Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6899
Gene name
LocationContig_374:12464..14034
Strand+
Gene length (bp)1570
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00128 Alpha-amylase Alpha amylase, catalytic domain 8.1E-50 57 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C1B4|AMYA3_ASPOR Alpha-amylase A type-3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy3 PE=3 SV=1 23 410 2.0E-107
sp|P0C1B3|AMYA1_ASPOR Alpha-amylase A type-1/2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy1 PE=1 SV=1 23 410 2.0E-107
sp|Q02906|AMYB_ASPAW Alpha-amylase B OS=Aspergillus awamori GN=amyB PE=3 SV=1 23 373 6.0E-107
sp|Q02905|AMYA_ASPAW Alpha-amylase A OS=Aspergillus awamori GN=amyA PE=3 SV=1 23 373 7.0E-107
sp|P30292|AMY_ASPSH Alpha-amylase OS=Aspergillus shirousami GN=amy PE=1 SV=1 23 410 3.0E-106
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C1B4|AMYA3_ASPOR Alpha-amylase A type-3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy3 PE=3 SV=1 23 410 2.0E-107
sp|P0C1B3|AMYA1_ASPOR Alpha-amylase A type-1/2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy1 PE=1 SV=1 23 410 2.0E-107
sp|Q02906|AMYB_ASPAW Alpha-amylase B OS=Aspergillus awamori GN=amyB PE=3 SV=1 23 373 6.0E-107
sp|Q02905|AMYA_ASPAW Alpha-amylase A OS=Aspergillus awamori GN=amyA PE=3 SV=1 23 373 7.0E-107
sp|P30292|AMY_ASPSH Alpha-amylase OS=Aspergillus shirousami GN=amy PE=1 SV=1 23 410 3.0E-106
sp|Q08806|AMY2_SCHOC Alpha-amylase 2 OS=Schwanniomyces occidentalis GN=SWA2 PE=3 SV=1 22 454 4.0E-99
sp|Q01117|AMY1_LIPKO Alpha-amylase 1 OS=Lipomyces kononenkoae GN=LKA1 PE=1 SV=2 23 373 1.0E-95
sp|P21567|AMY1_SACFI Alpha-amylase OS=Saccharomycopsis fibuligera GN=ALP1 PE=3 SV=1 23 412 3.0E-94
sp|P56271|AMYA_ASPNG Acid alpha-amylase OS=Aspergillus niger PE=1 SV=1 22 456 6.0E-90
sp|P19269|AMY1_SCHOC Alpha-amylase 1 OS=Schwanniomyces occidentalis GN=AMY1 PE=1 SV=1 16 454 1.0E-86
sp|O14154|MDE5_SCHPO Alpha-amylase mde5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde5 PE=2 SV=1 11 458 2.0E-81
sp|Q10427|YQ29_SCHPO Uncharacterized glycosyl hydrolase C11E10.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC11E10.09c PE=3 SV=1 11 414 3.0E-80
sp|O13996|YEI1_SCHPO Uncharacterized glycosyl hydrolase C27E2.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27E2.01 PE=3 SV=1 23 437 1.0E-79
sp|Q09840|AMY2_SCHPO Alpha-amylase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah2 PE=1 SV=1 2 455 2.0E-76
sp|Q9Y7S9|AMY3_SCHPO Alpha-amylase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah3 PE=1 SV=1 5 455 2.0E-75
sp|P21543|AMYB_PAEPO Beta/alpha-amylase OS=Paenibacillus polymyxa PE=1 SV=1 21 413 2.0E-72
sp|O74922|AMY1_SCHPO Alpha-amylase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah1 PE=3 SV=1 12 373 1.0E-65
sp|P09121|CDGT_BACS3 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 38-2) GN=cgt PE=1 SV=2 46 432 8.0E-42
sp|P31797|CDGT_GEOSE Cyclomaltodextrin glucanotransferase OS=Geobacillus stearothermophilus GN=cgt PE=1 SV=1 3 432 9.0E-41
sp|P30920|CDGT1_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans PE=1 SV=1 28 432 4.0E-40
sp|P31747|CDGT_BACSS Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 6.6.3) GN=cgt PE=3 SV=1 28 432 1.0E-39
sp|P14014|CDGT_BACLI Cyclomaltodextrin glucanotransferase OS=Bacillus licheniformis GN=cgtA PE=3 SV=1 28 432 2.0E-39
sp|P05618|CDGT_BACS0 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1011) GN=cgt PE=1 SV=1 46 432 3.0E-39
sp|P43379|CDGT2_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans GN=cgt PE=1 SV=1 5 432 5.0E-39
sp|P31746|CDGT_BACS2 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1-1) GN=cgt PE=1 SV=1 12 431 6.0E-39
sp|P08137|AMY_BACCI Alpha-amylase OS=Bacillus circulans PE=3 SV=1 14 430 4.0E-38
sp|P30921|CDGT_BAC11 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 17-1) GN=cgt PE=1 SV=1 46 428 9.0E-38
sp|O30565|CDGT_BREBE Cyclomaltodextrin glucanotransferase OS=Brevibacillus brevis GN=cgt PE=3 SV=1 6 431 3.0E-37
sp|P26827|CDGT_THETU Cyclomaltodextrin glucanotransferase OS=Thermoanaerobacterium thermosulfurigenes GN=amyA PE=1 SV=2 17 432 2.0E-36
sp|P19531|AMYM_GEOSE Maltogenic alpha-amylase OS=Geobacillus stearothermophilus GN=amyM PE=1 SV=2 54 432 3.0E-36
sp|P27036|CDGT_BACOH Cyclomaltodextrin glucanotransferase OS=Bacillus ohbensis GN=cgt PE=3 SV=2 28 441 3.0E-36
sp|P17692|CDGT_BACS8 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain B1018) GN=cgt PE=1 SV=1 5 432 4.0E-36
sp|P31835|CDGT2_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans PE=1 SV=1 23 432 1.0E-35
sp|O06988|BBMA_BACSU Intracellular maltogenic amylase OS=Bacillus subtilis (strain 168) GN=bbmA PE=3 SV=2 45 382 4.0E-33
sp|Q9R9H8|BBMA_BACIU Intracellular maltogenic amylase OS=Bacillus subtilis GN=bbmA PE=1 SV=2 23 382 7.0E-33
sp|P32818|AMYM_BACAD Maltogenic alpha-amylase OS=Bacillus acidopullulyticus PE=3 SV=1 8 415 7.0E-30
sp|P14898|AMY2_DICT6 Alpha-amylase 2 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=amyB PE=1 SV=2 23 449 1.0E-29
sp|P08704|CDGT_KLEOX Cyclomaltodextrin glucanotransferase OS=Klebsiella oxytoca GN=cgt PE=3 SV=1 3 412 1.0E-29
sp|P38940|NEPU_GEOSE Neopullulanase OS=Geobacillus stearothermophilus GN=nplT PE=1 SV=1 36 447 5.0E-29
sp|P04830|CDGT1_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans GN=cgtM PE=1 SV=2 1 432 1.0E-27
sp|Q8A1G0|SUSA_BACTN Neopullulanase SusA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=susA PE=3 SV=1 25 406 1.0E-26
sp|Q08751|NEPU2_THEVU Neopullulanase 2 OS=Thermoactinomyces vulgaris GN=tvaII PE=1 SV=1 53 441 1.0E-26
sp|Q08341|CDAS_LYSSH Cyclomaltodextrinase OS=Lysinibacillus sphaericus PE=1 SV=1 22 450 2.0E-25
sp|P29964|CDAS_THEP3 Cyclomaltodextrinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=Teth39_0676 PE=1 SV=2 53 434 4.0E-24
sp|P14899|AMY3_DICT6 Alpha-amylase 3 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=amyC PE=3 SV=2 23 379 5.0E-22
sp|O42918|AMY4_SCHPO Alpha-amylase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu7 PE=1 SV=1 190 409 3.0E-21
sp|P25718|AMY1_ECOLI Alpha-amylase OS=Escherichia coli (strain K12) GN=malS PE=1 SV=1 11 225 6.0E-20
sp|O42918|AMY4_SCHPO Alpha-amylase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu7 PE=1 SV=1 14 133 1.0E-19
sp|Q9X2F4|AGLB_THEMA Cyclomaltodextrinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=aglB PE=1 SV=1 54 396 3.0E-18
sp|O86959|AGLB_THENE Cyclomaltodextrinase OS=Thermotoga neapolitana GN=aglB PE=1 SV=1 54 391 9.0E-17
sp|Q05884|AMY_STRLI Alpha-amylase OS=Streptomyces lividans GN=amy PE=1 SV=1 50 134 1.0E-16
sp|Q05884|AMY_STRLI Alpha-amylase OS=Streptomyces lividans GN=amy PE=1 SV=1 183 397 6.0E-16
sp|P38939|APU_THEP3 Amylopullulanase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=apu PE=1 SV=2 53 395 1.0E-15
sp|L8B068|MALA_HALJP Alpha-amylase MalA OS=Haloarcula japonica GN=malA PE=1 SV=1 19 409 9.0E-14
sp|P36905|APU_THESA Amylopullulanase OS=Thermoanaerobacterium saccharolyticum GN=apu PE=3 SV=2 53 395 1.0E-13
sp|P21517|MALZ_ECOLI Maltodextrin glucosidase OS=Escherichia coli (strain K12) GN=malZ PE=1 SV=5 42 410 3.0E-13
sp|P80099|MGTA_THEMA 4-alpha-glucanotransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=mgtA PE=1 SV=2 52 346 4.0E-13
sp|P20845|AMY_BACME Alpha-amylase OS=Bacillus megaterium PE=1 SV=1 57 338 5.0E-13
sp|O86956|MGTA_THENE 4-alpha-glucanotransferase OS=Thermotoga neapolitana GN=mgtA PE=1 SV=1 52 346 6.0E-13
sp|Q8LFG1|AMY2_ARATH Probable alpha-amylase 2 OS=Arabidopsis thaliana GN=AMY2 PE=2 SV=1 59 330 2.0E-12
sp|P16950|APU_THETY Amylopullulanase OS=Thermoanaerobacter thermohydrosulfuricus GN=apu PE=1 SV=1 53 457 3.0E-12
sp|P38536|APU_THETU Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes GN=amyB PE=3 SV=2 57 395 4.0E-12
sp|P9WQ19|TRES_MYCTU Trehalose synthase/amylase TreS OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=treS PE=1 SV=1 13 133 4.0E-12
sp|P9WQ18|TRES_MYCTO Trehalose synthase/amylase TreS OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=treS PE=3 SV=1 13 133 4.0E-12
sp|Q55088|TREZ_SULSF Malto-oligosyltrehalose trehalohydrolase OS=Sulfolobus solfataricus GN=treZ PE=1 SV=2 57 210 5.0E-12
sp|P30269|AMY_BUTFI Alpha-amylase OS=Butyrivibrio fibrisolvens GN=amyA PE=3 SV=1 58 250 6.0E-12
sp|P95867|TREZ_SULSO Malto-oligosyltrehalose trehalohydrolase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=treZ PE=1 SV=1 57 210 1.0E-11
sp|Q94A41|AMY3_ARATH Alpha-amylase 3, chloroplastic OS=Arabidopsis thaliana GN=AMY3 PE=2 SV=1 53 281 2.0E-11
sp|P72235|TRES_PIMSR Trehalose synthase OS=Pimelobacter sp. (strain R48) GN=treS PE=3 SV=1 14 133 8.0E-11
sp|P39795|TREC_BACSU Trehalose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) GN=treA PE=1 SV=2 16 133 1.0E-10
sp|A0R6E0|TRES_MYCS2 Trehalose synthase/amylase TreS OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=treS PE=1 SV=1 57 133 2.0E-10
sp|P23671|AMY_CLOAB Alpha-amylase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=amyA PE=3 SV=2 58 249 2.0E-10
sp|Q8A1G3|SUSG_BACTN Alpha-amylase SusG OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=susG PE=1 SV=1 57 135 5.0E-10
sp|O05242|O16G3_BACSU Probable oligo-1,6-glucosidase 3 OS=Bacillus subtilis (strain 168) GN=yugT PE=3 SV=2 57 215 7.0E-10
sp|O34364|O16G2_BACSU Probable oligo-1,6-glucosidase 2 OS=Bacillus subtilis (strain 168) GN=ycdG PE=2 SV=1 20 339 8.0E-10
sp|P08486|AMY_STRHY Alpha-amylase OS=Streptomyces hygroscopicus PE=3 SV=1 73 214 2.0E-09
sp|P17654|AMY1_ORYSJ Alpha-amylase OS=Oryza sativa subsp. japonica GN=AMY1.1 PE=1 SV=2 56 330 2.0E-09
sp|Q59905|DEXB_STREQ Glucan 1,6-alpha-glucosidase OS=Streptococcus dysgalactiae subsp. equisimilis GN=dexB PE=3 SV=1 38 338 2.0E-09
sp|Q9RX51|TREZ_DEIRA Malto-oligosyltrehalose trehalohydrolase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=treZ PE=1 SV=1 57 216 5.0E-09
sp|Q45101|O16G_BACCO Oligo-1,6-glucosidase OS=Bacillus coagulans GN=malL PE=3 SV=1 21 133 6.0E-09
sp|Q17058|MAL1_APIME Alpha-glucosidase OS=Apis mellifera PE=1 SV=1 57 337 6.0E-09
sp|P9WQ21|TREY_MYCTU Putative maltooligosyl trehalose synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=treY PE=1 SV=1 53 142 6.0E-09
sp|P9WQ20|TREY_MYCTO Putative maltooligosyl trehalose synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=treY PE=3 SV=1 53 142 6.0E-09
sp|P21332|O16G_BACCE Oligo-1,6-glucosidase OS=Bacillus cereus GN=malL PE=1 SV=1 57 262 8.0E-09
sp|P29093|O16G_BACF5 Oligo-1,6-glucosidase OS=Bacillus sp. (strain F5) GN=malL PE=1 SV=2 57 133 1.0E-08
sp|Q9RQI5|GLGB_BERDE 1,4-alpha-glucan branching enzyme GlgB OS=Bergeriella denitrificans GN=glgB PE=3 SV=1 58 210 1.0E-08
sp|O06994|O16G1_BACSU Oligo-1,6-glucosidase 1 OS=Bacillus subtilis (strain 168) GN=malL PE=1 SV=1 57 133 3.0E-08
sp|P27350|AMY_STRTL Alpha-amylase OS=Streptomyces thermoviolaceus GN=amy PE=3 SV=2 99 445 4.0E-08
sp|P00691|AMY_BACSU Alpha-amylase OS=Bacillus subtilis (strain 168) GN=amyE PE=1 SV=2 58 248 4.0E-08
sp|P07191|MAL2_DROME Maltase A2 OS=Drosophila melanogaster GN=Mal-A2 PE=2 SV=2 17 213 4.0E-08
sp|Q23834|AM4N_DROAN Alpha-amylase 4N OS=Drosophila ananassae GN=Amy4N PE=3 SV=2 73 301 4.0E-08
sp|P28904|TREC_ECOLI Trehalose-6-phosphate hydrolase OS=Escherichia coli (strain K12) GN=treC PE=3 SV=3 57 337 5.0E-08
sp|Q64319|SLC31_RAT Neutral and basic amino acid transport protein rBAT OS=Rattus norvegicus GN=Slc3a1 PE=1 SV=1 56 133 6.0E-08
sp|P43473|AGL_PEDPE Alpha-glucosidase OS=Pediococcus pentosaceus GN=agl PE=3 SV=1 57 215 6.0E-08
sp|O97396|AMY_PHACE Alpha-amylase OS=Phaedon cochleariae PE=2 SV=1 73 220 8.0E-08
sp|P07190|MAL1_DROME Maltase A1 OS=Drosophila melanogaster GN=Mal-A1 PE=2 SV=2 21 133 1.0E-07
sp|O18345|AMY2_DROAN Alpha-amylase 2 OS=Drosophila ananassae GN=Amy58 PE=3 SV=2 73 301 1.0E-07
sp|P54215|AMYA_DROMA Alpha-amylase A OS=Drosophila mauritiana GN=Amy-d PE=3 SV=1 73 301 1.0E-07
sp|Q23835|AMY1_DROAN Alpha-amylase 1 OS=Drosophila ananassae GN=Amy35 PE=3 SV=3 73 301 1.0E-07
sp|Q91WV7|SLC31_MOUSE Neutral and basic amino acid transport protein rBAT OS=Mus musculus GN=Slc3a1 PE=1 SV=1 56 133 1.0E-07
sp|P40884|IMA5_YEAST Oligo-1,6-glucosidase IMA5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA5 PE=2 SV=1 57 133 2.0E-07
sp|P13507|AMT4_PSEST Glucan 1,4-alpha-maltotetraohydrolase OS=Pseudomonas stutzeri GN=amyP PE=1 SV=2 62 330 2.0E-07
sp|P53354|AMY1_AEDAE Alpha-amylase I OS=Aedes aegypti GN=AMY1 PE=2 SV=2 99 443 2.0E-07
sp|Q07837|SLC31_HUMAN Neutral and basic amino acid transport protein rBAT OS=Homo sapiens GN=SLC3A1 PE=1 SV=2 56 133 2.0E-07
sp|P08144|AMYA_DROME Alpha-amylase A OS=Drosophila melanogaster GN=Amy-p PE=2 SV=1 73 301 3.0E-07
sp|P81641|AMYB_DROME Alpha-amylase B OS=Drosophila melanogaster GN=Amy-d PE=3 SV=3 73 301 3.0E-07
sp|A0R1Y4|GLGB_MYCS2 1,4-alpha-glucan branching enzyme GlgB OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=glgB PE=3 SV=1 56 210 3.0E-07
sp|Q84HD6|AMYS_NEIME Amylosucrase OS=Neisseria meningitidis GN=ams PE=3 SV=1 11 133 4.0E-07
sp|Q9P6J3|MALT_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mal1 PE=2 SV=1 57 216 4.0E-07
sp|P29094|O16G_GEOTM Oligo-1,6-glucosidase OS=Geobacillus thermoglucosidasius GN=malL PE=1 SV=1 57 133 4.0E-07
sp|P56634|AMY_TENMO Alpha-amylase OS=Tenebrio molitor PE=1 SV=1 68 213 5.0E-07
sp|Q825Q8|GLGB2_STRAW 1,4-alpha-glucan branching enzyme GlgB 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=glgB2 PE=3 SV=1 56 210 5.0E-07
sp|Q82JF0|GLGB1_STRAW 1,4-alpha-glucan branching enzyme GlgB 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=glgB1 PE=3 SV=1 56 134 6.0E-07
sp|Q88FN1|GLGB_PSEPK 1,4-alpha-glucan branching enzyme GlgB OS=Pseudomonas putida (strain KT2440) GN=glgB PE=3 SV=1 48 210 7.0E-07
sp|Q9Z3R8|AGLA_RHIME Probable alpha-glucosidase OS=Rhizobium meliloti (strain 1021) GN=aglA PE=3 SV=2 13 133 7.0E-07
sp|Q9K8U9|O16G_BACHD Oligo-1,6-glucosidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=malL PE=3 SV=1 20 133 8.0E-07
sp|Q9ZEU2|AMYS_NEIPO Amylosucrase OS=Neisseria polysaccharea GN=ams PE=1 SV=1 11 133 8.0E-07
sp|Q59832|GLGB2_STRCO 1,4-alpha-glucan branching enzyme GlgB 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glgB2 PE=3 SV=2 56 210 9.0E-07
sp|P38158|MAL32_YEAST Alpha-glucosidase MAL32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL32 PE=1 SV=1 57 133 9.0E-07
sp|P07265|MAL62_YEASX Alpha-glucosidase MAL62 OS=Saccharomyces cerevisiae GN=MAL62 PE=1 SV=1 57 133 9.0E-07
sp|O16099|MAL2_DROVI Maltase 2 OS=Drosophila virilis GN=Mal-B2 PE=3 SV=2 12 133 9.0E-07
sp|P53341|MAL12_YEAST Alpha-glucosidase MAL12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL12 PE=1 SV=1 57 133 9.0E-07
sp|B3H0J1|GLGB_ACTP7 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=glgB PE=3 SV=1 66 210 1.0E-06
sp|Q8GQC5|GLGB_DICCH 1,4-alpha-glucan branching enzyme GlgB OS=Dickeya chrysanthemi GN=glgB PE=1 SV=1 58 210 1.0E-06
sp|P52980|GLGB_STRAU 1,4-alpha-glucan branching enzyme GlgB OS=Streptomyces aureofaciens GN=glgB PE=3 SV=1 56 134 1.0E-06
sp|B0BT96|GLGB_ACTPJ 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=glgB PE=3 SV=1 66 210 1.0E-06
sp|P04750|AMY6_HORVU Alpha-amylase type B isozyme OS=Hordeum vulgare GN=AMY1.6 PE=2 SV=2 53 330 1.0E-06
sp|P83833|AMYA_DROYA Alpha-amylase A OS=Drosophila yakuba GN=Amy-p PE=3 SV=1 73 301 1.0E-06
sp|A3D286|GLGB_SHEB5 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=glgB PE=3 SV=1 62 210 1.0E-06
sp|A9KTJ1|GLGB_SHEB9 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS195) GN=glgB PE=3 SV=1 62 210 1.0E-06
sp|A6WKY2|GLGB_SHEB8 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS185) GN=glgB PE=3 SV=1 62 210 1.0E-06
sp|Q9BN01|AMYB_DROYA Alpha-amylase B OS=Drosophila yakuba GN=Amy-d PE=3 SV=2 73 301 1.0E-06
sp|O77020|AMYR_DROAV Alpha-amylase-related protein OS=Drosophila auraria GN=Amyrel PE=3 SV=2 73 213 1.0E-06
sp|B8EAX1|GLGB_SHEB2 1,4-alpha-glucan branching enzyme GlgB OS=Shewanella baltica (strain OS223) GN=glgB PE=3 SV=1 62 210 1.0E-06
sp|P0CW41|MALX4_YEAST Oligo-1,6-glucosidase IMA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA4 PE=3 SV=1 57 133 2.0E-06
sp|P0CW40|MALX2_YEAST Oligo-1,6-glucosidase IMA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA3 PE=1 SV=1 57 133 2.0E-06
sp|P29957|AMY_PSEHA Alpha-amylase OS=Pseudoalteromonas haloplanktis GN=amy PE=1 SV=3 99 301 2.0E-06
sp|Q6CCT1|GLGB_YARLI 1,4-alpha-glucan-branching enzyme OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLC3 PE=3 SV=1 57 210 2.0E-06
sp|Q47SE7|GLGB_THEFY 1,4-alpha-glucan branching enzyme GlgB OS=Thermobifida fusca (strain YX) GN=glgB PE=3 SV=1 50 210 2.0E-06
sp|O16098|MAL1_DROVI Maltase 1 OS=Drosophila virilis GN=Mal-B1 PE=3 SV=2 19 133 2.0E-06
sp|P53051|MALX3_YEAST Oligo-1,6-glucosidase IMA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA1 PE=1 SV=1 57 133 2.0E-06
sp|Q08295|IMA2_YEAST Oligo-1,6-glucosidase IMA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA2 PE=2 SV=1 57 133 2.0E-06
sp|Q9NJN8|AMYR_DROBP Alpha-amylase-related protein OS=Drosophila bipectinata GN=Amyrel PE=3 SV=1 73 216 2.0E-06
sp|Q6FJV0|GLGB_CANGA 1,4-alpha-glucan-branching enzyme OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GLC3 PE=3 SV=1 63 133 2.0E-06
sp|O77022|AMYR_DROPN Alpha-amylase-related protein OS=Drosophila punjabiensis GN=Amyrel PE=3 SV=1 73 213 3.0E-06
sp|Q08047|GLGB_MAIZE 1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic OS=Zea mays GN=SBE1 PE=1 SV=1 66 210 3.0E-06
sp|Q2W2Q6|GLGB_MAGSA 1,4-alpha-glucan branching enzyme GlgB OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=glgB PE=3 SV=1 58 210 3.0E-06
sp|O06458|TRES_THETH Trehalose synthase OS=Thermus thermophilus GN=treS PE=3 SV=1 57 133 3.0E-06
sp|A3MZ64|GLGB_ACTP2 1,4-alpha-glucan branching enzyme GlgB OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=glgB PE=3 SV=1 66 210 3.0E-06
sp|Q44315|TREY_ARTSQ Maltooligosyl trehalose synthase OS=Arthrobacter sp. (strain Q36) GN=treY PE=1 SV=1 68 142 3.0E-06
sp|Q9NJN7|AMYR_DROVA Alpha-amylase-related protein OS=Drosophila varians GN=Amyrel PE=3 SV=1 73 216 4.0E-06
sp|Q59833|GLGB1_STRCO 1,4-alpha-glucan branching enzyme GlgB 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=glgB1 PE=3 SV=2 56 134 4.0E-06
sp|P22998|AMY_STRVL Alpha-amylase OS=Streptomyces violaceus GN=aml PE=2 SV=1 99 455 4.0E-06
sp|O76262|AMYR_DROLN Alpha-amylase-related protein OS=Drosophila lini GN=Amyrel PE=3 SV=2 73 213 5.0E-06
sp|O77013|AMYR_DROKI Alpha-amylase-related protein OS=Drosophila kikkawai GN=Amyrel PE=3 SV=2 73 213 5.0E-06
sp|Q44316|TREZ_ARTSQ Malto-oligosyltrehalose trehalohydrolase OS=Arthrobacter sp. (strain Q36) GN=treZ PE=3 SV=1 50 216 8.0E-06
sp|P09794|AMY_STRLM Alpha-amylase OS=Streptomyces limosus GN=aml PE=3 SV=1 99 455 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1655 0.0985 0.9173 0.1095 0.1552 0.0714 0.2545 0.3565 0.0909 0.0042

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999676

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH13_1 1.1E-104 56 344

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6716
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02987
Ophiocordyceps camponoti-rufipedis Ophun1|5328
Ophiocordyceps kimflemingae Ophio5|7346
Ophiocordyceps subramaniannii Hirsu2|6899 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6899
MRSALFLQAWMLCAAMAADTTAWKSRSIYFALTDRIARNGSDEGGGACGNLGNYCGGTFRGLQSKLGYIQNLGFD
AIWITPVVANHDGGYHGYWAQDLYSINPRLGSADDLKSLVNAAHEKGMYVMVDVVANHMGPGPIASNRPAPLDQE
ASYHTPCPIDYTDQRSIENCRIADLPDVKTQDGGIRRLYQDWVRWLVREFGFDGVRIDTVKHVEKDFWPAFAAAA
GVYSIGEVFDGSIDYLAGYARLMSGLLNYAVFYPLNAFYQQKGSSQALVDTHNAVSVRFPDPSALGTFLDNHDNA
RWLSRNPDRALFRNALTYVLLARGIPVLYYGSEQGFAGGDDPANREDLWRTGFDADADLYRFIARLGAVRKAAAG
LPGNDHIHLMVEDTAYAWSRANGDVIALTSNIGSANSRRYCFYTQRPAGRWRDALKGDEYAADVHGHLCADVSHG
EPVVLVSY*
Coding >Hirsu2|6899
ATGCGGTCGGCGCTGTTCCTGCAGGCATGGATGCTCTGCGCCGCCATGGCGGCCGACACGACGGCCTGGAAGTCG
CGCAGCATCTACTTTGCGCTGACGGACCGCATCGCCCGCAACGGCTCGGATGAGGGAGGCGGCGCATGCGGCAAT
CTGGGCAACTACTGCGGAGGGACGTTCCGCGGCTTGCAGTCCAAGCTCGGCTACATCCAGAACCTCGGCTTCGAC
GCCATTTGGATCACGCCCGTCGTGGCAAATCACGATGGCGGCTACCACGGTTACTGGGCCCAGGATCTATACTCG
ATCAACCCACGGCTCGGCTCCGCCGACGACCTCAAGAGCCTCGTCAACGCCGCCCACGAAAAGGGCATGTACGTC
ATGGTCGACGTCGTCGCCAACCACATGGGGCCGGGCCCGATCGCGAGCAACCGGCCGGCGCCCCTGGACCAGGAG
GCATCGTACCACACGCCCTGCCCCATCGACTACACGGACCAGCGCAGCATCGAGAACTGCCGGATCGCGGACCTG
CCGGACGTCAAGACGCAGGACGGCGGCATCCGGCGGCTGTACCAGGACTGGGTGCGCTGGCTGGTTCGCGAATTC
GGCTTCGACGGCGTGCGCATCGACACGGTCAAGCACGTCGAGAAGGACTTCTGGCCGGCCTTCGCGGCCGCCGCC
GGCGTCTACTCCATCGGCGAGGTCTTCGACGGCAGCATCGACTACCTGGCCGGCTACGCCCGCCTCATGTCCGGC
CTGCTCAACTACGCCGTCTTCTACCCGCTCAACGCCTTCTACCAGCAAAAGGGCTCGTCCCAGGCGCTGGTCGAC
ACGCACAACGCCGTCAGCGTCCGCTTCCCGGACCCGTCCGCCCTGGGGACCTTCCTCGACAACCACGACAACGCC
CGCTGGCTGAGCCGCAACCCGGACCGGGCTCTGTTCCGGAACGCGCTGACGTACGTCCTGCTCGCCCGCGGCATC
CCCGTCCTCTACTACGGCTCCGAGCAGGGCTTCGCCGGCGGCGACGACCCGGCCAACCGCGAGGACCTCTGGCGC
ACCGGCTTCGACGCCGACGCCGACCTGTACCGCTTCATCGCCCGCCTCGGCGCCGTCCGCAAGGCCGCCGCCGGC
CTGCCCGGCAACGACCACATCCACCTCATGGTCGAGGACACGGCCTACGCCTGGAGCCGCGCCAACGGAGACGTC
ATCGCCCTGACGAGCAACATCGGGAGCGCCAACTCGAGACGCTACTGCTTCTACACCCAGCGCCCGGCCGGCAGG
TGGAGGGATGCGCTCAAGGGCGACGAGTACGCTGCCGACGTGCACGGCCACTTGTGCGCCGACGTTTCCCATGGC
GAGCCTGTTGTCCTGGTATCTTACTGA
Transcript >Hirsu2|6899
ATGCGGTCGGCGCTGTTCCTGCAGGCATGGATGCTCTGCGCCGCCATGGCGGCCGACACGACGGCCTGGAAGTCG
CGCAGCATCTACTTTGCGCTGACGGACCGCATCGCCCGCAACGGCTCGGATGAGGGAGGCGGCGCATGCGGCAAT
CTGGGCAACTACTGCGGAGGGACGTTCCGCGGCTTGCAGTCCAAGCTCGGCTACATCCAGAACCTCGGCTTCGAC
GCCATTTGGATCACGCCCGTCGTGGCAAATCACGATGGCGGCTACCACGGTTACTGGGCCCAGGATCTATACTCG
ATCAACCCACGGCTCGGCTCCGCCGACGACCTCAAGAGCCTCGTCAACGCCGCCCACGAAAAGGGCATGTACGTC
ATGGTCGACGTCGTCGCCAACCACATGGGGCCGGGCCCGATCGCGAGCAACCGGCCGGCGCCCCTGGACCAGGAG
GCATCGTACCACACGCCCTGCCCCATCGACTACACGGACCAGCGCAGCATCGAGAACTGCCGGATCGCGGACCTG
CCGGACGTCAAGACGCAGGACGGCGGCATCCGGCGGCTGTACCAGGACTGGGTGCGCTGGCTGGTTCGCGAATTC
GGCTTCGACGGCGTGCGCATCGACACGGTCAAGCACGTCGAGAAGGACTTCTGGCCGGCCTTCGCGGCCGCCGCC
GGCGTCTACTCCATCGGCGAGGTCTTCGACGGCAGCATCGACTACCTGGCCGGCTACGCCCGCCTCATGTCCGGC
CTGCTCAACTACGCCGTCTTCTACCCGCTCAACGCCTTCTACCAGCAAAAGGGCTCGTCCCAGGCGCTGGTCGAC
ACGCACAACGCCGTCAGCGTCCGCTTCCCGGACCCGTCCGCCCTGGGGACCTTCCTCGACAACCACGACAACGCC
CGCTGGCTGAGCCGCAACCCGGACCGGGCTCTGTTCCGGAACGCGCTGACGTACGTCCTGCTCGCCCGCGGCATC
CCCGTCCTCTACTACGGCTCCGAGCAGGGCTTCGCCGGCGGCGACGACCCGGCCAACCGCGAGGACCTCTGGCGC
ACCGGCTTCGACGCCGACGCCGACCTGTACCGCTTCATCGCCCGCCTCGGCGCCGTCCGCAAGGCCGCCGCCGGC
CTGCCCGGCAACGACCACATCCACCTCATGGTCGAGGACACGGCCTACGCCTGGAGCCGCGCCAACGGAGACGTC
ATCGCCCTGACGAGCAACATCGGGAGCGCCAACTCGAGACGCTACTGCTTCTACACCCAGCGCCCGGCCGGCAGG
TGGAGGGATGCGCTCAAGGGCGACGAGTACGCTGCCGACGTGCACGGCCACTTGTGCGCCGACGTTTCCCATGGC
GAGCCTGTTGTCCTGGTATCTTACTGA
Gene >Hirsu2|6899
ATGCGGTCGGCGCTGTTCCTGCAGGCATGGATGCTCTGCGCCGCCATGGCGGCCGACACGACGGCCTGGAAGTCG
CGCAGCATCTACTTTGCGCTGACGGACCGCATCGCCCGCAACGGCTCGGATGAGGGAGGCGGCGCATGCGGCAAT
CTGGGCAACTACTGCGGAGGGACGTTCCGCGGCTTGCAGTCCAAGCTCGGCTACATCCAGAACCTCGGCTTCGAC
GCCATTTGGATCACGCCCGTCGTGGCAAGTCAGTCTCACCCCTGAGATCCAACCTCTTCGCTGTTCAGGCGAAGC
AACACCACACAGGTCCTGTCTTCGTTTCCTTGGGCTGACAACTATGCCTTGCCGGGACCAGATCACGATGGCGGC
TACCACGGTTACTGGGCCCAGGATCTATACTCGATCAACCCACGGCTCGGCTCCGCCGACGACCTCAAGAGCCTC
GTCAACGCCGCCCACGAAAAGGTAGGCCGGGCCGGTTTCATCCTTTCGCGAGGACGACAGCGTGTTGAGGCACCG
ACGCTGACACTGATCGAACGACGAAACCCAGGGCATGTACGTCATGGTCGACGTCGTCGCCAACCACATGGGGCC
GGGCCCGATCGCGAGCAACCGGCCGGCGCCCCTGGACCAGGAGGCATCGTACCACACGCCCTGCCCCATCGACTA
CACGGACCAGCGCAGCATCGAGAACTGCCGGATCGCGGACCTGCCGGACGTCAAGACGCAGGACGGCGGCATCCG
GCGGCTGTACCAGGACTGGGTGCGCTGGCTGGTTCGCGAATTCGGCTTCGACGGCGTGCGCATCGACACGGTCAA
GCACGTCGAGAAGGACTTCTGGCCGGCCTTCGCGGCCGCCGCCGGCGTCTACTCCATCGGCGAGGTCTTCGACGG
CAGCATCGACTACCTGGCCGGCTACGCCCGCCTCATGTCCGGCCTGCTCAACTACGCCGTCTTCTACCCGCTCAA
CGCCTTCTACCAGCAAAAGGGCTCGTCCCAGGCGCTGGTCGACACGCACAACGCCGTCAGCGTCCGCTTCCCGGA
CCCGTCCGCCCTGGGGACCTTCCTCGACAACCACGACAACGCCCGCTGGCTGAGCCGCAACCCGGACCGGGCTCT
GTTCCGGAACGCGCTGACGTACGTCCTGCTCGCCCGCGGCATCCCCGTCCTCTACTACGGCTCCGAGCAGGGCTT
CGCCGGCGGCGACGACCCGGCCAACCGCGAGGACCTCTGGCGCACCGGCTTCGACGCCGACGCCGACCTGTACCG
CTTCATCGCCCGCCTCGGCGCCGTCCGCAAGGCCGCCGCCGGCCTGCCCGGCAACGACCACATCCACCTCATGGT
CGAGGACACGGCCTACGCCTGGAGCCGCGCCAACGGAGACGTCATCGCCCTGACGAGCAACATCGGGAGCGCCAA
CTCGAGACGCTACTGCTTCTACACCCAGCGCCCGGCCGGCAGGTGGAGGGATGCGCTCAAGGGCGACGAGTACGC
TGCCGACGTGCACGGCCACTTGTGCGCCGACGTTTCCCATGGCGAGCCTGTTGTCCTGGTATCTTACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail