Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6881
Gene name
LocationContig_372:3888..5324
Strand-
Gene length (bp)1436
Transcript length (bp)1107
Coding sequence length (bp)1107
Protein length (aa) 369

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.4E-24 75 322
PF00083 Sugar_tr Sugar (and other) transporter 1.5E-13 100 243

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 18 352 6.0E-31
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 6 266 5.0E-28
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 47 240 5.0E-14
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 38 283 1.0E-12
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 25 254 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 18 352 6.0E-31
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 6 266 5.0E-28
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 47 240 5.0E-14
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 38 283 1.0E-12
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 25 254 4.0E-10
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 47 240 1.0E-09
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 47 221 6.0E-09
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 27 240 1.0E-08
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 43 260 2.0E-08
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 43 260 2.0E-08
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 11 326 2.0E-08
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 12 240 6.0E-07
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 27 240 3.0E-06
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 28 241 3.0E-06
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 41 232 8.0E-06
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 47 214 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 62 84 22
2 99 121 22
3 128 150 22
4 186 208 22
5 215 237 22
6 315 337 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6881
MDHQADQYPLQDGPAPPPGTVELISSDNSRQFEPEPTRLVLLPVPSDDPDDPLNWSTFRKCWNYALLTATTACIF
SVLSTQPVFWSQMLEELPVKQADLNASQALQLIGTAVGCIIFVPFTRKYGRRPIYILSVAIVAAATLWSAYMNTA
LEIILSNVLMGLAAATNETATQMSIRDMFFVHQRGSANGVYLAAISAGIFFAPILAGIQASATGWRSSYLTLGLF
MAGLLVLFICTFEETKFIVPVEESFHDFDDVSMHEHGLDSKEGIIEYERELSKREKVRQRPPFPRYLRLQLITKT
NESLWKTFYYPIYTIWYPQVIFCFLEFASGVCWFVVISSIGGIVFPEPPYNFTPAQSFRGAPRRLDNH*
Coding >Hirsu2|6881
ATGGACCACCAGGCGGACCAGTATCCCCTGCAGGATGGCCCGGCCCCGCCGCCGGGGACCGTCGAGTTGATTTCT
TCGGACAACAGCAGACAGTTCGAGCCGGAGCCCACGAGGCTGGTCCTGCTGCCTGTTCCGTCAGACGACCCGGAC
GATCCCTTGAATTGGTCTACCTTCCGCAAGTGCTGGAACTATGCGCTCCTCACGGCGACCACGGCCTGCATCTTC
AGCGTGCTGTCGACCCAGCCGGTCTTTTGGTCCCAGATGCTCGAGGAGCTGCCCGTGAAGCAGGCGGATCTGAAC
GCCTCCCAGGCCCTTCAGCTCATCGGGACGGCCGTGGGATGCATCATCTTCGTCCCCTTCACCAGGAAGTATGGC
CGCCGTCCCATCTACATTCTTTCGGTGGCCATCGTGGCGGCCGCCACGCTATGGTCTGCGTACATGAACACGGCG
CTGGAGATCATCCTCAGCAACGTCCTTATGGGCCTCGCCGCCGCCACCAACGAGACGGCCACTCAGATGAGCATC
CGCGACATGTTCTTCGTCCACCAGCGAGGCTCGGCTAATGGCGTCTACTTGGCTGCCATCTCGGCCGGTATCTTC
TTCGCCCCCATCTTGGCCGGCATACAGGCCTCCGCAACCGGCTGGCGCTCGTCCTATCTCACGCTGGGTCTTTTC
ATGGCCGGCCTCCTCGTCCTCTTCATCTGCACGTTTGAGGAGACCAAGTTTATCGTGCCCGTTGAGGAGAGCTTC
CACGACTTCGACGACGTGAGCATGCACGAGCATGGTCTGGACTCCAAGGAGGGCATAATCGAATACGAGCGCGAG
CTCTCCAAGCGAGAAAAAGTCCGCCAGCGGCCTCCATTCCCGCGCTATCTTCGGCTCCAGCTCATAACCAAGACC
AACGAGTCTCTCTGGAAGACCTTCTACTATCCCATCTATACTATTTGGTACCCCCAGGTAATCTTTTGCTTTCTC
GAGTTCGCCTCCGGCGTTTGCTGGTTCGTCGTCATCTCCTCGATTGGCGGCATCGTCTTCCCGGAGCCGCCGTAC
AACTTCACCCCTGCCCAGTCTTTTCGGGGGGCCCCTCGTCGACTGGATAATCATTAA
Transcript >Hirsu2|6881
ATGGACCACCAGGCGGACCAGTATCCCCTGCAGGATGGCCCGGCCCCGCCGCCGGGGACCGTCGAGTTGATTTCT
TCGGACAACAGCAGACAGTTCGAGCCGGAGCCCACGAGGCTGGTCCTGCTGCCTGTTCCGTCAGACGACCCGGAC
GATCCCTTGAATTGGTCTACCTTCCGCAAGTGCTGGAACTATGCGCTCCTCACGGCGACCACGGCCTGCATCTTC
AGCGTGCTGTCGACCCAGCCGGTCTTTTGGTCCCAGATGCTCGAGGAGCTGCCCGTGAAGCAGGCGGATCTGAAC
GCCTCCCAGGCCCTTCAGCTCATCGGGACGGCCGTGGGATGCATCATCTTCGTCCCCTTCACCAGGAAGTATGGC
CGCCGTCCCATCTACATTCTTTCGGTGGCCATCGTGGCGGCCGCCACGCTATGGTCTGCGTACATGAACACGGCG
CTGGAGATCATCCTCAGCAACGTCCTTATGGGCCTCGCCGCCGCCACCAACGAGACGGCCACTCAGATGAGCATC
CGCGACATGTTCTTCGTCCACCAGCGAGGCTCGGCTAATGGCGTCTACTTGGCTGCCATCTCGGCCGGTATCTTC
TTCGCCCCCATCTTGGCCGGCATACAGGCCTCCGCAACCGGCTGGCGCTCGTCCTATCTCACGCTGGGTCTTTTC
ATGGCCGGCCTCCTCGTCCTCTTCATCTGCACGTTTGAGGAGACCAAGTTTATCGTGCCCGTTGAGGAGAGCTTC
CACGACTTCGACGACGTGAGCATGCACGAGCATGGTCTGGACTCCAAGGAGGGCATAATCGAATACGAGCGCGAG
CTCTCCAAGCGAGAAAAAGTCCGCCAGCGGCCTCCATTCCCGCGCTATCTTCGGCTCCAGCTCATAACCAAGACC
AACGAGTCTCTCTGGAAGACCTTCTACTATCCCATCTATACTATTTGGTACCCCCAGGTAATCTTTTGCTTTCTC
GAGTTCGCCTCCGGCGTTTGCTGGTTCGTCGTCATCTCCTCGATTGGCGGCATCGTCTTCCCGGAGCCGCCGTAC
AACTTCACCCCTGCCCAGTCTTTTCGGGGGGCCCCTCGTCGACTGGATAATCATTAA
Gene >Hirsu2|6881
ATGGACCACCAGGCGGACCAGTATCCCCTGCAGGATGGCCCGGCCCCGCCGCCGGGGACCGTCGAGTTGATTTCT
TGTATGCCCCGACCTCGGCCCCCGACTTCGCCCGCGGCGATGGACGGGACAGAGCTTTGGTGCTGACCGCAACAT
CCGTCTTCTCCAGCGGACAACAGCAGACAGTTCGAGCCGGAGCCCACGAGGCTGGTCCTGCTGCCTGTTCCGTCA
GACGACCCGGACGATCCCTTGGTTGGTTCCCTGCCGGCTTCAAGCTCCCCCCGCCGCGACTGAGAACTGACTTCG
CGGCACAGAATTGGTCTACCTTCCGCAAGTGCTGGAACTATGCGCTCCTCACGGCGACCACGGCCTGCATCTTCA
GCGTGTAAGTGTCCCTTGCGAGCCCCGGCTGTCTTGCCGTGCCCGTGCTGTTGCTAAGGCGCGCCCTGTAGGCTG
TCGACCCAGCCGGTCTTTTGGTCCCAGATGCTCGAGGAGCTGCCCGTGAAGCAGGCGGATCTGAACGCCTCCCAG
GCCCTTCAGCTCATCGGGACGGCCGTGGGATGCATCATCTTCGTCCCCTTCACCAGGAAGTATGGCCGCCGTCCC
ATCTACATTCTTTCGGTGGCCATCGTGGCGGCCGCCACGCTATGGTCTGCGTACATGAACACGGCGCTGGAGATC
ATCCTCAGCAACGTCCTTATGGGCCTCGCCGCCGCCACCAACGAGACGGCCACTCAGATGAGCGTGAGCCTGCCA
ACCTTCCCCGGCAGCCGTTAGTATCGCGAATCGCTAACCCGTTCCCGTATTCAGATCCGCGACATGTTCTTCGTC
CACCAGCGAGGCTCGGCTAATGGCGTCTACTTGGCTGCCATCTCGGCCGGTATCTTCTTCGCCCCCATCTTGGCC
GGCATACAGGCCTCCGCAACCGGCTGGCGCTCGTCCTATCTCACGCTGGGTCTTTTCATGGCCGGCCTCCTCGTC
CTCTTCATCTGCACGTTTGAGGAGACCAAGTTTATCGTGCCCGTTGAGGAGAGCTTCCACGACTTCGACGACGTG
AGCATGCACGAGCATGGTCTGGACTCCAAGGAGGGCATAATCGAATACGAGCGCGAGCTCTCCAAGCGAGAAAAA
GTCCGCCAGCGGCCTCCATTCCCGCGCTATCTTCGGCTCCAGCTCATAACCAAGACCAACGAGTCTCTCTGGAAG
ACCTTCTACTATCCCATCTATACTATTTGGTACCCCCAGGTAATCTTTTGCTTTCTCGAGTTCGCCTCCGGCGTT
TGCTGGTTCGTCGTCATCTCCTCGATTGGCGGCATCGTCTTCCCGGAGCCGCCGTACAACTTCACCCCTGCCCAG
GTCGGCTTTATGTCTACCGGTCCTTTGATCGGCGCTATTCTCGGCAGTCTTTTCGGGGGGCCCCTCGTCGACTGG
ATAATCATTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail