Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6880
Gene name
LocationContig_372:3289..3815
Strand-
Gene length (bp)526
Transcript length (bp)396
Coding sequence length (bp)396
Protein length (aa) 132

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 3 111 3.0E-09
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 4 119 8.0E-09

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane 0.1932 0.0592 0.0642 0.6225 0.0661 0.0142 0.4814 0.5259 0.5938 0.0227

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 15 32 17
2 39 61 22
3 81 103 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup21
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|781
Ophiocordyceps australis 1348a (Ghana) OphauG2|3621
Ophiocordyceps australis map64 (Brazil) OphauB2|135
Ophiocordyceps australis map64 (Brazil) OphauB2|4856
Ophiocordyceps camponoti-floridani Ophcf2|05528
Ophiocordyceps camponoti-floridani Ophcf2|03539
Ophiocordyceps camponoti-floridani Ophcf2|02729
Ophiocordyceps camponoti-floridani Ophcf2|00664
Ophiocordyceps camponoti-rufipedis Ophun1|3781
Ophiocordyceps camponoti-rufipedis Ophun1|1856
Ophiocordyceps camponoti-rufipedis Ophun1|435
Ophiocordyceps camponoti-rufipedis Ophun1|607
Ophiocordyceps kimflemingae Ophio5|4168
Ophiocordyceps kimflemingae Ophio5|4169
Ophiocordyceps kimflemingae Ophio5|5392
Ophiocordyceps kimflemingae Ophio5|6880
Ophiocordyceps kimflemingae Ophio5|741
Ophiocordyceps subramaniannii Hirsu2|7470
Ophiocordyceps subramaniannii Hirsu2|7469
Ophiocordyceps subramaniannii Hirsu2|7335
Ophiocordyceps subramaniannii Hirsu2|6881
Ophiocordyceps subramaniannii Hirsu2|6880 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5938
Ophiocordyceps subramaniannii Hirsu2|1965
Ophiocordyceps subramaniannii Hirsu2|9409
Ophiocordyceps subramaniannii Hirsu2|10936

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6880
MSAGLVIFGVTADRGMHFIFPSIGSGLFAFGFNAISDINFTLVIDCFPNTVAQTFVVIDFFRNAISIGGPFSITP
WLEAMSVSAMFITAGLICMGIHLFAIPLTIWGKNSRARIAPHYYRLADRVATAAAS*
Coding >Hirsu2|6880
ATGTCAGCCGGTCTGGTTATCTTTGGTGTCACGGCTGATCGGGGCATGCATTTCATCTTCCCCAGCATCGGGAGC
GGCTTGTTTGCCTTTGGCTTCAACGCCATATCCGACATCAATTTCACTCTCGTTATTGACTGCTTTCCTAATACC
GTGGCCCAAACATTCGTGGTCATCGACTTCTTCCGCAACGCCATCAGCATCGGCGGGCCGTTTTCCATCACCCCG
TGGCTGGAGGCGATGAGCGTCAGTGCGATGTTTATCACCGCAGGGCTTATCTGCATGGGCATCCACCTCTTCGCC
ATCCCCCTCACGATCTGGGGCAAGAATTCGCGGGCCAGAATCGCGCCTCACTACTACCGCCTGGCGGACCGGGTC
GCCACCGCCGCTGCTTCTTGA
Transcript >Hirsu2|6880
ATGTCAGCCGGTCTGGTTATCTTTGGTGTCACGGCTGATCGGGGCATGCATTTCATCTTCCCCAGCATCGGGAGC
GGCTTGTTTGCCTTTGGCTTCAACGCCATATCCGACATCAATTTCACTCTCGTTATTGACTGCTTTCCTAATACC
GTGGCCCAAACATTCGTGGTCATCGACTTCTTCCGCAACGCCATCAGCATCGGCGGGCCGTTTTCCATCACCCCG
TGGCTGGAGGCGATGAGCGTCAGTGCGATGTTTATCACCGCAGGGCTTATCTGCATGGGCATCCACCTCTTCGCC
ATCCCCCTCACGATCTGGGGCAAGAATTCGCGGGCCAGAATCGCGCCTCACTACTACCGCCTGGCGGACCGGGTC
GCCACCGCCGCTGCTTCTTGA
Gene >Hirsu2|6880
ATGTCAGCCGGTCTGGTTATCTTTGGTGTCACGGCTGATCGGGTACGCCTGACTCCCTCCTCCCCCTCTGTGGAC
GGCTCGACGCCGAGGCTAACTGGCTGGAATTTCAACCGTAGGGCATGCATTTCATCTTCCCCAGCATCGGGAGCG
GCTTGTTTGCCTTTGGCTTCAACGCCATATCCGACATCAATTTCACTCTCGTTATTGACTGCTTTCCTAATGTAA
GAGACTGGAGTCGTGTGACCATGTATCGGGGCGGAAGGCTGACTCCATCCAGACCGTGGCCCAAACATTCGTGGT
CATCGACTTCTTCCGCAACGCCATCAGCATCGGCGGGCCGTTTTCCATCACCCCGTGGCTGGAGGCGATGAGCGT
CAGTGCGATGTTTATCACCGCAGGGCTTATCTGCATGGGCATCCACCTCTTCGCCATCCCCCTCACGATCTGGGG
CAAGAATTCGCGGGCCAGAATCGCGCCTCACTACTACCGCCTGGCGGACCGGGTCGCCACCGCCGCTGCTTCTTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail