Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6880
Gene name
LocationContig_372:3289..3815
Strand-
Gene length (bp)526
Transcript length (bp)396
Coding sequence length (bp)396
Protein length (aa) 132

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 3 111 3.0E-09
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 4 119 8.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 15 32 17
2 39 61 22
3 81 103 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6880
MSAGLVIFGVTADRGMHFIFPSIGSGLFAFGFNAISDINFTLVIDCFPNTVAQTFVVIDFFRNAISIGGPFSITP
WLEAMSVSAMFITAGLICMGIHLFAIPLTIWGKNSRARIAPHYYRLADRVATAAAS*
Coding >Hirsu2|6880
ATGTCAGCCGGTCTGGTTATCTTTGGTGTCACGGCTGATCGGGGCATGCATTTCATCTTCCCCAGCATCGGGAGC
GGCTTGTTTGCCTTTGGCTTCAACGCCATATCCGACATCAATTTCACTCTCGTTATTGACTGCTTTCCTAATACC
GTGGCCCAAACATTCGTGGTCATCGACTTCTTCCGCAACGCCATCAGCATCGGCGGGCCGTTTTCCATCACCCCG
TGGCTGGAGGCGATGAGCGTCAGTGCGATGTTTATCACCGCAGGGCTTATCTGCATGGGCATCCACCTCTTCGCC
ATCCCCCTCACGATCTGGGGCAAGAATTCGCGGGCCAGAATCGCGCCTCACTACTACCGCCTGGCGGACCGGGTC
GCCACCGCCGCTGCTTCTTGA
Transcript >Hirsu2|6880
ATGTCAGCCGGTCTGGTTATCTTTGGTGTCACGGCTGATCGGGGCATGCATTTCATCTTCCCCAGCATCGGGAGC
GGCTTGTTTGCCTTTGGCTTCAACGCCATATCCGACATCAATTTCACTCTCGTTATTGACTGCTTTCCTAATACC
GTGGCCCAAACATTCGTGGTCATCGACTTCTTCCGCAACGCCATCAGCATCGGCGGGCCGTTTTCCATCACCCCG
TGGCTGGAGGCGATGAGCGTCAGTGCGATGTTTATCACCGCAGGGCTTATCTGCATGGGCATCCACCTCTTCGCC
ATCCCCCTCACGATCTGGGGCAAGAATTCGCGGGCCAGAATCGCGCCTCACTACTACCGCCTGGCGGACCGGGTC
GCCACCGCCGCTGCTTCTTGA
Gene >Hirsu2|6880
ATGTCAGCCGGTCTGGTTATCTTTGGTGTCACGGCTGATCGGGTACGCCTGACTCCCTCCTCCCCCTCTGTGGAC
GGCTCGACGCCGAGGCTAACTGGCTGGAATTTCAACCGTAGGGCATGCATTTCATCTTCCCCAGCATCGGGAGCG
GCTTGTTTGCCTTTGGCTTCAACGCCATATCCGACATCAATTTCACTCTCGTTATTGACTGCTTTCCTAATGTAA
GAGACTGGAGTCGTGTGACCATGTATCGGGGCGGAAGGCTGACTCCATCCAGACCGTGGCCCAAACATTCGTGGT
CATCGACTTCTTCCGCAACGCCATCAGCATCGGCGGGCCGTTTTCCATCACCCCGTGGCTGGAGGCGATGAGCGT
CAGTGCGATGTTTATCACCGCAGGGCTTATCTGCATGGGCATCCACCTCTTCGCCATCCCCCTCACGATCTGGGG
CAAGAATTCGCGGGCCAGAATCGCGCCTCACTACTACCGCCTGGCGGACCGGGTCGCCACCGCCGCTGCTTCTTG
A

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail