Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6899
Gene name
LocationContig_374:12464..14034
Strand+
Gene length (bp)1570
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00128 Alpha-amylase Alpha amylase, catalytic domain 8.1E-50 57 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C1B4|AMYA3_ASPOR Alpha-amylase A type-3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy3 PE=3 SV=1 23 410 2.0E-107
sp|P0C1B3|AMYA1_ASPOR Alpha-amylase A type-1/2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy1 PE=1 SV=1 23 410 2.0E-107
sp|Q02906|AMYB_ASPAW Alpha-amylase B OS=Aspergillus awamori GN=amyB PE=3 SV=1 23 373 6.0E-107
sp|Q02905|AMYA_ASPAW Alpha-amylase A OS=Aspergillus awamori GN=amyA PE=3 SV=1 23 373 7.0E-107
sp|P30292|AMY_ASPSH Alpha-amylase OS=Aspergillus shirousami GN=amy PE=1 SV=1 23 410 3.0E-106
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C1B4|AMYA3_ASPOR Alpha-amylase A type-3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy3 PE=3 SV=1 23 410 2.0E-107
sp|P0C1B3|AMYA1_ASPOR Alpha-amylase A type-1/2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy1 PE=1 SV=1 23 410 2.0E-107
sp|Q02906|AMYB_ASPAW Alpha-amylase B OS=Aspergillus awamori GN=amyB PE=3 SV=1 23 373 6.0E-107
sp|Q02905|AMYA_ASPAW Alpha-amylase A OS=Aspergillus awamori GN=amyA PE=3 SV=1 23 373 7.0E-107
sp|P30292|AMY_ASPSH Alpha-amylase OS=Aspergillus shirousami GN=amy PE=1 SV=1 23 410 3.0E-106
sp|Q08806|AMY2_SCHOC Alpha-amylase 2 OS=Schwanniomyces occidentalis GN=SWA2 PE=3 SV=1 22 454 4.0E-99
sp|Q01117|AMY1_LIPKO Alpha-amylase 1 OS=Lipomyces kononenkoae GN=LKA1 PE=1 SV=2 23 373 1.0E-95
sp|P21567|AMY1_SACFI Alpha-amylase OS=Saccharomycopsis fibuligera GN=ALP1 PE=3 SV=1 23 412 3.0E-94
sp|P56271|AMYA_ASPNG Acid alpha-amylase OS=Aspergillus niger PE=1 SV=1 22 456 6.0E-90
sp|P19269|AMY1_SCHOC Alpha-amylase 1 OS=Schwanniomyces occidentalis GN=AMY1 PE=1 SV=1 16 454 1.0E-86
sp|O14154|MDE5_SCHPO Alpha-amylase mde5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde5 PE=2 SV=1 11 458 2.0E-81
sp|Q10427|YQ29_SCHPO Uncharacterized glycosyl hydrolase C11E10.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC11E10.09c PE=3 SV=1 11 414 3.0E-80
sp|O13996|YEI1_SCHPO Uncharacterized glycosyl hydrolase C27E2.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27E2.01 PE=3 SV=1 23 437 1.0E-79
sp|Q09840|AMY2_SCHPO Alpha-amylase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah2 PE=1 SV=1 2 455 2.0E-76
sp|Q9Y7S9|AMY3_SCHPO Alpha-amylase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah3 PE=1 SV=1 5 455 2.0E-75
sp|P21543|AMYB_PAEPO Beta/alpha-amylase OS=Paenibacillus polymyxa PE=1 SV=1 21 413 2.0E-72
sp|O74922|AMY1_SCHPO Alpha-amylase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah1 PE=3 SV=1 12 373 1.0E-65
sp|P09121|CDGT_BACS3 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 38-2) GN=cgt PE=1 SV=2 46 432 8.0E-42
sp|P31797|CDGT_GEOSE Cyclomaltodextrin glucanotransferase OS=Geobacillus stearothermophilus GN=cgt PE=1 SV=1 3 432 9.0E-41
sp|P30920|CDGT1_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans PE=1 SV=1 28 432 4.0E-40
sp|P31747|CDGT_BACSS Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 6.6.3) GN=cgt PE=3 SV=1 28 432 1.0E-39
sp|P14014|CDGT_BACLI Cyclomaltodextrin glucanotransferase OS=Bacillus licheniformis GN=cgtA PE=3 SV=1 28 432 2.0E-39
sp|P05618|CDGT_BACS0 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1011) GN=cgt PE=1 SV=1 46 432 3.0E-39
sp|P43379|CDGT2_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans GN=cgt PE=1 SV=1 5 432 5.0E-39
sp|P31746|CDGT_BACS2 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1-1) GN=cgt PE=1 SV=1 12 431 6.0E-39
sp|P08137|AMY_BACCI Alpha-amylase OS=Bacillus circulans PE=3 SV=1 14 430 4.0E-38
sp|P30921|CDGT_BAC11 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 17-1) GN=cgt PE=1 SV=1 46 428 9.0E-38
sp|O30565|CDGT_BREBE Cyclomaltodextrin glucanotransferase OS=Brevibacillus brevis GN=cgt PE=3 SV=1 6 431 3.0E-37
sp|P26827|CDGT_THETU Cyclomaltodextrin glucanotransferase OS=Thermoanaerobacterium thermosulfurigenes GN=amyA PE=1 SV=2 17 432 2.0E-36
sp|P19531|AMYM_GEOSE Maltogenic alpha-amylase OS=Geobacillus stearothermophilus GN=amyM PE=1 SV=2 54 432 3.0E-36
sp|P27036|CDGT_BACOH Cyclomaltodextrin glucanotransferase OS=Bacillus ohbensis GN=cgt PE=3 SV=2 28 441 3.0E-36
sp|P17692|CDGT_BACS8 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain B1018) GN=cgt PE=1 SV=1 5 432 4.0E-36
sp|P31835|CDGT2_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans PE=1 SV=1 23 432 1.0E-35
sp|O06988|BBMA_BACSU Intracellular maltogenic amylase OS=Bacillus subtilis (strain 168) GN=bbmA PE=3 SV=2 45 382 4.0E-33
sp|Q9R9H8|BBMA_BACIU Intracellular maltogenic amylase OS=Bacillus subtilis GN=bbmA PE=1 SV=2 23 382 7.0E-33
sp|P32818|AMYM_BACAD Maltogenic alpha-amylase OS=Bacillus acidopullulyticus PE=3 SV=1 8 415 7.0E-30
sp|P14898|AMY2_DICT6 Alpha-amylase 2 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=amyB PE=1 SV=2 23 449 1.0E-29
sp|P08704|CDGT_KLEOX Cyclomaltodextrin glucanotransferase OS=Klebsiella oxytoca GN=cgt PE=3 SV=1 3 412 1.0E-29
sp|P38940|NEPU_GEOSE Neopullulanase OS=Geobacillus stearothermophilus GN=nplT PE=1 SV=1 36 447 5.0E-29
sp|P04830|CDGT1_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans GN=cgtM PE=1 SV=2 1 432 1.0E-27
sp|Q8A1G0|SUSA_BACTN Neopullulanase SusA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=susA PE=3 SV=1 25 406 1.0E-26
sp|Q08751|NEPU2_THEVU Neopullulanase 2 OS=Thermoactinomyces vulgaris GN=tvaII PE=1 SV=1 53 441 1.0E-26
sp|Q08341|CDAS_LYSSH Cyclomaltodextrinase OS=Lysinibacillus sphaericus PE=1 SV=1 22 450 2.0E-25
sp|P29964|CDAS_THEP3 Cyclomaltodextrinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=Teth39_0676 PE=1 SV=2 53 434 4.0E-24
sp|P14899|AMY3_DICT6 Alpha-amylase 3 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=amyC PE=3 SV=2 23 379 5.0E-22
sp|O42918|AMY4_SCHPO Alpha-amylase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu7 PE=1 SV=1 190 409 3.0E-21
sp|P25718|AMY1_ECOLI Alpha-amylase OS=Escherichia coli (strain K12) GN=malS PE=1 SV=1 11 225 6.0E-20
sp|O42918|AMY4_SCHPO Alpha-amylase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu7 PE=1 SV=1 14 133 1.0E-19
sp|Q9X2F4|AGLB_THEMA Cyclomaltodextrinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=aglB PE=1 SV=1 54 396 3.0E-18
sp|O86959|AGLB_THENE Cyclomaltodextrinase OS=Thermotoga neapolitana GN=aglB PE=1 SV=1 54 391 9.0E-17
sp|Q05884|AMY_STRLI Alpha-amylase OS=Streptomyces lividans GN=amy PE=1 SV=1 50 134 1.0E-16
sp|Q05884|AMY_STRLI Alpha-amylase OS=Streptomyces lividans GN=amy PE=1 SV=1 183 397 6.0E-16
sp|P38939|APU_THEP3 Amylopullulanase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=apu PE=1 SV=2 53 395 1.0E-15
sp|L8B068|MALA_HALJP Alpha-amylase MalA OS=Haloarcula japonica GN=malA PE=1 SV=1 19 409 9.0E-14
sp|P36905|APU_THESA Amylopullulanase OS=Thermoanaerobacterium saccharolyticum GN=apu PE=3 SV=2 53 395 1.0E-13
sp|P21517|MALZ_ECOLI Maltodextrin glucosidase OS=Escherichia coli (strain K12) GN=malZ PE=1 SV=5 42 410 3.0E-13
sp|P80099|MGTA_THEMA 4-alpha-glucanotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=mgtA PE=1 SV=2 52 346 4.0E-13
sp|P20845|AMY_BACME Alpha-amylase OS=Bacillus megaterium PE=1 SV=1 57 338 5.0E-13
sp|O86956|MGTA_THENE 4-alpha-glucanotransferase OS=Thermotoga neapolitana GN=mgtA PE=1 SV=1 52 346 6.0E-13
sp|Q8LFG1|AMY2_ARATH Probable alpha-amylase 2 OS=Arabidopsis thaliana GN=AMY2 PE=2 SV=1 59 330 2.0E-12
sp|P16950|APU_THETY Amylopullulanase OS=Thermoanaerobacter thermohydrosulfuricus GN=apu PE=1 SV=1 53 457 3.0E-12
sp|P38536|APU_THETU Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes GN=amyB PE=3 SV=2 57 395 4.0E-12
sp|P9WQ19|TRES_MYCTU Trehalose synthase/amylase TreS OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=treS PE=1 SV=1 13 133 4.0E-12
sp|P9WQ18|TRES_MYCTO Trehalose synthase/amylase TreS OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=treS PE=3 SV=1 13 133 4.0E-12
sp|Q55088|TREZ_SULSF Malto-oligosyltrehalose trehalohydrolase OS=Sulfolobus solfataricus GN=treZ PE=1 SV=2 57 210 5.0E-12
sp|P30269|AMY_BUTFI Alpha-amylase OS=Butyrivibrio fibrisolvens GN=amyA PE=3 SV=1 58 250 6.0E-12
sp|P95867|TREZ_SULSO Malto-oligosyltrehalose trehalohydrolase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=treZ PE=1 SV=1 57 210 1.0E-11
sp|Q94A41|AMY3_ARATH Alpha-amylase 3, chloroplastic OS=Arabidopsis thaliana GN=AMY3 PE=2 SV=1 53 281 2.0E-11
sp|P72235|TRES_PIMSR Trehalose synthase OS=Pimelobacter sp. (strain R48) GN=treS PE=3 SV=1 14 133 8.0E-11
sp|P39795|TREC_BACSU Trehalose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) GN=treA PE=1 SV=2 16 133 1.0E-10
sp|A0R6E0|TRES_MYCS2 Trehalose synthase/amylase TreS OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=treS PE=1 SV=1 57 133 2.0E-10
sp|P23671|AMY_CLOAB Alpha-amylase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=amyA PE=3 SV=2 58 249 2.0E-10
sp|Q8A1G3|SUSG_BACTN Alpha-amylase SusG OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=susG PE=1 SV=1 57 135 5.0E-10
sp|O05242|O16G3_BACSU Probable oligo-1,6-glucosidase 3 OS=Bacillus subtilis (strain 168) GN=yugT PE=3 SV=2 57 215 7.0E-10
sp|O34364|O16G2_BACSU Probable oligo-1,6-glucosidase 2 OS=Bacillus subtilis (strain 168) GN=ycdG PE=2 SV=1 20 339 8.0E-10
sp|P08486|AMY_STRHY Alpha-amylase OS=Streptomyces hygroscopicus PE=3 SV=1 73 214 2.0E-09
sp|P17654|AMY1_ORYSJ Alpha-amylase OS=Oryza sativa subsp. japonica GN=AMY1.1 PE=1 SV=2 56 330 2.0E-09
sp|Q59905|DEXB_STREQ Glucan 1,6-alpha-glucosidase OS=Streptococcus dysgalactiae subsp. equisimilis GN=dexB PE=3 SV=1 38 338 2.0E-09
sp|Q9RX51|TREZ_DEIRA Malto-oligosyltrehalose trehalohydrolase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=treZ PE=1 SV=1 57 216 5.0E-09
sp|Q45101|O16G_BACCO Oligo-1,6-glucosidase OS=Bacillus coagulans GN=malL PE=3 SV=1 21 133 6.0E-09
sp|Q17058|MAL1_APIME Alpha-glucosidase OS=Apis mellifera PE=1 SV=1 57 337 6.0E-09
sp|P9WQ21|TREY_MYCTU Putative maltooligosyl trehalose synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=treY PE=1 SV=1 53 142 6.0E-09
sp|P9WQ20|TREY_MYCTO Putative maltooligosyl trehalose synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=treY PE=3 SV=1 53 142 6.0E-09
sp|P21332|O16G_BACCE Oligo-1,6-glucosidase OS=Bacillus cereus GN=malL PE=1 SV=1 57 262 8.0E-09
sp|P29093|O16G_BACF5 Oligo-1,6-glucosidase OS=Bacillus sp. (strain F5) GN=malL PE=1 SV=2 57 133 1.0E-08
sp|Q9RQI5|GLGB_BERDE 1,4-alpha-glucan branching enzyme GlgB OS=Bergeriella denitrificans GN=glgB PE=3 SV=1 58 210 1.0E-08
sp|O06994|O16G1_BACSU Oligo-1,6-glucosidase 1 OS=Bacillus subtilis (strain 168) GN=malL PE=1 SV=1 57 133 3.0E-08
sp|P27350|AMY_STRTL Alpha-amylase OS=Streptomyces thermoviolaceus GN=amy PE=3 SV=2 99 445 4.0E-08
sp|P00691|AMY_BACSU Alpha-amylase OS=Bacillus subtilis (strain 168) GN=amyE PE=1 SV=2 58 248 4.0E-08
sp|P07191|MAL2_DROME Maltase A2 OS=Drosophila melanogaster GN=Mal-A2 PE=2 SV=2 17 213 4.0E-08
sp|Q23834|AM4N_DROAN Alpha-amylase 4N OS=Drosophila ananassae GN=Amy4N PE=3 SV=2 73 301 4.0E-08
sp|P28904|TREC_ECOLI Trehalose-6-phosphate hydrolase OS=Escherichia coli (strain K12) GN=treC PE=3 SV=3 57 337 5.0E-08
sp|Q64319|SLC31_RAT Neutral and basic amino acid transport protein rBAT OS=Rattus norvegicus GN=Slc3a1 PE=1 SV=1 56 133 6.0E-08
sp|P43473|AGL_PEDPE Alpha-glucosidase OS=Pediococcus pentosaceus GN=agl PE=3 SV=1 57 215 6.0E-08
sp|O97396|AMY_PHACE Alpha-amylase OS=Phaedon cochleariae PE=2 SV=1 73 220 8.0E-08
sp|P07190|MAL1_DROME Maltase A1 OS=Drosophila melanogaster GN=Mal-A1 PE=2 SV=2 21 133 1.0E-07
sp|O18345|AMY2_DROAN Alpha-amylase 2 OS=Drosophila ananassae GN=Amy58 PE=3 SV=2 73 301 1.0E-07
sp|P54215|AMYA_DROMA Alpha-amylase A OS=Drosophila mauritiana GN=Amy-d PE=3 SV=1 73 301 1.0E-07
sp|Q23835|AMY1_DROAN Alpha-amylase 1 OS=Drosophila ananassae GN=Amy35 PE=3 SV=3 73 301 1.0E-07
sp|Q91WV7|SLC31_MOUSE Neutral and basic amino acid transport protein rBAT OS=Mus musculus GN=Slc3a1 PE=1 SV=1 56 133 1.0E-07
sp|P40884|IMA5_YEAST Oligo-1,6-glucosidase IMA5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA5 PE=2 SV=1 57 133 2.0E-07
sp|P13507|AMT4_PSEST Glucan 1,4-alpha-maltotetraohydrolase OS=Pseudomonas stutzeri GN=amyP PE=1 SV=2 62 330 2.0E-07
sp|P53354|AMY1_AEDAE Alpha-amylase I OS=Aedes aegypti GN=AMY1 PE=2 SV=2 99 443 2.0E-07
sp|Q07837|SLC31_HUMAN Neutral and basic amino acid transport protein rBAT OS=Homo sapiens GN=SLC3A1 PE=1 SV=2 56 133 2.0E-07
sp|P08144|AMYA_DROME Alpha-amylase A OS=Drosophila melanogaster GN=Amy-p PE=2 SV=1 73 301 3.0E-07
sp|P81641|AMYB_DROME Alpha-amylase B OS=Drosophila melanogaster GN=Amy-d PE=3 SV=3 73 301 3.0E-07
sp|A0R1Y4|GLGB_MYCS2 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glgB PE=3 SV=1 56 210 3.0E-07
sp|Q84HD6|AMYS_NEIME Amylosucrase OS=Neisseria meningitidis GN=ams PE=3 SV=1 11 133 4.0E-07
sp|Q9P6J3|MALT_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mal1 PE=2 SV=1 57 216 4.0E-07
sp|P29094|O16G_GEOTM Oligo-1,6-glucosidase OS=Geobacillus thermoglucosidasius GN=malL PE=1 SV=1 57 133 4.0E-07
sp|P56634|AMY_TENMO Alpha-amylase OS=Tenebrio molitor PE=1 SV=1 68 213 5.0E-07
sp|Q825Q8|GLGB2_STRAW 1,4-alpha-glucan branching enzyme GlgB 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=glgB2 PE=3 SV=1 56 210 5.0E-07
sp|Q82JF0|GLGB1_STRAW 1,4-alpha-glucan branching enzyme GlgB 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=glgB1 PE=3 SV=1 56 134 6.0E-07
sp|Q88FN1|GLGB_PSEPK 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas putida (strain KT2440) GN=glgB PE=3 SV=1 48 210 7.0E-07
sp|Q9Z3R8|AGLA_RHIME Probable alpha-glucosidase OS=Rhizobium meliloti (strain 1021) GN=aglA PE=3 SV=2 13 133 7.0E-07
sp|Q9K8U9|O16G_BACHD Oligo-1,6-glucosidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=malL PE=3 SV=1 20 133 8.0E-07
sp|Q9ZEU2|AMYS_NEIPO Amylosucrase OS=Neisseria polysaccharea GN=ams PE=1 SV=1 11 133 8.0E-07
sp|Q59832|GLGB2_STRCO 1,4-alpha-glucan branching enzyme GlgB 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glgB2 PE=3 SV=2 56 210 9.0E-07
sp|P38158|MAL32_YEAST Alpha-glucosidase MAL32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL32 PE=1 SV=1 57 133 9.0E-07
sp|P07265|MAL62_YEASX Alpha-glucosidase MAL62 OS=Saccharomyces cerevisiae GN=MAL62 PE=1 SV=1 57 133 9.0E-07
sp|O16099|MAL2_DROVI Maltase 2 OS=Drosophila virilis GN=Mal-B2 PE=3 SV=2 12 133 9.0E-07
sp|P53341|MAL12_YEAST Alpha-glucosidase MAL12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL12 PE=1 SV=1 57 133 9.0E-07
sp|B3H0J1|GLGB_ACTP7 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=glgB PE=3 SV=1 66 210 1.0E-06
sp|Q8GQC5|GLGB_DICCH 1,4-alpha-glucan branching enzyme GlgB OS=Dickeya chrysanthemi GN=glgB PE=1 SV=1 58 210 1.0E-06
sp|P52980|GLGB_STRAU 1,4-alpha-glucan branching enzyme GlgB OS=Streptomyces aureofaciens GN=glgB PE=3 SV=1 56 134 1.0E-06
sp|B0BT96|GLGB_ACTPJ 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=glgB PE=3 SV=1 66 210 1.0E-06
sp|P04750|AMY6_HORVU Alpha-amylase type B isozyme OS=Hordeum vulgare GN=AMY1.6 PE=2 SV=2 53 330 1.0E-06
sp|P83833|AMYA_DROYA Alpha-amylase A OS=Drosophila yakuba GN=Amy-p PE=3 SV=1 73 301 1.0E-06
sp|A3D286|GLGB_SHEB5 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=glgB PE=3 SV=1 62 210 1.0E-06
sp|A9KTJ1|GLGB_SHEB9 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS195) GN=glgB PE=3 SV=1 62 210 1.0E-06
sp|A6WKY2|GLGB_SHEB8 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS185) GN=glgB PE=3 SV=1 62 210 1.0E-06
sp|Q9BN01|AMYB_DROYA Alpha-amylase B OS=Drosophila yakuba GN=Amy-d PE=3 SV=2 73 301 1.0E-06
sp|O77020|AMYR_DROAV Alpha-amylase-related protein OS=Drosophila auraria GN=Amyrel PE=3 SV=2 73 213 1.0E-06
sp|B8EAX1|GLGB_SHEB2 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS223) GN=glgB PE=3 SV=1 62 210 1.0E-06
sp|P0CW41|MALX4_YEAST Oligo-1,6-glucosidase IMA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA4 PE=3 SV=1 57 133 2.0E-06
sp|P0CW40|MALX2_YEAST Oligo-1,6-glucosidase IMA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA3 PE=1 SV=1 57 133 2.0E-06
sp|P29957|AMY_PSEHA Alpha-amylase OS=Pseudoalteromonas haloplanktis GN=amy PE=1 SV=3 99 301 2.0E-06
sp|Q6CCT1|GLGB_YARLI 1,4-alpha-glucan-branching enzyme OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLC3 PE=3 SV=1 57 210 2.0E-06
sp|Q47SE7|GLGB_THEFY 1,4-alpha-glucan branching enzyme GlgB OS=Thermobifida fusca (strain YX) GN=glgB PE=3 SV=1 50 210 2.0E-06
sp|O16098|MAL1_DROVI Maltase 1 OS=Drosophila virilis GN=Mal-B1 PE=3 SV=2 19 133 2.0E-06
sp|P53051|MALX3_YEAST Oligo-1,6-glucosidase IMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA1 PE=1 SV=1 57 133 2.0E-06
sp|Q08295|IMA2_YEAST Oligo-1,6-glucosidase IMA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA2 PE=2 SV=1 57 133 2.0E-06
sp|Q9NJN8|AMYR_DROBP Alpha-amylase-related protein OS=Drosophila bipectinata GN=Amyrel PE=3 SV=1 73 216 2.0E-06
sp|Q6FJV0|GLGB_CANGA 1,4-alpha-glucan-branching enzyme OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GLC3 PE=3 SV=1 63 133 2.0E-06
sp|O77022|AMYR_DROPN Alpha-amylase-related protein OS=Drosophila punjabiensis GN=Amyrel PE=3 SV=1 73 213 3.0E-06
sp|Q08047|GLGB_MAIZE 1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic OS=Zea mays GN=SBE1 PE=1 SV=1 66 210 3.0E-06
sp|Q2W2Q6|GLGB_MAGSA 1,4-alpha-glucan branching enzyme GlgB OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=glgB PE=3 SV=1 58 210 3.0E-06
sp|O06458|TRES_THETH Trehalose synthase OS=Thermus thermophilus GN=treS PE=3 SV=1 57 133 3.0E-06
sp|A3MZ64|GLGB_ACTP2 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=glgB PE=3 SV=1 66 210 3.0E-06
sp|Q44315|TREY_ARTSQ Maltooligosyl trehalose synthase OS=Arthrobacter sp. (strain Q36) GN=treY PE=1 SV=1 68 142 3.0E-06
sp|Q9NJN7|AMYR_DROVA Alpha-amylase-related protein OS=Drosophila varians GN=Amyrel PE=3 SV=1 73 216 4.0E-06
sp|Q59833|GLGB1_STRCO 1,4-alpha-glucan branching enzyme GlgB 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glgB1 PE=3 SV=2 56 134 4.0E-06
sp|P22998|AMY_STRVL Alpha-amylase OS=Streptomyces violaceus GN=aml PE=2 SV=1 99 455 4.0E-06
sp|O76262|AMYR_DROLN Alpha-amylase-related protein OS=Drosophila lini GN=Amyrel PE=3 SV=2 73 213 5.0E-06
sp|O77013|AMYR_DROKI Alpha-amylase-related protein OS=Drosophila kikkawai GN=Amyrel PE=3 SV=2 73 213 5.0E-06
sp|Q44316|TREZ_ARTSQ Malto-oligosyltrehalose trehalohydrolase OS=Arthrobacter sp. (strain Q36) GN=treZ PE=3 SV=1 50 216 8.0E-06
sp|P09794|AMY_STRLM Alpha-amylase OS=Streptomyces limosus GN=aml PE=3 SV=1 99 455 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6899
MRSALFLQAWMLCAAMAADTTAWKSRSIYFALTDRIARNGSDEGGGACGNLGNYCGGTFRGLQSKLGYIQNLGFD
AIWITPVVANHDGGYHGYWAQDLYSINPRLGSADDLKSLVNAAHEKGMYVMVDVVANHMGPGPIASNRPAPLDQE
ASYHTPCPIDYTDQRSIENCRIADLPDVKTQDGGIRRLYQDWVRWLVREFGFDGVRIDTVKHVEKDFWPAFAAAA
GVYSIGEVFDGSIDYLAGYARLMSGLLNYAVFYPLNAFYQQKGSSQALVDTHNAVSVRFPDPSALGTFLDNHDNA
RWLSRNPDRALFRNALTYVLLARGIPVLYYGSEQGFAGGDDPANREDLWRTGFDADADLYRFIARLGAVRKAAAG
LPGNDHIHLMVEDTAYAWSRANGDVIALTSNIGSANSRRYCFYTQRPAGRWRDALKGDEYAADVHGHLCADVSHG
EPVVLVSY*
Coding >Hirsu2|6899
ATGCGGTCGGCGCTGTTCCTGCAGGCATGGATGCTCTGCGCCGCCATGGCGGCCGACACGACGGCCTGGAAGTCG
CGCAGCATCTACTTTGCGCTGACGGACCGCATCGCCCGCAACGGCTCGGATGAGGGAGGCGGCGCATGCGGCAAT
CTGGGCAACTACTGCGGAGGGACGTTCCGCGGCTTGCAGTCCAAGCTCGGCTACATCCAGAACCTCGGCTTCGAC
GCCATTTGGATCACGCCCGTCGTGGCAAATCACGATGGCGGCTACCACGGTTACTGGGCCCAGGATCTATACTCG
ATCAACCCACGGCTCGGCTCCGCCGACGACCTCAAGAGCCTCGTCAACGCCGCCCACGAAAAGGGCATGTACGTC
ATGGTCGACGTCGTCGCCAACCACATGGGGCCGGGCCCGATCGCGAGCAACCGGCCGGCGCCCCTGGACCAGGAG
GCATCGTACCACACGCCCTGCCCCATCGACTACACGGACCAGCGCAGCATCGAGAACTGCCGGATCGCGGACCTG
CCGGACGTCAAGACGCAGGACGGCGGCATCCGGCGGCTGTACCAGGACTGGGTGCGCTGGCTGGTTCGCGAATTC
GGCTTCGACGGCGTGCGCATCGACACGGTCAAGCACGTCGAGAAGGACTTCTGGCCGGCCTTCGCGGCCGCCGCC
GGCGTCTACTCCATCGGCGAGGTCTTCGACGGCAGCATCGACTACCTGGCCGGCTACGCCCGCCTCATGTCCGGC
CTGCTCAACTACGCCGTCTTCTACCCGCTCAACGCCTTCTACCAGCAAAAGGGCTCGTCCCAGGCGCTGGTCGAC
ACGCACAACGCCGTCAGCGTCCGCTTCCCGGACCCGTCCGCCCTGGGGACCTTCCTCGACAACCACGACAACGCC
CGCTGGCTGAGCCGCAACCCGGACCGGGCTCTGTTCCGGAACGCGCTGACGTACGTCCTGCTCGCCCGCGGCATC
CCCGTCCTCTACTACGGCTCCGAGCAGGGCTTCGCCGGCGGCGACGACCCGGCCAACCGCGAGGACCTCTGGCGC
ACCGGCTTCGACGCCGACGCCGACCTGTACCGCTTCATCGCCCGCCTCGGCGCCGTCCGCAAGGCCGCCGCCGGC
CTGCCCGGCAACGACCACATCCACCTCATGGTCGAGGACACGGCCTACGCCTGGAGCCGCGCCAACGGAGACGTC
ATCGCCCTGACGAGCAACATCGGGAGCGCCAACTCGAGACGCTACTGCTTCTACACCCAGCGCCCGGCCGGCAGG
TGGAGGGATGCGCTCAAGGGCGACGAGTACGCTGCCGACGTGCACGGCCACTTGTGCGCCGACGTTTCCCATGGC
GAGCCTGTTGTCCTGGTATCTTACTGA
Transcript >Hirsu2|6899
ATGCGGTCGGCGCTGTTCCTGCAGGCATGGATGCTCTGCGCCGCCATGGCGGCCGACACGACGGCCTGGAAGTCG
CGCAGCATCTACTTTGCGCTGACGGACCGCATCGCCCGCAACGGCTCGGATGAGGGAGGCGGCGCATGCGGCAAT
CTGGGCAACTACTGCGGAGGGACGTTCCGCGGCTTGCAGTCCAAGCTCGGCTACATCCAGAACCTCGGCTTCGAC
GCCATTTGGATCACGCCCGTCGTGGCAAATCACGATGGCGGCTACCACGGTTACTGGGCCCAGGATCTATACTCG
ATCAACCCACGGCTCGGCTCCGCCGACGACCTCAAGAGCCTCGTCAACGCCGCCCACGAAAAGGGCATGTACGTC
ATGGTCGACGTCGTCGCCAACCACATGGGGCCGGGCCCGATCGCGAGCAACCGGCCGGCGCCCCTGGACCAGGAG
GCATCGTACCACACGCCCTGCCCCATCGACTACACGGACCAGCGCAGCATCGAGAACTGCCGGATCGCGGACCTG
CCGGACGTCAAGACGCAGGACGGCGGCATCCGGCGGCTGTACCAGGACTGGGTGCGCTGGCTGGTTCGCGAATTC
GGCTTCGACGGCGTGCGCATCGACACGGTCAAGCACGTCGAGAAGGACTTCTGGCCGGCCTTCGCGGCCGCCGCC
GGCGTCTACTCCATCGGCGAGGTCTTCGACGGCAGCATCGACTACCTGGCCGGCTACGCCCGCCTCATGTCCGGC
CTGCTCAACTACGCCGTCTTCTACCCGCTCAACGCCTTCTACCAGCAAAAGGGCTCGTCCCAGGCGCTGGTCGAC
ACGCACAACGCCGTCAGCGTCCGCTTCCCGGACCCGTCCGCCCTGGGGACCTTCCTCGACAACCACGACAACGCC
CGCTGGCTGAGCCGCAACCCGGACCGGGCTCTGTTCCGGAACGCGCTGACGTACGTCCTGCTCGCCCGCGGCATC
CCCGTCCTCTACTACGGCTCCGAGCAGGGCTTCGCCGGCGGCGACGACCCGGCCAACCGCGAGGACCTCTGGCGC
ACCGGCTTCGACGCCGACGCCGACCTGTACCGCTTCATCGCCCGCCTCGGCGCCGTCCGCAAGGCCGCCGCCGGC
CTGCCCGGCAACGACCACATCCACCTCATGGTCGAGGACACGGCCTACGCCTGGAGCCGCGCCAACGGAGACGTC
ATCGCCCTGACGAGCAACATCGGGAGCGCCAACTCGAGACGCTACTGCTTCTACACCCAGCGCCCGGCCGGCAGG
TGGAGGGATGCGCTCAAGGGCGACGAGTACGCTGCCGACGTGCACGGCCACTTGTGCGCCGACGTTTCCCATGGC
GAGCCTGTTGTCCTGGTATCTTACTGA
Gene >Hirsu2|6899
ATGCGGTCGGCGCTGTTCCTGCAGGCATGGATGCTCTGCGCCGCCATGGCGGCCGACACGACGGCCTGGAAGTCG
CGCAGCATCTACTTTGCGCTGACGGACCGCATCGCCCGCAACGGCTCGGATGAGGGAGGCGGCGCATGCGGCAAT
CTGGGCAACTACTGCGGAGGGACGTTCCGCGGCTTGCAGTCCAAGCTCGGCTACATCCAGAACCTCGGCTTCGAC
GCCATTTGGATCACGCCCGTCGTGGCAAGTCAGTCTCACCCCTGAGATCCAACCTCTTCGCTGTTCAGGCGAAGC
AACACCACACAGGTCCTGTCTTCGTTTCCTTGGGCTGACAACTATGCCTTGCCGGGACCAGATCACGATGGCGGC
TACCACGGTTACTGGGCCCAGGATCTATACTCGATCAACCCACGGCTCGGCTCCGCCGACGACCTCAAGAGCCTC
GTCAACGCCGCCCACGAAAAGGTAGGCCGGGCCGGTTTCATCCTTTCGCGAGGACGACAGCGTGTTGAGGCACCG
ACGCTGACACTGATCGAACGACGAAACCCAGGGCATGTACGTCATGGTCGACGTCGTCGCCAACCACATGGGGCC
GGGCCCGATCGCGAGCAACCGGCCGGCGCCCCTGGACCAGGAGGCATCGTACCACACGCCCTGCCCCATCGACTA
CACGGACCAGCGCAGCATCGAGAACTGCCGGATCGCGGACCTGCCGGACGTCAAGACGCAGGACGGCGGCATCCG
GCGGCTGTACCAGGACTGGGTGCGCTGGCTGGTTCGCGAATTCGGCTTCGACGGCGTGCGCATCGACACGGTCAA
GCACGTCGAGAAGGACTTCTGGCCGGCCTTCGCGGCCGCCGCCGGCGTCTACTCCATCGGCGAGGTCTTCGACGG
CAGCATCGACTACCTGGCCGGCTACGCCCGCCTCATGTCCGGCCTGCTCAACTACGCCGTCTTCTACCCGCTCAA
CGCCTTCTACCAGCAAAAGGGCTCGTCCCAGGCGCTGGTCGACACGCACAACGCCGTCAGCGTCCGCTTCCCGGA
CCCGTCCGCCCTGGGGACCTTCCTCGACAACCACGACAACGCCCGCTGGCTGAGCCGCAACCCGGACCGGGCTCT
GTTCCGGAACGCGCTGACGTACGTCCTGCTCGCCCGCGGCATCCCCGTCCTCTACTACGGCTCCGAGCAGGGCTT
CGCCGGCGGCGACGACCCGGCCAACCGCGAGGACCTCTGGCGCACCGGCTTCGACGCCGACGCCGACCTGTACCG
CTTCATCGCCCGCCTCGGCGCCGTCCGCAAGGCCGCCGCCGGCCTGCCCGGCAACGACCACATCCACCTCATGGT
CGAGGACACGGCCTACGCCTGGAGCCGCGCCAACGGAGACGTCATCGCCCTGACGAGCAACATCGGGAGCGCCAA
CTCGAGACGCTACTGCTTCTACACCCAGCGCCCGGCCGGCAGGTGGAGGGATGCGCTCAAGGGCGACGAGTACGC
TGCCGACGTGCACGGCCACTTGTGCGCCGACGTTTCCCATGGCGAGCCTGTTGTCCTGGTATCTTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail