Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6893
Gene name
LocationContig_373:19098..21247
Strand-
Gene length (bp)2149
Transcript length (bp)2007
Coding sequence length (bp)2007
Protein length (aa) 669

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00412 LIM LIM domain 1.1E-10 473 530
PF00412 LIM LIM domain 2.2E-11 536 590

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36166|PXL1_YEAST Paxillin-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PXL1 PE=1 SV=3 468 579 1.0E-23
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 473 585 2.0E-13
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 473 585 2.0E-13
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 473 585 4.0E-13
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 473 584 4.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36166|PXL1_YEAST Paxillin-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PXL1 PE=1 SV=3 468 579 1.0E-23
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 473 585 2.0E-13
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 473 585 2.0E-13
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 473 585 4.0E-13
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 473 584 4.0E-13
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 473 585 4.0E-13
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 473 584 3.0E-12
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 473 584 4.0E-12
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 473 585 5.0E-12
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 473 584 5.0E-12
sp|P20271|HM14_CAEEL Homeobox protein ceh-14 OS=Caenorhabditis elegans GN=ceh-14 PE=1 SV=3 461 668 6.0E-12
sp|Q15942|ZYX_HUMAN Zyxin OS=Homo sapiens GN=ZYX PE=1 SV=1 473 592 6.0E-12
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 473 584 6.0E-12
sp|Q62523|ZYX_MOUSE Zyxin OS=Mus musculus GN=Zyx PE=1 SV=2 473 583 1.0E-11
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 473 584 2.0E-11
sp|Q91XC0|AJUBA_MOUSE LIM domain-containing protein ajuba OS=Mus musculus GN=Ajuba PE=1 SV=1 471 604 2.0E-11
sp|Q5U2Z2|AJUBA_RAT LIM domain-containing protein ajuba OS=Rattus norvegicus GN=Ajuba PE=1 SV=1 471 604 2.0E-11
sp|Q96HC4|PDLI5_HUMAN PDZ and LIM domain protein 5 OS=Homo sapiens GN=PDLIM5 PE=1 SV=5 472 575 2.0E-11
sp|Q96IF1|AJUBA_HUMAN LIM domain-containing protein ajuba OS=Homo sapiens GN=AJUBA PE=1 SV=1 471 604 3.0E-11
sp|Q04584|ZYX_CHICK Zyxin OS=Gallus gallus GN=ZYX PE=1 SV=1 473 583 3.0E-11
sp|E1BKA3|AJUBA_BOVIN LIM domain-containing protein ajuba OS=Bos taurus GN=AJUBA PE=3 SV=1 471 604 4.0E-11
sp|Q9VY77|AJUBA_DROME LIM domain-containing protein jub OS=Drosophila melanogaster GN=jub PE=1 SV=3 471 593 6.0E-11
sp|Q62920|PDLI5_RAT PDZ and LIM domain protein 5 OS=Rattus norvegicus GN=Pdlim5 PE=1 SV=2 472 575 6.0E-11
sp|Q8CI51|PDLI5_MOUSE PDZ and LIM domain protein 5 OS=Mus musculus GN=Pdlim5 PE=1 SV=4 472 575 6.0E-11
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 397 584 7.0E-11
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 466 593 9.0E-11
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 469 588 1.0E-10
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 466 593 1.0E-10
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 466 593 1.0E-10
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 466 593 1.0E-10
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 466 593 2.0E-10
sp|Q62920|PDLI5_RAT PDZ and LIM domain protein 5 OS=Rattus norvegicus GN=Pdlim5 PE=1 SV=2 473 588 2.0E-10
sp|Q8CI51|PDLI5_MOUSE PDZ and LIM domain protein 5 OS=Mus musculus GN=Pdlim5 PE=1 SV=4 473 588 2.0E-10
sp|Q96HC4|PDLI5_HUMAN PDZ and LIM domain protein 5 OS=Homo sapiens GN=PDLIM5 PE=1 SV=5 473 588 3.0E-10
sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens GN=LIMS2 PE=1 SV=1 485 585 3.0E-10
sp|O75112|LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2 473 570 3.0E-10
sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-containing domain protein 2 OS=Bos taurus GN=LIMS2 PE=2 SV=2 485 585 3.0E-10
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 473 584 4.0E-10
sp|O75112|LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2 473 586 5.0E-10
sp|Q9JKS4|LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus GN=Ldb3 PE=1 SV=1 473 570 5.0E-10
sp|Q15942|ZYX_HUMAN Zyxin OS=Homo sapiens GN=ZYX PE=1 SV=1 473 615 8.0E-10
sp|Q91XD2|LIMS2_MOUSE LIM and senescent cell antigen-like-containing domain protein 2 OS=Mus musculus GN=Lims2 PE=1 SV=1 485 585 9.0E-10
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 470 601 1.0E-09
sp|Q71FD7|FBLI1_MOUSE Filamin-binding LIM protein 1 OS=Mus musculus GN=Fblim1 PE=1 SV=2 473 604 1.0E-09
sp|P53405|ISL1_DANRE Insulin gene enhancer protein isl-1 OS=Danio rerio GN=isl1 PE=2 SV=1 495 586 1.0E-09
sp|P61374|ISL1_RAT Insulin gene enhancer protein ISL-1 OS=Rattus norvegicus GN=Isl1 PE=2 SV=1 495 586 1.0E-09
sp|P61372|ISL1_MOUSE Insulin gene enhancer protein ISL-1 OS=Mus musculus GN=Isl1 PE=1 SV=1 495 586 1.0E-09
sp|P61373|ISL1_MESAU Insulin gene enhancer protein ISL-1 OS=Mesocricetus auratus GN=ISL1 PE=2 SV=1 495 586 1.0E-09
sp|P61371|ISL1_HUMAN Insulin gene enhancer protein ISL-1 OS=Homo sapiens GN=ISL1 PE=1 SV=1 495 586 1.0E-09
sp|Q04584|ZYX_CHICK Zyxin OS=Gallus gallus GN=ZYX PE=1 SV=1 464 615 2.0E-09
sp|G5E5X0|LIMD1_BOVIN LIM domain-containing protein 1 OS=Bos taurus GN=LIMD1 PE=3 SV=1 471 593 2.0E-09
sp|Q06BR1|LIMD1_XENLA LIM domain-containing protein 1 OS=Xenopus laevis GN=limd1 PE=1 SV=1 463 606 2.0E-09
sp|Q04650|LMX1A_MESAU LIM homeobox transcription factor 1-alpha OS=Mesocricetus auratus GN=LMX1A PE=2 SV=1 473 586 2.0E-09
sp|Q9JKU8|LMX1A_MOUSE LIM homeobox transcription factor 1-alpha OS=Mus musculus GN=Lmx1a PE=2 SV=1 473 586 2.0E-09
sp|Q7TQJ8|WTIP_MOUSE Wilms tumor protein 1-interacting protein OS=Mus musculus GN=Wtip PE=1 SV=1 471 606 2.0E-09
sp|Q9U3F4|ZYX_CAEEL Zyxin OS=Caenorhabditis elegans GN=zyx-1 PE=1 SV=1 492 615 3.0E-09
sp|B5DEH0|LIMD1_RAT LIM domain-containing protein 1 OS=Rattus norvegicus GN=Limd1 PE=1 SV=1 496 593 4.0E-09
sp|Q6P7E4|PDLI7_DANRE PDZ and LIM domain protein 7 OS=Danio rerio GN=pdlim7 PE=2 SV=1 472 575 4.0E-09
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 473 578 4.0E-09
sp|Q9JKS4|LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus GN=Ldb3 PE=1 SV=1 473 586 5.0E-09
sp|Q9QXD8|LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus GN=Limd1 PE=1 SV=2 471 593 5.0E-09
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 473 584 6.0E-09
sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-containing domain protein 2 OS=Bos taurus GN=LIMS2 PE=2 SV=2 473 578 8.0E-09
sp|Q9UGP4|LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens GN=LIMD1 PE=1 SV=1 471 593 9.0E-09
sp|P53413|LMX1B_CHICK LIM/homeobox protein LMX-1.2 OS=Gallus gallus GN=LMX1B PE=2 SV=2 454 586 9.0E-09
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 473 590 1.0E-08
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 473 590 1.0E-08
sp|Q91XD2|LIMS2_MOUSE LIM and senescent cell antigen-like-containing domain protein 2 OS=Mus musculus GN=Lims2 PE=1 SV=1 473 578 1.0E-08
sp|A8DZE6|WTIP_DANRE Wilms tumor protein 1-interacting protein homolog OS=Danio rerio GN=wtip PE=3 SV=1 471 606 1.0E-08
sp|A9LS46|WTIP_XENLA Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis GN=wtip PE=2 SV=1 471 606 1.0E-08
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 473 585 1.0E-08
sp|Q6INU3|PDLI7_XENLA PDZ and LIM domain protein 7 OS=Xenopus laevis GN=pdlim7 PE=2 SV=1 472 575 1.0E-08
sp|Q5F464|LPP_CHICK Lipoma-preferred partner homolog OS=Gallus gallus GN=LPP PE=2 SV=1 496 615 1.0E-08
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 473 590 2.0E-08
sp|Q62523|ZYX_MOUSE Zyxin OS=Mus musculus GN=Zyx PE=1 SV=2 473 615 2.0E-08
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 473 590 2.0E-08
sp|P63007|LHX1_RAT LIM/homeobox protein Lhx1 OS=Rattus norvegicus GN=Lhx1 PE=1 SV=1 473 586 2.0E-08
sp|P63006|LHX1_MOUSE LIM/homeobox protein Lhx1 OS=Mus musculus GN=Lhx1 PE=1 SV=1 473 586 2.0E-08
sp|P63008|LHX1_MESAU LIM/homeobox protein Lhx1 OS=Mesocricetus auratus GN=Lhx1 PE=2 SV=1 473 586 2.0E-08
sp|P48742|LHX1_HUMAN LIM/homeobox protein Lhx1 OS=Homo sapiens GN=LHX1 PE=2 SV=2 473 586 2.0E-08
sp|Q5IS89|LHX1_SAIBB LIM/homeobox protein Lhx1 OS=Saimiri boliviensis boliviensis GN=LHX1 PE=2 SV=1 473 586 2.0E-08
sp|Q5IS44|LHX1_PANTR LIM/homeobox protein Lhx1 OS=Pan troglodytes GN=LHX1 PE=2 SV=1 473 586 2.0E-08
sp|Q3TJD7|PDLI7_MOUSE PDZ and LIM domain protein 7 OS=Mus musculus GN=Pdlim7 PE=1 SV=1 472 575 2.0E-08
sp|Q9NR12|PDLI7_HUMAN PDZ and LIM domain protein 7 OS=Homo sapiens GN=PDLIM7 PE=1 SV=1 473 575 2.0E-08
sp|A6NIX2|WTIP_HUMAN Wilms tumor protein 1-interacting protein OS=Homo sapiens GN=WTIP PE=1 SV=3 471 606 2.0E-08
sp|P53411|LHX1_CHICK LIM/homeobox protein Lhx1 OS=Gallus gallus GN=LHX1 PE=2 SV=1 473 586 2.0E-08
sp|Q69ZX8|ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus GN=Ablim3 PE=1 SV=2 473 573 2.0E-08
sp|Q9H2C1|LHX5_HUMAN LIM/homeobox protein Lhx5 OS=Homo sapiens GN=LHX5 PE=2 SV=1 473 588 2.0E-08
sp|Q8QFP8|LIMK1_CHICK LIM domain kinase 1 OS=Gallus gallus GN=LIMK1 PE=1 SV=1 535 590 2.0E-08
sp|Q0VA45|ZYX_XENTR Zyxin OS=Xenopus tropicalis GN=zyx PE=2 SV=1 473 584 2.0E-08
sp|A1ZA47|ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster GN=Zasp52 PE=1 SV=2 453 590 2.0E-08
sp|O94929|ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens GN=ABLIM3 PE=1 SV=3 473 573 2.0E-08
sp|A5H447|ZYX_XENLA Zyxin OS=Xenopus laevis GN=zyx PE=1 SV=1 480 584 2.0E-08
sp|Q679P3|PDLI7_CHICK PDZ and LIM domain protein 7 OS=Gallus gallus GN=PDLIM7 PE=1 SV=1 432 575 2.0E-08
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 473 590 3.0E-08
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 473 590 3.0E-08
sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens GN=LIMS2 PE=1 SV=1 473 578 3.0E-08
sp|Q9Z1Y4|TRIP6_MOUSE Thyroid receptor-interacting protein 6 OS=Mus musculus GN=Trip6 PE=1 SV=1 442 592 3.0E-08
sp|Q9Z1Y4|TRIP6_MOUSE Thyroid receptor-interacting protein 6 OS=Mus musculus GN=Trip6 PE=1 SV=1 496 593 3.0E-08
sp|Q3SX26|TRIP6_BOVIN Thyroid receptor-interacting protein 6 OS=Bos taurus GN=TRIP6 PE=2 SV=1 496 593 3.0E-08
sp|Q15654|TRIP6_HUMAN Thyroid receptor-interacting protein 6 OS=Homo sapiens GN=TRIP6 PE=1 SV=3 496 593 3.0E-08
sp|Q93052|LPP_HUMAN Lipoma-preferred partner OS=Homo sapiens GN=LPP PE=1 SV=1 496 615 3.0E-08
sp|O88609|LMX1B_MOUSE LIM homeobox transcription factor 1-beta OS=Mus musculus GN=Lmx1b PE=2 SV=3 473 586 3.0E-08
sp|P48059|LIMS1_HUMAN LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens GN=LIMS1 PE=1 SV=4 473 578 3.0E-08
sp|P61376|LHX5_RAT LIM/homeobox protein Lhx5 OS=Rattus norvegicus GN=Lhx5 PE=2 SV=1 473 588 3.0E-08
sp|P61375|LHX5_MOUSE LIM/homeobox protein Lhx5 OS=Mus musculus GN=Lhx5 PE=2 SV=1 473 588 3.0E-08
sp|Q60564|LMX1B_MESAU LIM homeobox transcription factor 1-beta (Fragment) OS=Mesocricetus auratus GN=LMX1B PE=2 SV=1 454 586 3.0E-08
sp|O60663|LMX1B_HUMAN LIM homeobox transcription factor 1-beta OS=Homo sapiens GN=LMX1B PE=1 SV=3 473 586 3.0E-08
sp|Q9VY77|AJUBA_DROME LIM domain-containing protein jub OS=Drosophila melanogaster GN=jub PE=1 SV=3 477 583 4.0E-08
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 442 621 4.0E-08
sp|Q90476|LHX1_DANRE LIM/homeobox protein Lhx1 OS=Danio rerio GN=lhx1a PE=2 SV=1 473 592 4.0E-08
sp|Q99JW4|LIMS1_MOUSE LIM and senescent cell antigen-like-containing domain protein 1 OS=Mus musculus GN=Lims1 PE=1 SV=3 473 578 4.0E-08
sp|Q9Z1Z9|PDLI7_RAT PDZ and LIM domain protein 7 OS=Rattus norvegicus GN=Pdlim7 PE=1 SV=1 473 575 4.0E-08
sp|P29674|LHX1_XENLA LIM/homeobox protein Lhx1 OS=Xenopus laevis GN=lhx1 PE=1 SV=1 473 586 4.0E-08
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 390 589 5.0E-08
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga1 PE=1 SV=1 463 584 5.0E-08
sp|Q5F464|LPP_CHICK Lipoma-preferred partner homolog OS=Gallus gallus GN=LPP PE=2 SV=1 472 592 6.0E-08
sp|A1ZA47|ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster GN=Zasp52 PE=1 SV=2 473 587 6.0E-08
sp|Q5REN1|FBLI1_PONAB Filamin-binding LIM protein 1 OS=Pongo abelii GN=FBLIM1 PE=2 SV=1 492 604 6.0E-08
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 439 573 6.0E-08
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 442 592 6.0E-08
sp|Q3SX26|TRIP6_BOVIN Thyroid receptor-interacting protein 6 OS=Bos taurus GN=TRIP6 PE=2 SV=1 442 592 7.0E-08
sp|Q15654|TRIP6_HUMAN Thyroid receptor-interacting protein 6 OS=Homo sapiens GN=TRIP6 PE=1 SV=3 442 592 7.0E-08
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 461 573 8.0E-08
sp|Q8WUP2|FBLI1_HUMAN Filamin-binding LIM protein 1 OS=Homo sapiens GN=FBLIM1 PE=1 SV=2 495 604 8.0E-08
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 496 583 9.0E-08
sp|P48059|LIMS1_HUMAN LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens GN=LIMS1 PE=1 SV=4 482 585 9.0E-08
sp|Q99JW4|LIMS1_MOUSE LIM and senescent cell antigen-like-containing domain protein 1 OS=Mus musculus GN=Lims1 PE=1 SV=3 482 585 9.0E-08
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 473 583 9.0E-08
sp|Q0VA45|ZYX_XENTR Zyxin OS=Xenopus tropicalis GN=zyx PE=2 SV=1 496 615 1.0E-07
sp|Q93052|LPP_HUMAN Lipoma-preferred partner OS=Homo sapiens GN=LPP PE=1 SV=1 472 584 1.0E-07
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 473 586 1.0E-07
sp|Q1JQB5|FBLI1_BOVIN Filamin-binding LIM protein 1 OS=Bos taurus GN=FBLIM1 PE=2 SV=1 492 604 1.0E-07
sp|P53667|LIMK1_HUMAN LIM domain kinase 1 OS=Homo sapiens GN=LIMK1 PE=1 SV=3 535 590 1.0E-07
sp|Q3SX40|PDLI7_BOVIN PDZ and LIM domain protein 7 OS=Bos taurus GN=PDLIM7 PE=2 SV=1 473 575 1.0E-07
sp|P37137|LHX5_XENLA LIM/homeobox protein Lhx5 OS=Xenopus laevis GN=lhx5 PE=1 SV=2 473 586 1.0E-07
sp|Q5XI07|LPP_RAT Lipoma-preferred partner homolog OS=Rattus norvegicus GN=Lpp PE=1 SV=1 496 615 1.0E-07
sp|A5H447|ZYX_XENLA Zyxin OS=Xenopus laevis GN=zyx PE=1 SV=1 496 615 2.0E-07
sp|Q3SX40|PDLI7_BOVIN PDZ and LIM domain protein 7 OS=Bos taurus GN=PDLIM7 PE=2 SV=1 473 586 2.0E-07
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 473 584 2.0E-07
sp|B7ZUL2|LIMD1_XENTR LIM domain-containing protein 1 OS=Xenopus tropicalis GN=limd1 PE=2 SV=1 471 606 2.0E-07
sp|Q8BFW7|LPP_MOUSE Lipoma-preferred partner homolog OS=Mus musculus GN=Lpp PE=1 SV=1 496 615 2.0E-07
sp|P53410|ISL2_CHICK Insulin gene enhancer protein ISL-2 (Fragment) OS=Gallus gallus GN=ISL2 PE=2 SV=1 495 573 2.0E-07
sp|P53668|LIMK1_MOUSE LIM domain kinase 1 OS=Mus musculus GN=Limk1 PE=1 SV=1 535 590 2.0E-07
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 473 586 2.0E-07
sp|O70209|PDLI3_MOUSE PDZ and LIM domain protein 3 OS=Mus musculus GN=Pdlim3 PE=1 SV=1 535 594 2.0E-07
sp|A6NIX2|WTIP_HUMAN Wilms tumor protein 1-interacting protein OS=Homo sapiens GN=WTIP PE=1 SV=3 477 595 3.0E-07
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 473 568 3.0E-07
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 473 568 3.0E-07
sp|Q54L00|LIMKA_DICDI Probable LIM domain-containing serine/threonine-protein kinase DDB_G0287001 OS=Dictyostelium discoideum GN=DDB_G0287001 PE=3 SV=1 493 626 3.0E-07
sp|P53776|LHX4_MOUSE LIM/homeobox protein Lhx4 OS=Mus musculus GN=Lhx4 PE=1 SV=4 473 586 3.0E-07
sp|Q969G2|LHX4_HUMAN LIM/homeobox protein Lhx4 OS=Homo sapiens GN=LHX4 PE=1 SV=2 473 586 3.0E-07
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 473 586 4.0E-07
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 473 586 4.0E-07
sp|Q53GG5|PDLI3_HUMAN PDZ and LIM domain protein 3 OS=Homo sapiens GN=PDLIM3 PE=1 SV=1 535 594 4.0E-07
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 473 586 5.0E-07
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 470 586 5.0E-07
sp|Q66HS7|PDLI3_RAT PDZ and LIM domain protein 3 OS=Rattus norvegicus GN=Pdlim3 PE=1 SV=2 535 594 5.0E-07
sp|P53669|LIMK1_RAT LIM domain kinase 1 OS=Rattus norvegicus GN=Limk1 PE=1 SV=1 535 590 6.0E-07
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 473 584 7.0E-07
sp|Q2QLE3|TES_PIG Testin OS=Sus scrofa GN=TES PE=3 SV=1 447 585 7.0E-07
sp|G5E5X0|LIMD1_BOVIN LIM domain-containing protein 1 OS=Bos taurus GN=LIMD1 PE=3 SV=1 477 596 8.0E-07
sp|O42565|LIMK1_XENLA LIM domain kinase 1 OS=Xenopus laevis GN=limk1 PE=2 SV=1 535 590 8.0E-07
sp|Q07DW1|TES_AOTNA Testin OS=Aotus nancymaae GN=TES PE=3 SV=1 374 585 8.0E-07
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 473 584 9.0E-07
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 473 584 9.0E-07
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 473 584 1.0E-06
sp|B5DEH0|LIMD1_RAT LIM domain-containing protein 1 OS=Rattus norvegicus GN=Limd1 PE=1 SV=1 477 596 1.0E-06
sp|Q9UGP4|LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens GN=LIMD1 PE=1 SV=1 477 596 1.0E-06
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 470 586 1.0E-06
sp|Q6INU3|PDLI7_XENLA PDZ and LIM domain protein 7 OS=Xenopus laevis GN=pdlim7 PE=2 SV=1 452 586 1.0E-06
sp|Q3TJD7|PDLI7_MOUSE PDZ and LIM domain protein 7 OS=Mus musculus GN=Pdlim7 PE=1 SV=1 473 586 1.0E-06
sp|Q8QFP8|LIMK1_CHICK LIM domain kinase 1 OS=Gallus gallus GN=LIMK1 PE=1 SV=1 492 645 1.0E-06
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 473 566 1.0E-06
sp|Q6QGC0|PDLI3_PIG PDZ and LIM domain protein 3 OS=Sus scrofa GN=PDLIM3 PE=2 SV=1 535 594 1.0E-06
sp|Q9UPM6|LHX6_HUMAN LIM/homeobox protein Lhx6 OS=Homo sapiens GN=LHX6 PE=1 SV=2 463 573 1.0E-06
sp|P34764|MEC3_CAEBR Mechanosensory protein 3 OS=Caenorhabditis briggsae GN=mec-3 PE=3 SV=2 469 573 1.0E-06
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 470 593 2.0E-06
sp|Q9QXD8|LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus GN=Limd1 PE=1 SV=2 477 596 2.0E-06
sp|A8DZE6|WTIP_DANRE Wilms tumor protein 1-interacting protein homolog OS=Danio rerio GN=wtip PE=3 SV=1 473 598 2.0E-06
sp|Q9Z1Z9|PDLI7_RAT PDZ and LIM domain protein 7 OS=Rattus norvegicus GN=Pdlim7 PE=1 SV=1 473 586 2.0E-06
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 492 573 2.0E-06
sp|Q2IBC3|TES_RHIFE Testin OS=Rhinolophus ferrumequinum GN=TES PE=3 SV=1 447 585 2.0E-06
sp|P34765|MEC3_CAERE Mechanosensory protein 3 OS=Caenorhabditis remanei GN=mec-3 PE=3 SV=1 469 573 2.0E-06
sp|P50481|LHX3_MOUSE LIM/homeobox protein Lhx3 OS=Mus musculus GN=Lhx3 PE=1 SV=1 473 586 2.0E-06
sp|Q09YI0|TES_SAIBB Testin OS=Saimiri boliviensis boliviensis GN=TES PE=3 SV=1 374 585 2.0E-06
sp|Q3SYZ8|PDLI3_BOVIN PDZ and LIM domain protein 3 OS=Bos taurus GN=PDLIM3 PE=2 SV=1 535 594 2.0E-06
sp|A9LS46|WTIP_XENLA Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis GN=wtip PE=2 SV=1 480 598 3.0E-06
sp|Q69ZX8|ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus GN=Ablim3 PE=1 SV=2 473 586 3.0E-06
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 473 566 3.0E-06
sp|P09088|MEC3_CAEEL Mechanosensory protein 3 OS=Caenorhabditis elegans GN=mec-3 PE=2 SV=2 469 573 3.0E-06
sp|Q07DY3|TES_NOMLE Testin OS=Nomascus leucogenys GN=TES PE=3 SV=1 374 585 3.0E-06
sp|Q9NR12|PDLI7_HUMAN PDZ and LIM domain protein 7 OS=Homo sapiens GN=PDLIM7 PE=1 SV=1 473 586 4.0E-06
sp|P36202|PDLI4_RAT PDZ and LIM domain protein 4 OS=Rattus norvegicus GN=Pdlim4 PE=1 SV=2 536 594 4.0E-06
sp|P50479|PDLI4_HUMAN PDZ and LIM domain protein 4 OS=Homo sapiens GN=PDLIM4 PE=1 SV=2 536 594 4.0E-06
sp|P70271|PDLI4_MOUSE PDZ and LIM domain protein 4 OS=Mus musculus GN=Pdlim4 PE=1 SV=3 536 594 4.0E-06
sp|P50212|ISL2B_ONCTS Insulin gene enhancer protein ISL-2B (Fragment) OS=Oncorhynchus tshawytscha GN=isl2b PE=2 SV=1 495 586 4.0E-06
sp|Q55BI0|Y6787_DICDI LIM domain-containing protein DDB_G0271356 OS=Dictyostelium discoideum GN=DDB_G0271356 PE=3 SV=1 473 583 4.0E-06
sp|O94929|ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens GN=ABLIM3 PE=1 SV=3 473 586 5.0E-06
sp|Q3T005|PDLI4_BOVIN PDZ and LIM domain protein 4 OS=Bos taurus GN=PDLIM4 PE=2 SV=1 536 594 5.0E-06
sp|Q19157|PIN2_CAEEL LIM domain-containing protein pin-2 OS=Caenorhabditis elegans GN=pin-2 PE=2 SV=2 496 571 5.0E-06
sp|Q9U1I1|ESN_DROME Protein espinas OS=Drosophila melanogaster GN=esn PE=2 SV=1 473 583 7.0E-06
sp|Q2QLC3|TES_CALMO Testin OS=Callicebus moloch GN=TES PE=3 SV=1 374 585 8.0E-06
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 473 584 9.0E-06
sp|Q7TQJ8|WTIP_MOUSE Wilms tumor protein 1-interacting protein OS=Mus musculus GN=Wtip PE=1 SV=1 477 571 9.0E-06
sp|Q2QLG8|TES_CALJA Testin OS=Callithrix jacchus GN=TES PE=3 SV=1 374 585 9.0E-06
sp|Q09YL5|TES_ATEGE Testin OS=Ateles geoffroyi GN=TES PE=3 SV=1 374 585 9.0E-06
sp|A0M8S5|TES_FELCA Testin OS=Felis catus GN=TES PE=3 SV=1 447 585 9.0E-06
sp|Q5RC52|TES_PONAB Testin OS=Pongo abelii GN=TES PE=2 SV=1 374 585 9.0E-06
sp|Q2QLF4|TES_PANTR Testin OS=Pan troglodytes GN=TES PE=3 SV=1 374 585 9.0E-06
sp|Q9UGI8|TES_HUMAN Testin OS=Homo sapiens GN=TES PE=1 SV=1 374 585 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6893
MALPRESTFLPTIKCSLCGNQVEISMMGDHLCGGPTVELSPPPEPKDRFDDYGWPSHGRTPPPVDTDAANRPFIN
KGQLTPVSQPSASRTGSPAASAGRYSPGSPHSPARAQRPGGYGGFGGRSKREPDEPDPVKSGGGVLDRMNALVRG
PFDAPARPSTSRSSGRSAFPNRKDSLEMWDGPATGRSNGSGGGGGWTITIAPPKAPRKNGYGGFGPPGSASSDHP
EPGTPGFISRSETYPKPSAPVESHRRMPSAPGSGGRPDPSPTNSQYGDGRLRASGPDRTRRPPPRTSLLGQRAGR
DSGSVDVAAEFGVGNPYHASIDSASSGYSGFSDVSRSTAATTTSPARSQTYRDREDADDAWMSSTGKARPRDLRV
DTAARAPPRRDASPTTDGLSPRAYAASPQDMRFDPAVQTGRADAGRQKSYDVPRMLPAPFSSSRRSDRGDDGGSR
TASPAAAGRRGGAPNAAPSRGDCKACRLPIRGKSISSADGRLTGKYHKACFVCATCAEPFTSAEFYVLGDRPYCE
QHYHRLNGSLCGTCGRGIEGQYLEDEARTKYHVGCFRCLDCGRSLSDGYFEVDGGAYCEPDAWRRTQPPPSQPQQ
PPQPGRRPSAAVGGLPGRPVPRSGSGSAAAASGLPPRGGGASPGSRLGPGIGLPRPQMNKRMTRLGRM*
Coding >Hirsu2|6893
ATGGCTCTGCCAAGGGAGTCGACCTTCCTGCCCACCATCAAGTGTTCGTTATGCGGCAACCAGGTCGAGATCTCC
ATGATGGGAGACCATCTCTGCGGCGGTCCGACAGTCGAGCTGTCGCCTCCGCCCGAGCCCAAAGACCGATTTGAC
GACTATGGTTGGCCTTCGCACGGCCGCACACCGCCACCTGTCGACACGGACGCTGCCAATCGGCCCTTCATCAAC
AAGGGGCAGTTAACACCCGTCAGCCAGCCCAGCGCGTCCCGCACCGGTTCGCCCGCGGCTTCCGCCGGCCGCTAC
AGCCCCGGTTCGCCGCACTCCCCGGCCCGCGCCCAACGTCCCGGAGGATACGGCGGTTTCGGCGGCCGCTCCAAG
CGAGAGCCCGATGAGCCCGACCCGGTCAAGTCCGGCGGCGGCGTACTCGACCGTATGAATGCCCTTGTCCGGGGC
CCGTTCGACGCCCCGGCCCGACCATCGACGAGCCGGAGCTCCGGCCGCAGCGCCTTTCCCAATCGCAAGGATTCC
CTCGAGATGTGGGACGGGCCGGCGACAGGTCGCTCCAACGGGTCCGGAGGCGGCGGCGGCTGGACCATCACCATC
GCGCCGCCCAAGGCGCCGCGCAAGAACGGCTACGGAGGCTTCGGCCCGCCAGGCTCGGCCTCTTCCGACCACCCG
GAGCCGGGCACACCGGGCTTCATCAGCCGGTCGGAGACGTACCCGAAGCCGTCGGCCCCCGTCGAGTCCCACCGC
AGGATGCCCTCGGCCCCCGGCAGCGGCGGCCGCCCCGACCCATCCCCAACCAACAGCCAGTACGGCGACGGCCGG
CTGAGGGCCTCTGGCCCGGACCGCACGAGGAGACCACCGCCACGGACCAGCCTGCTGGGCCAGCGCGCCGGGCGC
GACTCGGGCTCCGTCGACGTGGCCGCCGAGTTTGGCGTCGGCAACCCCTACCACGCCTCGATCGACTCGGCTTCT
TCGGGCTACTCGGGCTTCAGCGACGTCAGCCGGTCGACGGCCGCAACGACGACGAGCCCGGCCCGGTCGCAGACG
TACCGTGACAGGGAGGACGCCGACGACGCCTGGATGTCGTCGACGGGCAAGGCGCGCCCGCGGGATCTGCGCGTC
GACACGGCCGCCCGCGCACCGCCGCGCCGGGACGCGTCGCCGACGACAGACGGCCTGTCGCCTCGCGCGTACGCG
GCCTCGCCACAGGACATGCGCTTCGACCCGGCCGTGCAGACCGGGCGGGCGGACGCGGGCCGCCAGAAGTCGTAC
GACGTGCCCCGGATGCTGCCCGCCCCGTTCTCGTCCTCGCGACGCTCGGACCGAGGCGACGATGGCGGGTCCAGG
ACGGCGTCCCCGGCCGCGGCCGGGAGACGCGGGGGTGCCCCGAACGCGGCGCCGTCTCGGGGCGACTGCAAGGCG
TGTCGGCTCCCGATCCGGGGCAAGAGCATCTCGTCGGCGGACGGGCGGCTAACGGGCAAGTACCACAAGGCGTGC
TTCGTGTGCGCCACGTGCGCCGAGCCCTTCACCTCGGCCGAGTTCTACGTCCTGGGCGACCGGCCGTACTGCGAG
CAGCACTACCACCGGCTCAACGGCAGCCTCTGCGGCACCTGCGGCCGCGGCATCGAGGGTCAGTACCTGGAGGAC
GAGGCGCGCACCAAGTACCACGTCGGCTGCTTCCGCTGCCTCGACTGCGGCCGCTCGCTGTCGGACGGCTACTTC
GAGGTCGACGGCGGCGCCTACTGCGAGCCCGACGCCTGGCGGAGGACCCAGCCGCCTCCGTCGCAGCCTCAGCAG
CCTCCGCAACCGGGCCGTCGGCCGTCGGCTGCGGTGGGCGGCCTGCCGGGACGTCCAGTGCCCCGGTCGGGATCG
GGATCGGCGGCGGCGGCGTCGGGTCTACCCCCCCGCGGCGGCGGCGCCTCTCCGGGGAGCCGGCTCGGGCCCGGT
ATCGGCCTTCCGCGGCCGCAGATGAACAAGCGCATGACACGCCTGGGCCGGATGTGA
Transcript >Hirsu2|6893
ATGGCTCTGCCAAGGGAGTCGACCTTCCTGCCCACCATCAAGTGTTCGTTATGCGGCAACCAGGTCGAGATCTCC
ATGATGGGAGACCATCTCTGCGGCGGTCCGACAGTCGAGCTGTCGCCTCCGCCCGAGCCCAAAGACCGATTTGAC
GACTATGGTTGGCCTTCGCACGGCCGCACACCGCCACCTGTCGACACGGACGCTGCCAATCGGCCCTTCATCAAC
AAGGGGCAGTTAACACCCGTCAGCCAGCCCAGCGCGTCCCGCACCGGTTCGCCCGCGGCTTCCGCCGGCCGCTAC
AGCCCCGGTTCGCCGCACTCCCCGGCCCGCGCCCAACGTCCCGGAGGATACGGCGGTTTCGGCGGCCGCTCCAAG
CGAGAGCCCGATGAGCCCGACCCGGTCAAGTCCGGCGGCGGCGTACTCGACCGTATGAATGCCCTTGTCCGGGGC
CCGTTCGACGCCCCGGCCCGACCATCGACGAGCCGGAGCTCCGGCCGCAGCGCCTTTCCCAATCGCAAGGATTCC
CTCGAGATGTGGGACGGGCCGGCGACAGGTCGCTCCAACGGGTCCGGAGGCGGCGGCGGCTGGACCATCACCATC
GCGCCGCCCAAGGCGCCGCGCAAGAACGGCTACGGAGGCTTCGGCCCGCCAGGCTCGGCCTCTTCCGACCACCCG
GAGCCGGGCACACCGGGCTTCATCAGCCGGTCGGAGACGTACCCGAAGCCGTCGGCCCCCGTCGAGTCCCACCGC
AGGATGCCCTCGGCCCCCGGCAGCGGCGGCCGCCCCGACCCATCCCCAACCAACAGCCAGTACGGCGACGGCCGG
CTGAGGGCCTCTGGCCCGGACCGCACGAGGAGACCACCGCCACGGACCAGCCTGCTGGGCCAGCGCGCCGGGCGC
GACTCGGGCTCCGTCGACGTGGCCGCCGAGTTTGGCGTCGGCAACCCCTACCACGCCTCGATCGACTCGGCTTCT
TCGGGCTACTCGGGCTTCAGCGACGTCAGCCGGTCGACGGCCGCAACGACGACGAGCCCGGCCCGGTCGCAGACG
TACCGTGACAGGGAGGACGCCGACGACGCCTGGATGTCGTCGACGGGCAAGGCGCGCCCGCGGGATCTGCGCGTC
GACACGGCCGCCCGCGCACCGCCGCGCCGGGACGCGTCGCCGACGACAGACGGCCTGTCGCCTCGCGCGTACGCG
GCCTCGCCACAGGACATGCGCTTCGACCCGGCCGTGCAGACCGGGCGGGCGGACGCGGGCCGCCAGAAGTCGTAC
GACGTGCCCCGGATGCTGCCCGCCCCGTTCTCGTCCTCGCGACGCTCGGACCGAGGCGACGATGGCGGGTCCAGG
ACGGCGTCCCCGGCCGCGGCCGGGAGACGCGGGGGTGCCCCGAACGCGGCGCCGTCTCGGGGCGACTGCAAGGCG
TGTCGGCTCCCGATCCGGGGCAAGAGCATCTCGTCGGCGGACGGGCGGCTAACGGGCAAGTACCACAAGGCGTGC
TTCGTGTGCGCCACGTGCGCCGAGCCCTTCACCTCGGCCGAGTTCTACGTCCTGGGCGACCGGCCGTACTGCGAG
CAGCACTACCACCGGCTCAACGGCAGCCTCTGCGGCACCTGCGGCCGCGGCATCGAGGGTCAGTACCTGGAGGAC
GAGGCGCGCACCAAGTACCACGTCGGCTGCTTCCGCTGCCTCGACTGCGGCCGCTCGCTGTCGGACGGCTACTTC
GAGGTCGACGGCGGCGCCTACTGCGAGCCCGACGCCTGGCGGAGGACCCAGCCGCCTCCGTCGCAGCCTCAGCAG
CCTCCGCAACCGGGCCGTCGGCCGTCGGCTGCGGTGGGCGGCCTGCCGGGACGTCCAGTGCCCCGGTCGGGATCG
GGATCGGCGGCGGCGGCGTCGGGTCTACCCCCCCGCGGCGGCGGCGCCTCTCCGGGGAGCCGGCTCGGGCCCGGT
ATCGGCCTTCCGCGGCCGCAGATGAACAAGCGCATGACACGCCTGGGCCGGATGTGA
Gene >Hirsu2|6893
ATGGCTCTGCCAAGGGAGTCGACCTTCCTGCCCACCATCAAGTGTTCGTTATGCGGCAACCAGGTCGAGATCTCC
ATGATGGGAGACCATCTCTGCGGCGGTCCGACAGTCGAGCGTAAGTCGCCTCGTCGTCCGGCCCGGGACCTTCTT
ATCCGCCGCTGACCCCCGCCGGCTCAGTGTCGCCTCCGCCCGAGCCCAAAGACCGATTTGACGACTATGGTTGGC
CTTCGCACGGCCGCACACCGCCACCTGTCGACACGGACGCTGCCAGTGAGTTGCTTGCCGACCCGAGCCCGTCAC
CGTCGCCCGTCCGCCCTGGTGTGTCGCCGGCACTGACCAATGCCCACCAGATCGGCCCTTCATCAACAAGGGGCA
GTTAACACCCGTCAGCCAGCCCAGCGCGTCCCGCACCGGTTCGCCCGCGGCTTCCGCCGGCCGCTACAGCCCCGG
TTCGCCGCACTCCCCGGCCCGCGCCCAACGTCCCGGAGGATACGGCGGTTTCGGCGGCCGCTCCAAGCGAGAGCC
CGATGAGCCCGACCCGGTCAAGTCCGGCGGCGGCGTACTCGACCGTATGAATGCCCTTGTCCGGGGCCCGTTCGA
CGCCCCGGCCCGACCATCGACGAGCCGGAGCTCCGGCCGCAGCGCCTTTCCCAATCGCAAGGATTCCCTCGAGAT
GTGGGACGGGCCGGCGACAGGTCGCTCCAACGGGTCCGGAGGCGGCGGCGGCTGGACCATCACCATCGCGCCGCC
CAAGGCGCCGCGCAAGAACGGCTACGGAGGCTTCGGCCCGCCAGGCTCGGCCTCTTCCGACCACCCGGAGCCGGG
CACACCGGGCTTCATCAGCCGGTCGGAGACGTACCCGAAGCCGTCGGCCCCCGTCGAGTCCCACCGCAGGATGCC
CTCGGCCCCCGGCAGCGGCGGCCGCCCCGACCCATCCCCAACCAACAGCCAGTACGGCGACGGCCGGCTGAGGGC
CTCTGGCCCGGACCGCACGAGGAGACCACCGCCACGGACCAGCCTGCTGGGCCAGCGCGCCGGGCGCGACTCGGG
CTCCGTCGACGTGGCCGCCGAGTTTGGCGTCGGCAACCCCTACCACGCCTCGATCGACTCGGCTTCTTCGGGCTA
CTCGGGCTTCAGCGACGTCAGCCGGTCGACGGCCGCAACGACGACGAGCCCGGCCCGGTCGCAGACGTACCGTGA
CAGGGAGGACGCCGACGACGCCTGGATGTCGTCGACGGGCAAGGCGCGCCCGCGGGATCTGCGCGTCGACACGGC
CGCCCGCGCACCGCCGCGCCGGGACGCGTCGCCGACGACAGACGGCCTGTCGCCTCGCGCGTACGCGGCCTCGCC
ACAGGACATGCGCTTCGACCCGGCCGTGCAGACCGGGCGGGCGGACGCGGGCCGCCAGAAGTCGTACGACGTGCC
CCGGATGCTGCCCGCCCCGTTCTCGTCCTCGCGACGCTCGGACCGAGGCGACGATGGCGGGTCCAGGACGGCGTC
CCCGGCCGCGGCCGGGAGACGCGGGGGTGCCCCGAACGCGGCGCCGTCTCGGGGCGACTGCAAGGCGTGTCGGCT
CCCGATCCGGGGCAAGAGCATCTCGTCGGCGGACGGGCGGCTAACGGGCAAGTACCACAAGGCGTGCTTCGTGTG
CGCCACGTGCGCCGAGCCCTTCACCTCGGCCGAGTTCTACGTCCTGGGCGACCGGCCGTACTGCGAGCAGCACTA
CCACCGGCTCAACGGCAGCCTCTGCGGCACCTGCGGCCGCGGCATCGAGGGTCAGTACCTGGAGGACGAGGCGCG
CACCAAGTACCACGTCGGCTGCTTCCGCTGCCTCGACTGCGGCCGCTCGCTGTCGGACGGCTACTTCGAGGTCGA
CGGCGGCGCCTACTGCGAGCCCGACGCCTGGCGGAGGACCCAGCCGCCTCCGTCGCAGCCTCAGCAGCCTCCGCA
ACCGGGCCGTCGGCCGTCGGCTGCGGTGGGCGGCCTGCCGGGACGTCCAGTGCCCCGGTCGGGATCGGGATCGGC
GGCGGCGGCGTCGGGTCTACCCCCCCGCGGCGGCGGCGCCTCTCCGGGGAGCCGGCTCGGGCCCGGTATCGGCCT
TCCGCGGCCGCAGATGAACAAGCGCATGACACGCCTGGGCCGGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail