Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6902
Gene name
LocationContig_374:19872..20790
Strand-
Gene length (bp)918
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12296 HsbA Hydrophobic surface binding protein A 9.0E-19 31 148

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8TG42|MP1_ASPFL Cell wall mannoprotein 1 OS=Aspergillus flavus GN=mp1 PE=2 SV=1 1 165 2.0E-12
sp|Q9HFP8|MP1_ASPFM Cell wall mannoprotein 1 OS=Neosartorya fumigata GN=MP1 PE=1 SV=1 1 165 5.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 282 304 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6902
MKFTAVTLACLATGIYARASDPPTKVYERDIATVTGAIEDVGKDIDGLGSALQGFKSDPQPVKDAADKLIGTLGD
SKSKVDGSDKLTLADALGLQEPVKALQTKSEELVKGLKGGKTRIQDGGYCKLVREKVNSIDKGSNDLIDSVVSKV
PESAQDIAKSLASGLQKVLAEAKTEFNEQNCKDSAGGGKSSAPASSAPASSAPASSAPASSAEPSESEPAATSAP
ASSGYAVPSESESESEPASTSAPANTGYPKPSGPATTPYQPTGTGIPTAVPTTQAPIVTAGAALVAPAGALAMAV
AAMIL*
Coding >Hirsu2|6902
ATGAAGTTCACCGCCGTCACCCTCGCTTGCCTCGCCACGGGCATCTACGCTCGCGCCTCGGATCCGCCTACCAAG
GTCTACGAGCGCGACATCGCCACCGTCACCGGCGCCATCGAGGACGTCGGCAAGGACATCGACGGTCTCGGCTCC
GCCCTTCAGGGCTTCAAGAGCGACCCCCAGCCCGTGAAGGATGCGGCCGACAAGCTGATCGGCACTCTGGGCGAT
TCCAAGAGCAAGGTTGACGGCTCCGACAAGCTGACCCTGGCCGACGCCCTCGGCCTGCAGGAGCCGGTCAAGGCC
CTGCAGACGAAGAGTGAAGAGCTCGTCAAGGGCCTCAAGGGTGGCAAGACCAGGATCCAGGACGGCGGCTACTGC
AAGCTCGTCCGTGAGAAGGTCAACTCCATCGATAAGGGCTCCAACGACCTGATCGACTCCGTCGTCAGCAAGGTC
CCCGAATCAGCCCAGGACATCGCCAAGAGCCTCGCCAGCGGCCTGCAGAAGGTGCTTGCCGAGGCCAAGACGGAG
TTCAACGAGCAGAACTGCAAGGACTCCGCCGGCGGCGGCAAGTCGTCCGCTCCTGCCTCGTCCGCCCCGGCCTCG
TCCGCCCCGGCCTCGTCCGCCCCCGCCAGCTCGGCCGAGCCTAGCGAGTCCGAGCCCGCCGCCACCTCCGCCCCG
GCCAGCTCCGGCTATGCCGTGCCCTCCGAGTCCGAGTCCGAGTCCGAGCCCGCCTCGACCTCCGCCCCGGCCAAC
ACCGGCTACCCCAAGCCTTCCGGCCCCGCCACCACCCCCTACCAGCCCACCGGCACCGGCATCCCCACTGCCGTT
CCCACCACGCAGGCCCCGATTGTCACCGCCGGCGCCGCCCTGGTCGCCCCCGCCGGCGCTCTGGCCATGGCCGTT
GCTGCCATGATCCTGTAA
Transcript >Hirsu2|6902
ATGAAGTTCACCGCCGTCACCCTCGCTTGCCTCGCCACGGGCATCTACGCTCGCGCCTCGGATCCGCCTACCAAG
GTCTACGAGCGCGACATCGCCACCGTCACCGGCGCCATCGAGGACGTCGGCAAGGACATCGACGGTCTCGGCTCC
GCCCTTCAGGGCTTCAAGAGCGACCCCCAGCCCGTGAAGGATGCGGCCGACAAGCTGATCGGCACTCTGGGCGAT
TCCAAGAGCAAGGTTGACGGCTCCGACAAGCTGACCCTGGCCGACGCCCTCGGCCTGCAGGAGCCGGTCAAGGCC
CTGCAGACGAAGAGTGAAGAGCTCGTCAAGGGCCTCAAGGGTGGCAAGACCAGGATCCAGGACGGCGGCTACTGC
AAGCTCGTCCGTGAGAAGGTCAACTCCATCGATAAGGGCTCCAACGACCTGATCGACTCCGTCGTCAGCAAGGTC
CCCGAATCAGCCCAGGACATCGCCAAGAGCCTCGCCAGCGGCCTGCAGAAGGTGCTTGCCGAGGCCAAGACGGAG
TTCAACGAGCAGAACTGCAAGGACTCCGCCGGCGGCGGCAAGTCGTCCGCTCCTGCCTCGTCCGCCCCGGCCTCG
TCCGCCCCGGCCTCGTCCGCCCCCGCCAGCTCGGCCGAGCCTAGCGAGTCCGAGCCCGCCGCCACCTCCGCCCCG
GCCAGCTCCGGCTATGCCGTGCCCTCCGAGTCCGAGTCCGAGTCCGAGCCCGCCTCGACCTCCGCCCCGGCCAAC
ACCGGCTACCCCAAGCCTTCCGGCCCCGCCACCACCCCCTACCAGCCCACCGGCACCGGCATCCCCACTGCCGTT
CCCACCACGCAGGCCCCGATTGTCACCGCCGGCGCCGCCCTGGTCGCCCCCGCCGGCGCTCTGGCCATGGCCGTT
GCTGCCATGATCCTGTAA
Gene >Hirsu2|6902
ATGAAGTTCACCGCCGTCACCCTCGCTTGCCTCGCCACGGGCATCTACGCTCGCGCCTCGGATCCGCCTACCAAG
GTCTACGAGCGCGACATCGCCACCGTCACCGGCGCCATCGAGGACGTCGGCAAGGACATCGACGGTCTCGGCTCC
GCCCTTCAGGGCTTCAAGAGCGACCCCCAGCCCGTGAAGGATGCGGCCGACAAGCTGATCGGCACTCTGGGCGAT
TCCAAGAGCAAGGTTGACGGCTCCGACAAGCTGACCCTGGCCGACGCCCTCGGCCTGCAGGAGCCGGTCAAGGCC
CTGCAGACGAAGAGTGAAGAGCTCGTCAAGGGCCTCAAGGGTGGCAAGACCAGGATCCAGGACGGCGGCTACTGC
AAGCTCGTCCGTGAGAAGGTCAACTCCATCGATAAGGGCTCCAACGACCTGATCGACTCCGTCGTCAGCAAGGTC
CCCGAATCAGCCCAGGACATCGCCAAGAGCCTCGCCAGCGGCCTGCAGAAGGTGCTTGCCGAGGCCAAGACGGAG
TTCAACGAGCAGAACTGCAAGGACTCCGCCGGCGGCGGCAAGTCGTCCGCTCCTGCCTCGTCCGCCCCGGCCTCG
TCCGCCCCGGCCTCGTCCGCCCCCGCCAGCTCGGCCGAGCCTAGCGAGTCCGAGCCCGCCGCCACCTCCGCCCCG
GCCAGCTCCGGCTATGCCGTGCCCTCCGAGTCCGAGTCCGAGTCCGAGCCCGCCTCGACCTCCGCCCCGGCCAAC
ACCGGCTACCCCAAGCCTTCCGGCCCCGCCACCACCCCCTACCAGCCCACCGGCACCGGCATCCCCACTGCCGTT
CCCACCACGCAGGCCCCGATTGTCACCGCCGGCGCCGCCCTGGTCGCCCCCGCCGGCGCTCTGGCCATGGCCGTT
GCTGCCATGATCCTGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail