gene name
LocationContig_375:875..2504
Strand-
Gene length (bp)1629
Transcript length (bp)1524
Coding sequence length (bp)1524
Protein length (aa) 508

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01554 MatE MatE 2.1E-33 172 332
PF01554 MatE MatE 2.9E-09 394 465

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38767|ERC1_YEAST Ethionine resistance-conferring protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERC1 PE=1 SV=1 110 465 4.0E-97
sp|Q05497|YD338_YEAST Uncharacterized transporter YDR338C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR338C PE=1 SV=1 41 465 4.0E-82
sp|Q9USK3|YJ2D_SCHPO Uncharacterized transporter C4B3.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.13 PE=3 SV=1 135 465 1.0E-77
sp|Q9UT92|YL47_SCHPO Uncharacterized transporter C323.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC323.07c PE=1 SV=1 160 465 2.0E-66
sp|Q10085|YAO6_SCHPO Uncharacterized transporter C11D3.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.06 PE=3 SV=1 162 465 1.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38767|ERC1_YEAST Ethionine resistance-conferring protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERC1 PE=1 SV=1 110 465 4.0E-97
sp|Q05497|YD338_YEAST Uncharacterized transporter YDR338C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR338C PE=1 SV=1 41 465 4.0E-82
sp|Q9USK3|YJ2D_SCHPO Uncharacterized transporter C4B3.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.13 PE=3 SV=1 135 465 1.0E-77
sp|Q9UT92|YL47_SCHPO Uncharacterized transporter C323.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC323.07c PE=1 SV=1 160 465 2.0E-66
sp|Q10085|YAO6_SCHPO Uncharacterized transporter C11D3.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.06 PE=3 SV=1 162 465 1.0E-46
sp|Q3V050|S47A2_MOUSE Multidrug and toxin extrusion protein 2 OS=Mus musculus GN=Slc47a2 PE=1 SV=1 153 466 1.0E-43
sp|A4IIS8|S47A1_XENTR Multidrug and toxin extrusion protein 1 OS=Xenopus tropicalis GN=slc47a1 PE=2 SV=1 185 466 9.0E-42
sp|Q9C9U1|DTX17_ARATH Protein DETOXIFICATION 17 OS=Arabidopsis thaliana GN=DTX17 PE=2 SV=1 160 466 6.0E-41
sp|Q9FHB6|DTX16_ARATH Protein DETOXIFICATION 16 OS=Arabidopsis thaliana GN=DTX16 PE=2 SV=1 156 466 5.0E-40
sp|F4IHU9|DTX15_ARATH Protein DETOXIFICATION 15 OS=Arabidopsis thaliana GN=DTX15 PE=3 SV=1 160 466 5.0E-38
sp|A1L1P9|S47A1_DANRE Multidrug and toxin extrusion protein 1 OS=Danio rerio GN=slc47a1 PE=2 SV=1 131 465 4.0E-37
sp|Q8K0H1|S47A1_MOUSE Multidrug and toxin extrusion protein 1 OS=Mus musculus GN=Slc47a1 PE=1 SV=2 161 465 5.0E-36
sp|Q5I0E9|S47A1_RAT Multidrug and toxin extrusion protein 1 OS=Rattus norvegicus GN=Slc47a1 PE=1 SV=1 159 465 9.0E-36
sp|Q5RFD2|S47A1_PONAB Multidrug and toxin extrusion protein 1 OS=Pongo abelii GN=SLC47A1 PE=2 SV=1 157 465 9.0E-36
sp|Q9LUH2|DTX19_ARATH Protein DETOXIFICATION 19 OS=Arabidopsis thaliana GN=DTX19 PE=2 SV=1 127 460 7.0E-35
sp|Q9SZE2|DTX51_ARATH Protein DETOXIFICATION 51 OS=Arabidopsis thaliana GN=DTX51 PE=2 SV=1 162 465 4.0E-34
sp|Q9LUH3|DTX18_ARATH Protein DETOXIFICATION 18 OS=Arabidopsis thaliana GN=DTX18 PE=2 SV=1 161 460 2.0E-33
sp|Q96FL8|S47A1_HUMAN Multidrug and toxin extrusion protein 1 OS=Homo sapiens GN=SLC47A1 PE=1 SV=1 157 465 5.0E-33
sp|Q9C9M8|DTX9_ARATH Protein DETOXIFICATION 9 OS=Arabidopsis thaliana GN=DTX9 PE=2 SV=1 156 454 6.0E-33
sp|Q4PSF4|DTX52_ARATH Protein DETOXIFICATION 52 OS=Arabidopsis thaliana GN=DTX52 PE=2 SV=1 157 465 7.0E-31
sp|Q9ZVH5|DTX53_ARATH Protein DETOXIFICATION 53 OS=Arabidopsis thaliana GN=DTX53 PE=2 SV=1 161 465 4.0E-30
sp|A7KAU2|S47A1_RABIT Multidrug and toxin extrusion protein 1 OS=Oryctolagus cuniculus GN=SLC47A1 PE=2 SV=1 157 465 1.0E-29
sp|Q9C994|DTX14_ARATH Protein DETOXIFICATION 14 OS=Arabidopsis thaliana GN=DTX14 PE=3 SV=1 156 454 4.0E-28
sp|Q9SIA5|DTX1_ARATH Protein DETOXIFICATION 1 OS=Arabidopsis thaliana GN=DTX1 PE=2 SV=1 156 462 4.0E-27
sp|Q9SIA4|DTX3_ARATH Protein DETOXIFICATION 3 OS=Arabidopsis thaliana GN=DTX3 PE=3 SV=1 156 462 6.0E-27
sp|Q8GXM8|DTX2_ARATH Protein DETOXIFICATION 2 OS=Arabidopsis thaliana GN=DTX2 PE=2 SV=1 156 462 1.0E-26
sp|Q5R7E4|S47A2_PONAB Multidrug and toxin extrusion protein 2 OS=Pongo abelii GN=SLC47A2 PE=2 SV=1 162 463 4.0E-26
sp|Q86VL8|S47A2_HUMAN Multidrug and toxin extrusion protein 2 OS=Homo sapiens GN=SLC47A2 PE=1 SV=1 162 463 5.0E-26
sp|A7KAU3|S47A2_RABIT Multidrug and toxin extrusion protein 2 OS=Oryctolagus cuniculus GN=SLC47A2 PE=1 SV=1 126 463 7.0E-26
sp|Q8VYL8|DTX10_ARATH Protein DETOXIFICATION 10 OS=Arabidopsis thaliana GN=DTX10 PE=2 SV=1 137 462 2.0E-25
sp|F4HQ05|DTX8_ARATH Protein DETOXIFICATION 8 OS=Arabidopsis thaliana GN=DTX8 PE=3 SV=1 180 464 8.0E-25
sp|Q9SIA3|DTX4_ARATH Protein DETOXIFICATION 4 OS=Arabidopsis thaliana GN=DTX4 PE=3 SV=2 156 462 3.0E-24
sp|F4HZH9|DTX11_ARATH Protein DETOXIFICATION 11 OS=Arabidopsis thaliana GN=DTX11 PE=3 SV=1 128 462 4.0E-24
sp|O80695|DTX37_ARATH Protein DETOXIFICATION 37 OS=Arabidopsis thaliana GN=DTX37 PE=2 SV=1 128 465 1.0E-22
sp|Q9LVD9|DTX40_ARATH Protein DETOXIFICATION 40 OS=Arabidopsis thaliana GN=DTX40 PE=1 SV=1 154 467 2.0E-22
sp|Q9FJ87|DTX50_ARATH Protein DETOXIFICATION 50 OS=Arabidopsis thaliana GN=DTX50 PE=2 SV=1 157 454 3.0E-22
sp|Q9SIA1|DTX5_ARATH Protein DETOXIFICATION 5 OS=Arabidopsis thaliana GN=DTX5 PE=3 SV=2 162 454 3.0E-22
sp|Q8L731|DTX12_ARATH Protein DETOXIFICATION 12 OS=Arabidopsis thaliana GN=DTX12 PE=2 SV=1 139 462 5.0E-22
sp|Q1PFG9|DTX7_ARATH Protein DETOXIFICATION 7 OS=Arabidopsis thaliana GN=DTX7 PE=2 SV=1 164 460 7.0E-22
sp|Q9SLV0|DTX48_ARATH Protein DETOXIFICATION 48 OS=Arabidopsis thaliana GN=DTX48 PE=2 SV=1 161 462 1.0E-21
sp|Q9SAB0|DTX36_ARATH Protein DETOXIFICATION 36 OS=Arabidopsis thaliana GN=DTX36 PE=2 SV=1 162 454 1.0E-21
sp|Q94AL1|DTX13_ARATH Protein DETOXIFICATION 13 OS=Arabidopsis thaliana GN=DTX13 PE=2 SV=1 162 462 2.0E-21
sp|O82752|DTX49_ARATH Protein DETOXIFICATION 49 OS=Arabidopsis thaliana GN=DTX49 PE=2 SV=1 161 464 4.0E-21
sp|Q9FH21|DTX55_ARATH Protein DETOXIFICATION 55 OS=Arabidopsis thaliana GN=DTX55 PE=2 SV=1 161 460 1.0E-20
sp|Q8RWF5|DTX6_ARATH Protein DETOXIFICATION 6 OS=Arabidopsis thaliana GN=DTX6 PE=2 SV=1 156 454 2.0E-20
sp|F4JKB9|DTX38_ARATH Protein DETOXIFICATION 38 OS=Arabidopsis thaliana GN=DTX38 PE=2 SV=1 186 454 2.0E-19
sp|Q8RXK1|DTX23_ARATH Protein DETOXIFICATION 23 OS=Arabidopsis thaliana GN=DTX23 PE=2 SV=1 143 466 2.0E-19
sp|F4JTB3|DTX35_ARATH Protein DETOXIFICATION 35 OS=Arabidopsis thaliana GN=DTX35 PE=2 SV=1 142 465 9.0E-19
sp|Q940N9|DTX39_ARATH Protein DETOXIFICATION 39 OS=Arabidopsis thaliana GN=DTX39 PE=2 SV=1 162 454 1.0E-18
sp|F4JH46|DTX34_ARATH Protein DETOXIFICATION 34 OS=Arabidopsis thaliana GN=DTX34 PE=2 SV=1 170 465 4.0E-18
sp|Q9LPV4|DTX31_ARATH Protein DETOXIFICATION 31 OS=Arabidopsis thaliana GN=DTX31 PE=2 SV=1 153 495 8.0E-18
sp|Q38956|DTX29_ARATH Protein DETOXIFICATION 29 OS=Arabidopsis thaliana GN=DTX29 PE=1 SV=1 132 495 1.0E-17
sp|Q9FNC1|DTX28_ARATH Protein DETOXIFICATION 28 OS=Arabidopsis thaliana GN=DTX28 PE=3 SV=1 192 454 3.0E-17
sp|Q9LS19|DTX30_ARATH Protein DETOXIFICATION 30 OS=Arabidopsis thaliana GN=DTX30 PE=2 SV=1 125 496 8.0E-17
sp|Q9LE20|DTX54_ARATH Protein DETOXIFICATION 54 OS=Arabidopsis thaliana GN=DTX54 PE=2 SV=1 161 465 2.0E-16
sp|Q1PDX9|DTX26_ARATH Protein DETOXIFICATION 26 OS=Arabidopsis thaliana GN=DTX26 PE=2 SV=1 151 465 7.0E-16
sp|Q8W488|DTX21_ARATH Protein DETOXIFICATION 21 OS=Arabidopsis thaliana GN=DTX21 PE=1 SV=1 143 460 1.0E-15
sp|F4HPH1|DTX22_ARATH Protein DETOXIFICATION 22 OS=Arabidopsis thaliana GN=DTX22 PE=2 SV=1 143 460 1.0E-15
sp|Q9SX83|DTX33_ARATH Protein DETOXIFICATION 33 OS=Arabidopsis thaliana GN=DTX33 PE=2 SV=1 161 466 2.0E-15
sp|Q9FKQ1|DTX27_ARATH Protein DETOXIFICATION 27 OS=Arabidopsis thaliana GN=DTX27 PE=2 SV=1 162 460 2.0E-15
sp|F4HPH2|DTX20_ARATH Protein DETOXIFICATION 20 OS=Arabidopsis thaliana GN=DTX20 PE=3 SV=1 147 460 1.0E-13
sp|O82855|NORM_VIBPA Multidrug resistance protein NorM OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=norM PE=1 SV=2 159 465 1.0E-13
sp|F4I4Q3|DTX32_ARATH Protein DETOXIFICATION 32 OS=Arabidopsis thaliana GN=DTX32 PE=3 SV=1 162 453 2.0E-13
sp|Q9LYT3|DTX41_ARATH Protein DETOXIFICATION 41 OS=Arabidopsis thaliana GN=DTX41 PE=2 SV=1 162 467 7.0E-13
sp|Q7MKP8|NORM_VIBVY Multidrug resistance protein NorM OS=Vibrio vulnificus (strain YJ016) GN=norM PE=3 SV=2 159 465 1.0E-11
sp|Q8D9N8|NORM_VIBVU Multidrug resistance protein NorM OS=Vibrio vulnificus (strain CMCP6) GN=norM PE=3 SV=2 159 465 4.0E-11
sp|Q9KRU4|NORM_VIBCH Multidrug resistance protein NorM OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=norM PE=3 SV=2 159 465 4.0E-11
sp|Q5E4Y6|NORM_VIBF1 Multidrug resistance protein NorM OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=norM PE=3 SV=1 159 461 1.0E-10
sp|O49660|DTX56_ARATH Protein DETOXIFICATION 56 OS=Arabidopsis thaliana GN=DTX56 PE=1 SV=1 134 453 2.0E-09
sp|Q6LQ49|NORM_PHOPR Multidrug resistance protein NorM OS=Photobacterium profundum GN=norM PE=3 SV=1 158 464 4.0E-09
sp|Q5NYX9|NORM_AROAE Probable multidrug resistance protein NorM OS=Aromatoleum aromaticum (strain EbN1) GN=norM PE=3 SV=1 172 465 6.0E-09
sp|Q9KEJ2|NORM_BACHD Probable multidrug resistance protein NorM OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=norM PE=3 SV=1 158 465 2.0E-08
sp|Q8L616|DTX25_ARATH Protein DETOXIFICATION 25 OS=Arabidopsis thaliana GN=DTX25 PE=2 SV=1 219 466 3.0E-08
sp|A1JPA1|MDTK_YERE8 Multidrug resistance protein MdtK OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtK PE=3 SV=1 162 463 5.0E-08
sp|A7FHJ7|MDTK_YERP3 Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtK PE=3 SV=1 162 463 5.0E-08
sp|B1JJ53|MDTK_YERPY Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtK PE=3 SV=1 162 463 6.0E-08
sp|Q66A27|MDTK_YERPS Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtK PE=3 SV=1 162 463 6.0E-08
sp|A4TIP9|MDTK_YERPP Multidrug resistance protein MdtK OS=Yersinia pestis (strain Pestoides F) GN=mdtK PE=3 SV=1 162 463 6.0E-08
sp|Q1CIK5|MDTK_YERPN Multidrug resistance protein MdtK OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtK PE=3 SV=1 162 463 6.0E-08
sp|A9QZC0|MDTK_YERPG Multidrug resistance protein MdtK OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtK PE=3 SV=1 162 463 6.0E-08
sp|Q8ZDZ8|MDTK_YERPE Multidrug resistance protein MdtK OS=Yersinia pestis GN=mdtK PE=3 SV=1 162 463 6.0E-08
sp|B2K5I9|MDTK_YERPB Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtK PE=3 SV=1 162 463 6.0E-08
sp|Q1C769|MDTK_YERPA Multidrug resistance protein MdtK OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtK PE=3 SV=1 162 463 6.0E-08
sp|F4J158|DTX24_ARATH Protein DETOXIFICATION 24 OS=Arabidopsis thaliana GN=DTX24 PE=2 SV=1 182 466 7.0E-08
sp|Q8CUL5|NORM_OCEIH Probable multidrug resistance protein NorM OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=norM PE=3 SV=2 180 460 8.0E-08
sp|Q5KZL2|NORM_GEOKA Probable multidrug resistance protein NorM OS=Geobacillus kaustophilus (strain HTA426) GN=norM PE=3 SV=1 180 460 1.0E-07
sp|Q9I3Y3|PMPM_PSEAE Multidrug resistance protein PmpM OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pmpM PE=3 SV=1 162 465 2.0E-07
sp|Q7WAK9|NORM_BORPA Probable multidrug resistance protein NorM OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=norM PE=3 SV=1 156 453 2.0E-07
sp|Q7WJR0|NORM_BORBR Probable multidrug resistance protein NorM OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=norM PE=3 SV=1 156 453 2.0E-07
sp|Q8UDF5|NORM_AGRFC Probable multidrug resistance protein NorM OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=norM PE=3 SV=1 148 454 3.0E-07
sp|Q6HLG9|NORM_BACHK Probable multidrug resistance protein NorM OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=norM PE=3 SV=1 219 460 3.0E-07
sp|Q81T85|NORM_BACAN Probable multidrug resistance protein NorM OS=Bacillus anthracis GN=norM PE=3 SV=1 219 460 3.0E-07
sp|Q92AG2|NORM_LISIN Probable multidrug resistance protein NorM OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=norM PE=3 SV=1 215 447 8.0E-07
sp|Q8Y654|NORM_LISMO Probable multidrug resistance protein NorM OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=norM PE=3 SV=1 215 447 1.0E-06
sp|Q73BB8|NORM_BACC1 Probable multidrug resistance protein NorM OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=norM PE=3 SV=1 157 460 1.0E-06
sp|Q71YH0|NORM_LISMF Probable multidrug resistance protein NorM OS=Listeria monocytogenes serotype 4b (strain F2365) GN=norM PE=3 SV=1 215 447 2.0E-06
sp|P45272|HMRM_HAEIN Multidrug resistance protein HmrM OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hmrM PE=3 SV=1 154 460 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006855 drug transmembrane transport Yes
GO:0015238 drug transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0015297 antiporter activity Yes
GO:0016020 membrane Yes
GO:0022804 active transmembrane transporter activity No
GO:0008150 biological_process No
GO:0015893 drug transport No
GO:0006810 transport No
GO:0015291 secondary active transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 247 264 17
2 279 299 20
3 312 334 22
4 344 366 22
5 387 409 22
6 419 441 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6903
MHGKQGTADNASPPPAAQATTASAATDDEPMAVSPALQALLRQEPELKLWLEHTGYFDAAHRARVVQGIKRLKAA
EEERDRILRELHDTTGGLFHRRPASASTTTTPSSAQAANGRAAAASAAAAAAESPPSCDDVPADELLEEQWEEAV
ASGRLRTTWQREAETVVAYSAPLIATFFLQYSINVASIFAVGRIGKVELGAVSLANMSAAISCLAPFQGLATSLD
TLCAQAYGSGHKQLVGLQCQRLACFLLCLSAPVAVLWLFSDRILVLVVPDAESARLAGLYLKIMIFSIPGIILFE
TGKRFLQAQGLFHATTVILVIAAPFNIFITWLLVWRVGLGFVGAPIAVAVTENLLPVLLVLYVRFVGGAQCWGGL
SRRAFTQWWVMIRLALPGMIMVEAEWLAFEIMTLLASRFGTEYLAAQSVLATLATISYQVPFPVSIAASTRVANL
IGAGMVNAAKVTARVVRRRPRGPLSPSPSLSLHSPPPPLTLLDDRRSWPSASSGSST*
Coding >Hirsu2|6903
ATGCACGGCAAGCAAGGGACAGCCGACAACGCCTCCCCGCCGCCCGCCGCACAGGCCACGACCGCCTCGGCAGCG
ACCGACGACGAGCCCATGGCCGTCTCGCCTGCCCTCCAGGCCCTGCTTAGGCAGGAGCCGGAGCTGAAGCTGTGG
CTCGAGCATACGGGCTACTTCGACGCCGCCCACCGCGCGCGGGTGGTGCAGGGCATCAAGAGGCTCAAGGCGGCC
GAGGAGGAGCGTGACAGAATCCTCCGCGAGCTCCACGACACCACCGGCGGCCTGTTCCACCGCCGGCCCGCGTCG
GCGTCGACGACCACGACGCCCTCGTCCGCCCAGGCGGCCAACGGCCGCGCCGCCGCCGCCTCCGCCGCCGCCGCC
GCCGCCGAGTCGCCGCCGTCGTGCGATGACGTGCCCGCCGACGAGCTGCTCGAGGAGCAGTGGGAGGAGGCCGTG
GCCTCGGGCCGGCTGCGCACCACCTGGCAGCGCGAGGCCGAGACCGTCGTCGCCTACTCGGCCCCGCTCATCGCC
ACCTTCTTCCTGCAGTACTCCATCAACGTGGCCAGCATCTTCGCCGTCGGCCGCATAGGCAAGGTCGAGCTGGGC
GCCGTGTCTCTGGCCAACATGTCGGCGGCAATCTCGTGCCTGGCGCCCTTCCAGGGGCTGGCCACGAGCCTGGAC
ACGCTGTGCGCCCAGGCCTACGGGTCCGGCCACAAGCAGCTGGTCGGGCTGCAGTGCCAGCGGCTGGCCTGCTTC
CTGCTGTGCCTGTCGGCGCCGGTGGCCGTGCTCTGGCTGTTCTCGGACCGGATCCTGGTGCTCGTAGTGCCGGAC
GCCGAGTCGGCGCGGCTGGCCGGCCTGTACCTCAAGATCATGATCTTCTCCATCCCGGGCATCATCCTCTTCGAG
ACGGGCAAGCGCTTCCTGCAGGCGCAGGGCCTGTTCCACGCGACGACGGTCATCCTCGTCATCGCCGCGCCCTTC
AACATCTTCATCACCTGGCTGCTGGTCTGGCGCGTCGGGCTGGGCTTCGTCGGCGCCCCGATCGCCGTGGCCGTG
ACGGAGAACCTGCTGCCGGTCCTGCTCGTCCTCTACGTCCGCTTCGTCGGCGGCGCCCAGTGCTGGGGCGGCCTC
AGCCGGCGCGCCTTCACCCAGTGGTGGGTCATGATCCGCCTGGCGCTGCCGGGCATGATCATGGTCGAGGCCGAG
TGGCTGGCCTTTGAGATCATGACGCTGCTGGCCAGCCGCTTCGGCACCGAGTACCTGGCCGCCCAGAGCGTGCTG
GCGACGCTGGCCACCATCTCGTACCAGGTCCCCTTCCCCGTCTCCATCGCCGCCTCGACCCGCGTCGCCAACCTG
ATCGGCGCCGGCATGGTGAACGCGGCCAAGGTCACGGCCAGGGTGGTACGTCGTCGTCCCCGCGGCCCTCTCTCT
CCTTCGCCTTCTCTCTCTCTCCACTCCCCCCCCCCTCCGCTGACGCTGCTCGACGACAGACGTTCGTGGCCGTCT
GCGTCCTCGGGCTCGTCAACCTGA
Transcript >Hirsu2|6903
ATGCACGGCAAGCAAGGGACAGCCGACAACGCCTCCCCGCCGCCCGCCGCACAGGCCACGACCGCCTCGGCAGCG
ACCGACGACGAGCCCATGGCCGTCTCGCCTGCCCTCCAGGCCCTGCTTAGGCAGGAGCCGGAGCTGAAGCTGTGG
CTCGAGCATACGGGCTACTTCGACGCCGCCCACCGCGCGCGGGTGGTGCAGGGCATCAAGAGGCTCAAGGCGGCC
GAGGAGGAGCGTGACAGAATCCTCCGCGAGCTCCACGACACCACCGGCGGCCTGTTCCACCGCCGGCCCGCGTCG
GCGTCGACGACCACGACGCCCTCGTCCGCCCAGGCGGCCAACGGCCGCGCCGCCGCCGCCTCCGCCGCCGCCGCC
GCCGCCGAGTCGCCGCCGTCGTGCGATGACGTGCCCGCCGACGAGCTGCTCGAGGAGCAGTGGGAGGAGGCCGTG
GCCTCGGGCCGGCTGCGCACCACCTGGCAGCGCGAGGCCGAGACCGTCGTCGCCTACTCGGCCCCGCTCATCGCC
ACCTTCTTCCTGCAGTACTCCATCAACGTGGCCAGCATCTTCGCCGTCGGCCGCATAGGCAAGGTCGAGCTGGGC
GCCGTGTCTCTGGCCAACATGTCGGCGGCAATCTCGTGCCTGGCGCCCTTCCAGGGGCTGGCCACGAGCCTGGAC
ACGCTGTGCGCCCAGGCCTACGGGTCCGGCCACAAGCAGCTGGTCGGGCTGCAGTGCCAGCGGCTGGCCTGCTTC
CTGCTGTGCCTGTCGGCGCCGGTGGCCGTGCTCTGGCTGTTCTCGGACCGGATCCTGGTGCTCGTAGTGCCGGAC
GCCGAGTCGGCGCGGCTGGCCGGCCTGTACCTCAAGATCATGATCTTCTCCATCCCGGGCATCATCCTCTTCGAG
ACGGGCAAGCGCTTCCTGCAGGCGCAGGGCCTGTTCCACGCGACGACGGTCATCCTCGTCATCGCCGCGCCCTTC
AACATCTTCATCACCTGGCTGCTGGTCTGGCGCGTCGGGCTGGGCTTCGTCGGCGCCCCGATCGCCGTGGCCGTG
ACGGAGAACCTGCTGCCGGTCCTGCTCGTCCTCTACGTCCGCTTCGTCGGCGGCGCCCAGTGCTGGGGCGGCCTC
AGCCGGCGCGCCTTCACCCAGTGGTGGGTCATGATCCGCCTGGCGCTGCCGGGCATGATCATGGTCGAGGCCGAG
TGGCTGGCCTTTGAGATCATGACGCTGCTGGCCAGCCGCTTCGGCACCGAGTACCTGGCCGCCCAGAGCGTGCTG
GCGACGCTGGCCACCATCTCGTACCAGGTCCCCTTCCCCGTCTCCATCGCCGCCTCGACCCGCGTCGCCAACCTG
ATCGGCGCCGGCATGGTGAACGCGGCCAAGGTCACGGCCAGGGTGGTACGTCGTCGTCCCCGCGGCCCTCTCTCT
CCTTCGCCTTCTCTCTCTCTCCACTCCCCCCCCCCTCCGCTGACGCTGCTCGACGACAGACGTTCGTGGCCGTCT
GCGTCCTCGGGCTCGTCAACCTGA
Gene >Hirsu2|6903
ATGCACGGCAAGCAAGGGACAGCCGACAACGCCTCCCCGCCGCCCGCCGCACAGGCCACGACCGCCTCGGCAGCG
ACCGACGACGAGCCCATGGCCGTCTCGCCTGCCCTCCAGGCCCTGCTTAGGCAGGAGCCGGAGCTGAAGCTGTGG
CTCGAGCATACGGGCTACTTCGACGCCGCCCACCGCGCGCGGGTGGTGCAGGGCATCAAGAGGCTCAAGGCGGCC
GAGGAGGAGCGTGACAGAATCCTCCGCGAGCTCCACGACACCACCGGCGGCCTGTTCCACCGCCGGCCCGCGTCG
GCGTCGACGACCACGACGCCCTCGTCCGCCCAGGCGGCCAACGGCCGCGCCGCCGCCGCCTCCGCCGCCGCCGCC
GCCGCCGAGTCGCCGCCGTCGTGCGATGACGTGCCCGCCGACGAGCTGCTCGAGGAGCAGTGGGAGGAGGCCGTG
GCCTCGGGCCGGCTGCGCACCACCTGGCAGCGCGAGGCCGAGACCGTCGTCGCCTACTCGGCCCCGCTCATCGCC
ACCTTCTTCCTGCAGTACTCCATCAACGTGGCCAGCATCTTCGCCGTCGGCCGCATAGGCAAGGTCGAGCTGGGC
GCCGTGTCTCGTAAGGGAGCCTTTCAACCCCCCACCCCGTTGAGCGAGAGAGGCATAAGAGTGATCTGACTTGGC
CGAACAACAACAACAACAACAACAACAACAACAACAAAAGTGGCCAACATGTCGGCGGCAATCTCGTGCCTGGCG
CCCTTCCAGGGGCTGGCCACGAGCCTGGACACGCTGTGCGCCCAGGCCTACGGGTCCGGCCACAAGCAGCTGGTC
GGGCTGCAGTGCCAGCGGCTGGCCTGCTTCCTGCTGTGCCTGTCGGCGCCGGTGGCCGTGCTCTGGCTGTTCTCG
GACCGGATCCTGGTGCTCGTAGTGCCGGACGCCGAGTCGGCGCGGCTGGCCGGCCTGTACCTCAAGATCATGATC
TTCTCCATCCCGGGCATCATCCTCTTCGAGACGGGCAAGCGCTTCCTGCAGGCGCAGGGCCTGTTCCACGCGACG
ACGGTCATCCTCGTCATCGCCGCGCCCTTCAACATCTTCATCACCTGGCTGCTGGTCTGGCGCGTCGGGCTGGGC
TTCGTCGGCGCCCCGATCGCCGTGGCCGTGACGGAGAACCTGCTGCCGGTCCTGCTCGTCCTCTACGTCCGCTTC
GTCGGCGGCGCCCAGTGCTGGGGCGGCCTCAGCCGGCGCGCCTTCACCCAGTGGTGGGTCATGATCCGCCTGGCG
CTGCCGGGCATGATCATGGTCGAGGCCGAGTGGCTGGCCTTTGAGATCATGACGCTGCTGGCCAGCCGCTTCGGC
ACCGAGTACCTGGCCGCCCAGAGCGTGCTGGCGACGCTGGCCACCATCTCGTACCAGGTCCCCTTCCCCGTCTCC
ATCGCCGCCTCGACCCGCGTCGCCAACCTGATCGGCGCCGGCATGGTGAACGCGGCCAAGGTCACGGCCAGGGTG
GTACGTCGTCGTCCCCGCGGCCCTCTCTCTCCTTCGCCTTCTCTCTCTCTCCACTCCCCCCCCCCTCCGCTGACG
CTGCTCGACGACAGACGTTCGTGGCCGTCTGCGTCCTCGGGCTCGTCAACCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail