Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6878
Gene name
LocationContig_371:15497..16518
Strand-
Gene length (bp)1021
Transcript length (bp)954
Coding sequence length (bp)954
Protein length (aa) 318

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00651 BTB BTB/POZ domain 6.4E-14 25 98

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VFP2|RDX_DROME Protein roadkill OS=Drosophila melanogaster GN=rdx PE=1 SV=2 16 125 6.0E-09
sp|Q99N64|GMCLL_MOUSE Putative germ cell-less protein-like 1-like OS=Mus musculus GN=GMCL1P1 PE=2 SV=2 20 128 6.0E-08
sp|Q08DS0|KLH21_BOVIN Kelch-like protein 21 OS=Bos taurus GN=KLHL21 PE=2 SV=1 11 95 2.0E-06
sp|Q3U410|KLH21_MOUSE Kelch-like protein 21 OS=Mus musculus GN=Klhl21 PE=2 SV=1 11 95 2.0E-06
sp|D4A2K4|KLH21_RAT Kelch-like protein 21 OS=Rattus norvegicus GN=Klhl21 PE=3 SV=1 11 95 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VFP2|RDX_DROME Protein roadkill OS=Drosophila melanogaster GN=rdx PE=1 SV=2 16 125 6.0E-09
sp|Q99N64|GMCLL_MOUSE Putative germ cell-less protein-like 1-like OS=Mus musculus GN=GMCL1P1 PE=2 SV=2 20 128 6.0E-08
sp|Q08DS0|KLH21_BOVIN Kelch-like protein 21 OS=Bos taurus GN=KLHL21 PE=2 SV=1 11 95 2.0E-06
sp|Q3U410|KLH21_MOUSE Kelch-like protein 21 OS=Mus musculus GN=Klhl21 PE=2 SV=1 11 95 2.0E-06
sp|D4A2K4|KLH21_RAT Kelch-like protein 21 OS=Rattus norvegicus GN=Klhl21 PE=3 SV=1 11 95 2.0E-06
sp|Q9UJP4|KLH21_HUMAN Kelch-like protein 21 OS=Homo sapiens GN=KLHL21 PE=1 SV=4 11 95 2.0E-06
sp|Q5BL35|SPOLA_DANRE Speckle-type POZ protein-like A OS=Danio rerio GN=spopla PE=2 SV=1 19 94 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6878
MASAPRPDLASDGQQQAALYQNIRQLFLADKYSDLTIHCGGRDFKAHRAILCPQSSFFAKACDSGFKESVTGVVN
LPEDDPDVLKCFLQFIYSGNYEDGEYPTLDQPAFSATMELEEIDQELQQAPGIETGGPARDFPLHQIPTQSVSEE
DGNSPFPSPIEPDLEYSSDGAEVDEEDILDAEIADLRAEKAENENHEHHTPNNLLLSLRVYIMADKFDVPALKLL
ARHRFYMTAREIYDDDDDFPAVVEELYETTAPTDQIMREIPCRLIANCIGRGGSIPLPFEAIMRKHADLAVGVLH
YSCIYWSGSQCPSCINW*
Coding >Hirsu2|6878
ATGGCTTCCGCGCCCAGACCAGATCTCGCCAGTGATGGCCAGCAACAGGCGGCGCTCTACCAGAACATTCGTCAA
CTGTTCCTCGCCGACAAGTACTCCGACTTGACGATACACTGTGGCGGCCGCGACTTCAAGGCTCATCGCGCCATT
CTATGCCCGCAGTCATCCTTCTTCGCGAAGGCTTGCGACAGCGGCTTCAAGGAATCGGTGACTGGCGTTGTTAAC
CTCCCAGAAGACGACCCCGATGTGCTGAAATGTTTCCTGCAATTCATCTACTCGGGAAACTATGAAGATGGCGAG
TATCCGACCTTGGACCAGCCTGCCTTTTCTGCTACGATGGAACTCGAAGAAATCGACCAAGAACTCCAGCAAGCG
CCAGGAATTGAAACCGGTGGCCCCGCGCGGGATTTTCCTCTCCATCAAATTCCAACTCAAAGCGTCAGCGAAGAA
GACGGCAATAGTCCGTTTCCAAGCCCCATCGAGCCCGACCTGGAGTACTCCTCTGACGGCGCCGAAGTCGACGAA
GAGGATATTCTGGACGCGGAGATCGCTGATCTGCGCGCGGAGAAGGCTGAGAATGAGAATCATGAGCACCACACC
CCAAACAATCTCCTCCTTTCGCTCCGCGTATACATCATGGCGGACAAATTCGACGTACCGGCGCTCAAGTTACTA
GCACGACACCGCTTCTACATGACGGCACGCGAGATCTATGACGATGACGATGACTTCCCCGCCGTCGTTGAGGAG
CTGTACGAGACGACAGCGCCCACGGACCAGATCATGCGCGAGATTCCCTGTCGGCTTATCGCGAACTGCATCGGC
CGCGGGGGATCTATTCCGTTGCCCTTTGAGGCCATCATGCGCAAGCATGCAGATCTGGCCGTCGGCGTCCTTCAT
TACAGCTGTATCTACTGGTCTGGTTCTCAATGCCCGTCCTGTATAAACTGGTGA
Transcript >Hirsu2|6878
ATGGCTTCCGCGCCCAGACCAGATCTCGCCAGTGATGGCCAGCAACAGGCGGCGCTCTACCAGAACATTCGTCAA
CTGTTCCTCGCCGACAAGTACTCCGACTTGACGATACACTGTGGCGGCCGCGACTTCAAGGCTCATCGCGCCATT
CTATGCCCGCAGTCATCCTTCTTCGCGAAGGCTTGCGACAGCGGCTTCAAGGAATCGGTGACTGGCGTTGTTAAC
CTCCCAGAAGACGACCCCGATGTGCTGAAATGTTTCCTGCAATTCATCTACTCGGGAAACTATGAAGATGGCGAG
TATCCGACCTTGGACCAGCCTGCCTTTTCTGCTACGATGGAACTCGAAGAAATCGACCAAGAACTCCAGCAAGCG
CCAGGAATTGAAACCGGTGGCCCCGCGCGGGATTTTCCTCTCCATCAAATTCCAACTCAAAGCGTCAGCGAAGAA
GACGGCAATAGTCCGTTTCCAAGCCCCATCGAGCCCGACCTGGAGTACTCCTCTGACGGCGCCGAAGTCGACGAA
GAGGATATTCTGGACGCGGAGATCGCTGATCTGCGCGCGGAGAAGGCTGAGAATGAGAATCATGAGCACCACACC
CCAAACAATCTCCTCCTTTCGCTCCGCGTATACATCATGGCGGACAAATTCGACGTACCGGCGCTCAAGTTACTA
GCACGACACCGCTTCTACATGACGGCACGCGAGATCTATGACGATGACGATGACTTCCCCGCCGTCGTTGAGGAG
CTGTACGAGACGACAGCGCCCACGGACCAGATCATGCGCGAGATTCCCTGTCGGCTTATCGCGAACTGCATCGGC
CGCGGGGGATCTATTCCGTTGCCCTTTGAGGCCATCATGCGCAAGCATGCAGATCTGGCCGTCGGCGTCCTTCAT
TACAGCTGTATCTACTGGTCTGGTTCTCAATGCCCGTCCTGTATAAACTGGTGA
Gene >Hirsu2|6878
ATGGCTTCCGCGCCCAGACCAGATCTCGCCAGTGATGGCCAGCAACAGGCGGCGCTCTACCAGAACATTCGTCAA
CTGTTCCTCGCCGACAAGTACTCCGACTTGACGATACACTGTGGCGGCCGCGACTTCAAGGCTCATCGCGCCATT
CTATGCCCGCAGTCATCCTTCTTCGCGAAGGCTTGCGACAGCGGCTTCAAGGTGTCTGGTGGCTTCAGCCACATG
ACATCCACAGAGCCATCAACTGACTTTATGTTCAATCCTCCAGGAATCGGTGACTGGCGTTGTTAACCTCCCAGA
AGACGACCCCGATGTGCTGAAATGTTTCCTGCAATTCATCTACTCGGGAAACTATGAAGATGGCGAGTATCCGAC
CTTGGACCAGCCTGCCTTTTCTGCTACGATGGAACTCGAAGAAATCGACCAAGAACTCCAGCAAGCGCCAGGAAT
TGAAACCGGTGGCCCCGCGCGGGATTTTCCTCTCCATCAAATTCCAACTCAAAGCGTCAGCGAAGAAGACGGCAA
TAGTCCGTTTCCAAGCCCCATCGAGCCCGACCTGGAGTACTCCTCTGACGGCGCCGAAGTCGACGAAGAGGATAT
TCTGGACGCGGAGATCGCTGATCTGCGCGCGGAGAAGGCTGAGAATGAGAATCATGAGCACCACACCCCAAACAA
TCTCCTCCTTTCGCTCCGCGTATACATCATGGCGGACAAATTCGACGTACCGGCGCTCAAGTTACTAGCACGACA
CCGCTTCTACATGACGGCACGCGAGATCTATGACGATGACGATGACTTCCCCGCCGTCGTTGAGGAGCTGTACGA
GACGACAGCGCCCACGGACCAGATCATGCGCGAGATTCCCTGTCGGCTTATCGCGAACTGCATCGGCCGCGGGGG
ATCTATTCCGTTGCCCTTTGAGGCCATCATGCGCAAGCATGCAGATCTGGCCGTCGGCGTCCTTCATTACAGCTG
TATCTACTGGTCTGGTTCTCAATGCCCGTCCTGTATAAACTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail