Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6900
Gene name
LocationContig_374:15058..17029
Strand-
Gene length (bp)1971
Transcript length (bp)1971
Coding sequence length (bp)1971
Protein length (aa) 657

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 2.8E-25 177 298
PF08030 NAD_binding_6 Ferric reductase NAD binding domain 6.3E-17 469 628
PF08022 FAD_binding_8 FAD-binding domain 1.7E-09 356 454
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 2.3E-07 474 552

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08905|FRE3_YEAST Ferric reductase transmembrane component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE3 PE=1 SV=1 51 644 9.0E-31
sp|Q08908|FRE5_YEAST Ferric reductase transmembrane component 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE5 PE=2 SV=1 95 629 3.0E-30
sp|P36033|FRE2_YEAST Ferric/cupric reductase transmembrane component 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE2 PE=1 SV=1 47 644 3.0E-29
sp|P53746|FRE4_YEAST Ferric reductase transmembrane component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE4 PE=2 SV=1 54 644 3.0E-28
sp|Q12333|FRE7_YEAST Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE7 PE=1 SV=2 168 642 6.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08905|FRE3_YEAST Ferric reductase transmembrane component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE3 PE=1 SV=1 51 644 9.0E-31
sp|Q08908|FRE5_YEAST Ferric reductase transmembrane component 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE5 PE=2 SV=1 95 629 3.0E-30
sp|P36033|FRE2_YEAST Ferric/cupric reductase transmembrane component 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE2 PE=1 SV=1 47 644 3.0E-29
sp|P53746|FRE4_YEAST Ferric reductase transmembrane component 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE4 PE=2 SV=1 54 644 3.0E-28
sp|Q12333|FRE7_YEAST Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE7 PE=1 SV=2 168 642 6.0E-22
sp|Q12473|FRE6_YEAST Ferric reductase transmembrane component 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE6 PE=1 SV=1 173 644 8.0E-22
sp|A6ZN61|FRE7_YEAS7 Ferric/cupric reductase transmembrane component 7 OS=Saccharomyces cerevisiae (strain YJM789) GN=FRE7 PE=3 SV=1 168 642 5.0E-21
sp|P32791|FRE1_YEAST Ferric/cupric reductase transmembrane component 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE1 PE=1 SV=1 166 629 5.0E-21
sp|P78588|FREL_CANAX Probable ferric reductase transmembrane component OS=Candida albicans GN=CFL1 PE=3 SV=1 65 643 8.0E-21
sp|Q5A446|FRE1_CANAL Ferric/cupric reductase transmembrane component 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CFL1 PE=2 SV=1 65 540 3.0E-20
sp|O94727|FRP2_SCHPO Ferric/cupric reductase transmembrane component 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp2 PE=3 SV=1 175 574 2.0E-19
sp|Q04800|FRP1_SCHPO Ferric reductase transmembrane component 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp1 PE=1 SV=1 124 559 9.0E-18
sp|Q8W110|FRO4_ARATH Ferric reduction oxidase 4 OS=Arabidopsis thaliana GN=FRO4 PE=2 SV=1 130 559 3.0E-10
sp|Q9LMM2|FRO1_ARATH Probable ferric reduction oxidase 1 OS=Arabidopsis thaliana GN=FRO1 PE=2 SV=1 94 548 1.0E-07
sp|Q9FLW2|FRO5_ARATH Ferric reduction oxidase 5 OS=Arabidopsis thaliana GN=FRO5 PE=2 SV=1 130 559 2.0E-07
sp|Q86GL4|NOXB_DICDI Superoxide-generating NADPH oxidase heavy chain subunit B OS=Dictyostelium discoideum GN=noxB PE=2 SV=1 271 549 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 127 149 22
3 211 233 22
4 254 276 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6900
MDALPGLHRLASRHIQNHSDADNVEPHWGYPDRVVPCKNDAGSCAYLDTVYRAHDLGMLYVGILWATILGILLLW
VCLRHAGRPAGLVAGTPSRSGLDRARSALAALRRRHLLPDASRRLFGRTTRLQVLVLAILAGYLLVWSFVGIAYN
SWVTPVKNQPGVFNTRTGLGPWSDRVGVLAYALTPLSVLLASRESLLSVLTGLPYQTFNFLHRWLGYIIFVQGSL
HTIGWCIIQLRLYQPQPKVGLEWVVQTYIVWGLVAMILLTLLFILSTPWAIRRTGYEFFRKAHYVLAMVYIGACW
GHWDKLKCFLIPSLILWGLDRGARLVRTALLHYHPWAASKFSPVKAAMTRFTDDQDGDVIRLDFTLEQDPWAVGQ
HFYLCFVECSVWQSHPFTPLNAPVLQGGHVRHSYIVRAKAGETKKLARLAAGKLPSSDPSKTTSAAPTTPVILTG
PYGEDLMSSISAGNAGFNSNIICIAGGTGIAYVMPVLLQLARRHPVPDRKIELIWAMRHQSNVEWIQEEMECLQR
AQKTLNLTIRLYATRDSKIPAAEKGASTAKDHELGSASSSSDGICACDDGVSVHKTGDGETGSDRHPNLRELVGE
FVESTITGRTTVFASGPGGMITDLRATVAALNCPSKVLKGRERFIVELVCDDRLEW*
Coding >Hirsu2|6900
ATGGACGCCCTCCCCGGCCTGCACCGGCTCGCCAGCCGGCATATCCAGAATCACTCGGATGCAGACAACGTCGAG
CCGCACTGGGGCTACCCGGACCGCGTCGTCCCCTGCAAGAACGATGCCGGCTCCTGCGCCTACCTCGACACCGTC
TACCGCGCCCACGATCTAGGCATGCTGTATGTTGGCATCCTCTGGGCCACCATCCTCGGCATCCTGCTGCTCTGG
GTCTGCCTCCGCCATGCCGGTCGTCCGGCCGGCCTTGTCGCCGGAACGCCCTCCCGGAGCGGCCTCGACAGGGCC
CGCTCCGCCCTGGCCGCCCTCCGCCGCCGCCATCTTCTGCCGGATGCCAGCCGCCGCCTCTTCGGCCGCACCACC
CGCCTGCAGGTGCTCGTCCTCGCCATCCTGGCCGGCTACCTCCTGGTCTGGAGCTTCGTCGGCATCGCCTACAAC
TCCTGGGTCACGCCCGTCAAGAACCAGCCCGGCGTCTTCAACACCCGGACCGGCCTCGGCCCCTGGTCCGACCGC
GTCGGCGTGCTGGCCTACGCCCTGACGCCCCTGTCCGTTCTCCTGGCCAGCCGCGAGTCCCTCCTGTCCGTCCTG
ACCGGCCTCCCTTATCAGACCTTCAACTTCCTGCACCGGTGGCTCGGCTACATCATCTTCGTCCAGGGCTCCCTG
CACACCATCGGCTGGTGCATCATCCAGCTCCGTCTCTACCAGCCCCAGCCCAAGGTCGGCCTCGAATGGGTCGTC
CAGACTTACATCGTCTGGGGCCTGGTCGCCATGATCCTGTTGACTCTGCTCTTCATCTTGAGCACCCCCTGGGCC
ATCCGTCGCACCGGCTACGAGTTCTTCCGCAAGGCTCACTACGTCCTGGCCATGGTCTACATTGGCGCCTGTTGG
GGTCACTGGGACAAGCTCAAGTGCTTCCTCATCCCCTCCTTGATCCTCTGGGGCCTCGATCGCGGTGCTCGCCTC
GTCCGCACCGCCCTTCTCCACTACCATCCTTGGGCTGCGTCCAAGTTCAGCCCAGTCAAGGCCGCCATGACGCGC
TTTACCGATGATCAGGACGGAGACGTCATCCGCCTCGACTTTACCCTCGAACAGGACCCCTGGGCTGTCGGCCAG
CATTTCTACCTCTGCTTCGTCGAATGCAGCGTCTGGCAATCACATCCCTTCACCCCCTTGAACGCCCCCGTTCTT
CAGGGCGGACACGTCCGTCACTCCTACATCGTGAGGGCCAAGGCGGGAGAGACGAAGAAGCTGGCCAGGCTGGCC
GCCGGCAAGCTTCCATCGAGCGATCCCAGCAAGACCACGTCTGCCGCTCCTACGACCCCGGTCATCCTGACGGGC
CCTTACGGGGAAGATCTCATGAGCAGTATCTCAGCCGGCAACGCCGGCTTCAACAGCAACATCATCTGCATCGCG
GGGGGCACCGGCATCGCCTACGTCATGCCCGTCCTTCTGCAGCTCGCCCGGCGGCACCCGGTGCCGGACCGCAAG
ATTGAGCTGATTTGGGCCATGAGGCACCAGAGCAACGTCGAATGGATCCAGGAGGAGATGGAATGTCTTCAGCGG
GCGCAGAAGACGCTCAACCTGACCATCCGGCTTTACGCTACTCGGGATTCCAAGATACCGGCCGCCGAGAAGGGG
GCCAGCACCGCCAAGGACCACGAGCTGGGCTCCGCATCGTCCTCCTCCGACGGGATCTGCGCCTGTGACGACGGC
GTCTCCGTCCACAAGACCGGAGACGGCGAAACGGGCAGCGACAGGCACCCGAACCTGCGCGAGCTGGTCGGCGAA
TTTGTCGAGTCTACCATAACGGGGCGAACGACGGTGTTTGCCAGCGGCCCTGGAGGCATGATCACGGACCTGAGA
GCTACCGTCGCCGCCCTCAACTGCCCATCAAAGGTCTTGAAGGGGCGGGAGCGGTTCATCGTCGAACTCGTCTGC
GACGATCGCTTGGAGTGGTAG
Transcript >Hirsu2|6900
ATGGACGCCCTCCCCGGCCTGCACCGGCTCGCCAGCCGGCATATCCAGAATCACTCGGATGCAGACAACGTCGAG
CCGCACTGGGGCTACCCGGACCGCGTCGTCCCCTGCAAGAACGATGCCGGCTCCTGCGCCTACCTCGACACCGTC
TACCGCGCCCACGATCTAGGCATGCTGTATGTTGGCATCCTCTGGGCCACCATCCTCGGCATCCTGCTGCTCTGG
GTCTGCCTCCGCCATGCCGGTCGTCCGGCCGGCCTTGTCGCCGGAACGCCCTCCCGGAGCGGCCTCGACAGGGCC
CGCTCCGCCCTGGCCGCCCTCCGCCGCCGCCATCTTCTGCCGGATGCCAGCCGCCGCCTCTTCGGCCGCACCACC
CGCCTGCAGGTGCTCGTCCTCGCCATCCTGGCCGGCTACCTCCTGGTCTGGAGCTTCGTCGGCATCGCCTACAAC
TCCTGGGTCACGCCCGTCAAGAACCAGCCCGGCGTCTTCAACACCCGGACCGGCCTCGGCCCCTGGTCCGACCGC
GTCGGCGTGCTGGCCTACGCCCTGACGCCCCTGTCCGTTCTCCTGGCCAGCCGCGAGTCCCTCCTGTCCGTCCTG
ACCGGCCTCCCTTATCAGACCTTCAACTTCCTGCACCGGTGGCTCGGCTACATCATCTTCGTCCAGGGCTCCCTG
CACACCATCGGCTGGTGCATCATCCAGCTCCGTCTCTACCAGCCCCAGCCCAAGGTCGGCCTCGAATGGGTCGTC
CAGACTTACATCGTCTGGGGCCTGGTCGCCATGATCCTGTTGACTCTGCTCTTCATCTTGAGCACCCCCTGGGCC
ATCCGTCGCACCGGCTACGAGTTCTTCCGCAAGGCTCACTACGTCCTGGCCATGGTCTACATTGGCGCCTGTTGG
GGTCACTGGGACAAGCTCAAGTGCTTCCTCATCCCCTCCTTGATCCTCTGGGGCCTCGATCGCGGTGCTCGCCTC
GTCCGCACCGCCCTTCTCCACTACCATCCTTGGGCTGCGTCCAAGTTCAGCCCAGTCAAGGCCGCCATGACGCGC
TTTACCGATGATCAGGACGGAGACGTCATCCGCCTCGACTTTACCCTCGAACAGGACCCCTGGGCTGTCGGCCAG
CATTTCTACCTCTGCTTCGTCGAATGCAGCGTCTGGCAATCACATCCCTTCACCCCCTTGAACGCCCCCGTTCTT
CAGGGCGGACACGTCCGTCACTCCTACATCGTGAGGGCCAAGGCGGGAGAGACGAAGAAGCTGGCCAGGCTGGCC
GCCGGCAAGCTTCCATCGAGCGATCCCAGCAAGACCACGTCTGCCGCTCCTACGACCCCGGTCATCCTGACGGGC
CCTTACGGGGAAGATCTCATGAGCAGTATCTCAGCCGGCAACGCCGGCTTCAACAGCAACATCATCTGCATCGCG
GGGGGCACCGGCATCGCCTACGTCATGCCCGTCCTTCTGCAGCTCGCCCGGCGGCACCCGGTGCCGGACCGCAAG
ATTGAGCTGATTTGGGCCATGAGGCACCAGAGCAACGTCGAATGGATCCAGGAGGAGATGGAATGTCTTCAGCGG
GCGCAGAAGACGCTCAACCTGACCATCCGGCTTTACGCTACTCGGGATTCCAAGATACCGGCCGCCGAGAAGGGG
GCCAGCACCGCCAAGGACCACGAGCTGGGCTCCGCATCGTCCTCCTCCGACGGGATCTGCGCCTGTGACGACGGC
GTCTCCGTCCACAAGACCGGAGACGGCGAAACGGGCAGCGACAGGCACCCGAACCTGCGCGAGCTGGTCGGCGAA
TTTGTCGAGTCTACCATAACGGGGCGAACGACGGTGTTTGCCAGCGGCCCTGGAGGCATGATCACGGACCTGAGA
GCTACCGTCGCCGCCCTCAACTGCCCATCAAAGGTCTTGAAGGGGCGGGAGCGGTTCATCGTCGAACTCGTCTGC
GACGATCGCTTGGAGTGGTAG
Gene >Hirsu2|6900
ATGGACGCCCTCCCCGGCCTGCACCGGCTCGCCAGCCGGCATATCCAGAATCACTCGGATGCAGACAACGTCGAG
CCGCACTGGGGCTACCCGGACCGCGTCGTCCCCTGCAAGAACGATGCCGGCTCCTGCGCCTACCTCGACACCGTC
TACCGCGCCCACGATCTAGGCATGCTGTATGTTGGCATCCTCTGGGCCACCATCCTCGGCATCCTGCTGCTCTGG
GTCTGCCTCCGCCATGCCGGTCGTCCGGCCGGCCTTGTCGCCGGAACGCCCTCCCGGAGCGGCCTCGACAGGGCC
CGCTCCGCCCTGGCCGCCCTCCGCCGCCGCCATCTTCTGCCGGATGCCAGCCGCCGCCTCTTCGGCCGCACCACC
CGCCTGCAGGTGCTCGTCCTCGCCATCCTGGCCGGCTACCTCCTGGTCTGGAGCTTCGTCGGCATCGCCTACAAC
TCCTGGGTCACGCCCGTCAAGAACCAGCCCGGCGTCTTCAACACCCGGACCGGCCTCGGCCCCTGGTCCGACCGC
GTCGGCGTGCTGGCCTACGCCCTGACGCCCCTGTCCGTTCTCCTGGCCAGCCGCGAGTCCCTCCTGTCCGTCCTG
ACCGGCCTCCCTTATCAGACCTTCAACTTCCTGCACCGGTGGCTCGGCTACATCATCTTCGTCCAGGGCTCCCTG
CACACCATCGGCTGGTGCATCATCCAGCTCCGTCTCTACCAGCCCCAGCCCAAGGTCGGCCTCGAATGGGTCGTC
CAGACTTACATCGTCTGGGGCCTGGTCGCCATGATCCTGTTGACTCTGCTCTTCATCTTGAGCACCCCCTGGGCC
ATCCGTCGCACCGGCTACGAGTTCTTCCGCAAGGCTCACTACGTCCTGGCCATGGTCTACATTGGCGCCTGTTGG
GGTCACTGGGACAAGCTCAAGTGCTTCCTCATCCCCTCCTTGATCCTCTGGGGCCTCGATCGCGGTGCTCGCCTC
GTCCGCACCGCCCTTCTCCACTACCATCCTTGGGCTGCGTCCAAGTTCAGCCCAGTCAAGGCCGCCATGACGCGC
TTTACCGATGATCAGGACGGAGACGTCATCCGCCTCGACTTTACCCTCGAACAGGACCCCTGGGCTGTCGGCCAG
CATTTCTACCTCTGCTTCGTCGAATGCAGCGTCTGGCAATCACATCCCTTCACCCCCTTGAACGCCCCCGTTCTT
CAGGGCGGACACGTCCGTCACTCCTACATCGTGAGGGCCAAGGCGGGAGAGACGAAGAAGCTGGCCAGGCTGGCC
GCCGGCAAGCTTCCATCGAGCGATCCCAGCAAGACCACGTCTGCCGCTCCTACGACCCCGGTCATCCTGACGGGC
CCTTACGGGGAAGATCTCATGAGCAGTATCTCAGCCGGCAACGCCGGCTTCAACAGCAACATCATCTGCATCGCG
GGGGGCACCGGCATCGCCTACGTCATGCCCGTCCTTCTGCAGCTCGCCCGGCGGCACCCGGTGCCGGACCGCAAG
ATTGAGCTGATTTGGGCCATGAGGCACCAGAGCAACGTCGAATGGATCCAGGAGGAGATGGAATGTCTTCAGCGG
GCGCAGAAGACGCTCAACCTGACCATCCGGCTTTACGCTACTCGGGATTCCAAGATACCGGCCGCCGAGAAGGGG
GCCAGCACCGCCAAGGACCACGAGCTGGGCTCCGCATCGTCCTCCTCCGACGGGATCTGCGCCTGTGACGACGGC
GTCTCCGTCCACAAGACCGGAGACGGCGAAACGGGCAGCGACAGGCACCCGAACCTGCGCGAGCTGGTCGGCGAA
TTTGTCGAGTCTACCATAACGGGGCGAACGACGGTGTTTGCCAGCGGCCCTGGAGGCATGATCACGGACCTGAGA
GCTACCGTCGCCGCCCTCAACTGCCCATCAAAGGTCTTGAAGGGGCGGGAGCGGTTCATCGTCGAACTCGTCTGC
GACGATCGCTTGGAGTGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail