Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6876
Gene name
LocationContig_371:6537..8575
Strand+
Gene length (bp)2038
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 1.8E-25 23 241

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29138|CUDP_METAN Cuticle-degrading protease OS=Metarhizium anisopliae GN=PR1 PE=1 SV=1 6 253 8.0E-56
sp|Q68GV9|ALP_LECPS Alkaline serine protease ver112 OS=Lecanicillium psalliotae PE=1 SV=1 6 253 4.0E-46
sp|A1CIA7|ORYZ_ASPCL Alkaline protease 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=alp1 PE=3 SV=1 5 253 2.0E-44
sp|P20015|PRTT_ENGAL Proteinase T (Fragment) OS=Engyodontium album GN=PROT PE=1 SV=1 6 252 1.0E-43
sp|E4UTU7|SUB9_ARTGP Subtilisin-like protease 9 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB9 PE=3 SV=1 6 253 2.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29138|CUDP_METAN Cuticle-degrading protease OS=Metarhizium anisopliae GN=PR1 PE=1 SV=1 6 253 8.0E-56
sp|Q68GV9|ALP_LECPS Alkaline serine protease ver112 OS=Lecanicillium psalliotae PE=1 SV=1 6 253 4.0E-46
sp|A1CIA7|ORYZ_ASPCL Alkaline protease 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=alp1 PE=3 SV=1 5 253 2.0E-44
sp|P20015|PRTT_ENGAL Proteinase T (Fragment) OS=Engyodontium album GN=PROT PE=1 SV=1 6 252 1.0E-43
sp|E4UTU7|SUB9_ARTGP Subtilisin-like protease 9 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB9 PE=3 SV=1 6 253 2.0E-43
sp|Q00208|ORYZ_EMENI Alkaline protease 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alp1 PE=2 SV=1 6 255 2.0E-41
sp|P35211|ORYZ_ASPFL Alkaline protease 1 OS=Aspergillus flavus GN=alp1 PE=1 SV=1 6 252 2.0E-41
sp|A1CWF3|ORYZ_NEOFI Alkaline protease 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=alp1 PE=2 SV=1 5 252 7.0E-41
sp|D4B5N1|SUB9_ARTBC Subtilisin-like protease 9 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB9 PE=3 SV=1 6 253 8.0E-41
sp|P23653|PRTR_ENGAL Proteinase R OS=Engyodontium album GN=PROR PE=1 SV=1 6 251 9.0E-41
sp|L8G6I7|SUB1_PSED2 Subtilisin-like protease 1 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP1 PE=1 SV=1 6 252 8.0E-40
sp|D4D674|SUB9_TRIVH Subtilisin-like protease 9 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB9 PE=3 SV=1 6 253 2.0E-39
sp|P12547|ORYZ_ASPOR Alkaline protease 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=alp1 PE=1 SV=2 6 252 4.0E-39
sp|B8N106|ORYZ_ASPFN Alkaline protease 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=alp1 PE=1 SV=1 6 252 4.0E-39
sp|C5PCX1|SUB7B_COCP7 Subtilisin-like protease CPC735_015300 OS=Coccidioides posadasii (strain C735) GN=CPC735_015300 PE=3 SV=1 6 252 6.0E-39
sp|P28296|ORYZ_ASPFU Alkaline protease 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alp1 PE=1 SV=2 5 252 6.0E-39
sp|B0Y708|ORYZ_ASPFC Alkaline protease 1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alp1 PE=3 SV=1 5 252 6.0E-39
sp|C5FH27|SUB9_ARTOC Subtilisin-like protease 9 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB9 PE=3 SV=1 6 253 7.0E-38
sp|C5PCB1|SUB4A_COCP7 Subtilisin-like protease CPC735_066880 OS=Coccidioides posadasii (strain C735) GN=CPC735_066880 PE=3 SV=1 6 252 8.0E-38
sp|L8FSM5|SUB2_PSED2 Subtilisin-like protease 2 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP2 PE=3 SV=1 6 252 9.0E-38
sp|C5G1D1|SUB5_ARTOC Subtilisin-like protease 5 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB5 PE=3 SV=1 6 253 1.0E-37
sp|P06873|PRTK_ENGAL Proteinase K OS=Engyodontium album GN=PROK PE=1 SV=2 6 251 1.0E-37
sp|Q8J0D7|SUB3_ARTOT Subtilisin-like protease 3 OS=Arthroderma otae GN=SUB3 PE=1 SV=1 6 253 2.0E-37
sp|C5FMY5|SUB3_ARTOC Subtilisin-like protease 3 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB3 PE=3 SV=1 6 253 2.0E-37
sp|C5FQI3|SUB6_ARTOC Subtilisin-like protease 6 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB6 PE=3 SV=1 6 253 3.0E-37
sp|D4D1U5|SUB12_TRIVH Subtilisin-like protease 12 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB12 PE=3 SV=1 6 253 4.0E-37
sp|B6VA86|SUB3_TRIEQ Subtilisin-like protease 3 OS=Trichophyton equinum GN=SUB3 PE=3 SV=1 6 253 5.0E-37
sp|A1XIH1|SUB6_TRISD Subtilisin-like protease 6 OS=Trichophyton soudanense GN=SUB6 PE=1 SV=1 6 253 6.0E-37
sp|Q9UW97|SUB6_TRIRU Subtilisin-like protease 6 OS=Trichophyton rubrum GN=SUB6 PE=1 SV=1 6 253 6.0E-37
sp|Q64K31|SUB6_ARTBE Subtilisin-like protease 6 OS=Arthroderma benhamiae GN=SUB6 PE=3 SV=1 6 253 8.0E-37
sp|D4ALV9|SUB6_ARTBC Subtilisin-like protease 6 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB6 PE=2 SV=1 6 253 8.0E-37
sp|Q8J0D9|SUB1_ARTOT Subtilisin-like protease 1 OS=Arthroderma otae GN=SUB1 PE=3 SV=1 6 252 9.0E-37
sp|C5FPS1|SUB1_ARTOC Subtilisin-like protease 1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB1 PE=3 SV=1 6 252 9.0E-37
sp|B8XGQ6|SUB3_TRITO Subtilisin-like protease 3 OS=Trichophyton tonsurans GN=SUB3 PE=3 SV=1 6 253 1.0E-36
sp|D4D5H3|SUB6_TRIVH Subtilisin-like protease 6 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB6 PE=3 SV=1 6 253 1.0E-36
sp|E4UPZ4|SUB1_ARTGP Subtilisin-like protease 1 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB1 PE=3 SV=1 6 252 1.0E-36
sp|A1XIH4|SUB7_TRITO Subtilisin-like protease 7 OS=Trichophyton tonsurans GN=SUB7 PE=1 SV=1 6 253 2.0E-36
sp|D4DLA2|SUB3_TRIVH Subtilisin-like protease 3 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB3 PE=3 SV=1 6 253 3.0E-36
sp|Q5VJ75|SUB3_TRIVC Subtilisin-like protease 3 OS=Trichophyton verrucosum GN=SUB3 PE=3 SV=1 6 253 3.0E-36
sp|Q64K34|SUB3_ARTBE Subtilisin-like protease 3 OS=Arthroderma benhamiae GN=SUB3 PE=1 SV=1 6 253 3.0E-36
sp|D4AWY5|SUB3_ARTBC Subtilisin-like protease 3 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB3 PE=1 SV=1 6 253 3.0E-36
sp|E4V2V9|SUB7_ARTGP Subtilisin-like protease 7 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB7 PE=3 SV=1 6 253 4.0E-36
sp|Q69F58|SUB1_TRIRU Subtilisin-like protease 1 OS=Trichophyton rubrum GN=SUB1 PE=2 SV=1 6 252 4.0E-36
sp|L8GD75|SUB3_PSED2 Subtilisin-like protease 3 OS=Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) GN=SP3 PE=3 SV=1 5 251 4.0E-36
sp|C5P5Q3|SUB9_COCP7 Subtilisin-like protease CPC735_033790 OS=Coccidioides posadasii (strain C735) GN=CPC735_033790 PE=3 SV=1 6 251 6.0E-36
sp|A1XIH0|SUB6_TRIEQ Subtilisin-like protease 6 OS=Trichophyton equinum GN=SUB6 PE=1 SV=1 6 253 6.0E-36
sp|Q8J077|SUB6_TRISH Subtilisin-like protease 6 (Fragment) OS=Trichophyton schoenleinii GN=SUB6 PE=1 SV=1 6 236 8.0E-36
sp|A1XIH3|SUB7_TRIEQ Subtilisin-like protease 7 OS=Trichophyton equinum GN=SUB7 PE=1 SV=1 6 253 8.0E-36
sp|D4DIW9|SUB1_TRIVH Subtilisin-like protease 1 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB1 PE=3 SV=1 6 252 1.0E-35
sp|D4DIS6|SUB10_TRIVH Subtilisin-like protease 10 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB10 PE=3 SV=1 6 254 1.0E-35
sp|D4AKU9|SUB1_ARTBC Subtilisin-like protease 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB1 PE=2 SV=2 6 253 1.0E-35
sp|Q5VJ72|SUB6_TRIVC Subtilisin-like protease 6 OS=Trichophyton verrucosum GN=SUB6 PE=3 SV=1 6 253 1.0E-35
sp|Q69F56|SUB3_TRIRU Subtilisin-like protease 3 OS=Trichophyton rubrum GN=SUB3 PE=1 SV=1 6 253 2.0E-35
sp|C5P1W9|SU11A_COCP7 Subtilisin-like protease CPC735_035780 OS=Coccidioides posadasii (strain C735) GN=CPC735_035780 PE=3 SV=1 6 251 3.0E-35
sp|D4B194|SUB5_ARTBC Subtilisin-like protease 5 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB5 PE=3 SV=1 6 253 3.0E-35
sp|D4AQG0|SUB10_ARTBC Subtilisin-like protease 10 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB10 PE=3 SV=2 6 254 3.0E-35
sp|Q5VJ77|SUB1_TRIVC Subtilisin-like protease 1 (Fragment) OS=Trichophyton verrucosum GN=SUB1 PE=3 SV=1 6 252 4.0E-35
sp|Q64K30|SUB1_ARTBE Subtilisin-like protease 1 (Fragment) OS=Arthroderma benhamiae GN=SUB1 PE=3 SV=1 6 252 4.0E-35
sp|E4V4J8|SUB6_ARTGP Subtilisin-like protease 6 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB6 PE=3 SV=1 6 253 5.0E-35
sp|C5FX37|SUB10_ARTOC Subtilisin-like protease 10 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB10 PE=3 SV=1 6 253 5.0E-35
sp|E4UN97|SUB3_ARTGP Subtilisin-like protease 3 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB3 PE=3 SV=1 6 253 6.0E-35
sp|Q3ZEJ8|SUB6_TRITO Subtilisin-like protease 6 OS=Trichophyton tonsurans GN=SUB6 PE=3 SV=1 6 253 1.0E-34
sp|B8XGQ4|SUB1_TRITO Subtilisin-like protease 1 OS=Trichophyton tonsurans GN=SUB1 PE=3 SV=1 6 252 2.0E-34
sp|C5PFR5|SU11B_COCP7 Subtilisin-like protease CPC735_047380 OS=Coccidioides posadasii (strain C735) GN=CPC735_047380 PE=3 SV=1 6 253 3.0E-34
sp|D4AQA9|SUB12_ARTBC Subtilisin-like protease 12 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB12 PE=3 SV=1 6 253 3.0E-34
sp|E4V2L6|SUB5_ARTGP Subtilisin-like protease 5 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB5 PE=3 SV=1 6 253 4.0E-34
sp|B6VA84|SUB1_TRIEQ Subtilisin-like protease 1 OS=Trichophyton equinum GN=SUB1 PE=3 SV=1 6 252 4.0E-34
sp|E4UY04|SUB12_ARTGP Subtilisin-like protease 12 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB12 PE=3 SV=1 6 253 5.0E-34
sp|C5P6L5|SUB4C_COCP7 Subtilisin-like protease CPC735_024010 OS=Coccidioides posadasii (strain C735) GN=CPC735_024010 PE=3 SV=1 6 253 2.0E-33
sp|C5FJA5|SUB7_ARTOC Subtilisin-like protease 7 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB7 PE=3 SV=1 6 253 3.0E-33
sp|Q5VJ71|SUB7_TRIVC Subtilisin-like protease 7 OS=Trichophyton verrucosum GN=SUB7 PE=3 SV=1 6 253 5.0E-33
sp|D4CZQ4|SUB7_TRIVH Subtilisin-like protease 7 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB7 PE=3 SV=2 6 253 5.0E-33
sp|A1XIH6|SUB7_TRIVO Subtilisin-like protease 7 OS=Trichophyton violaceum GN=SUB7 PE=1 SV=1 6 253 6.0E-33
sp|Q8NID9|SUB7_TRIRU Subtilisin-like protease 7 OS=Trichophyton rubrum GN=SUB7 PE=2 SV=1 6 253 6.0E-33
sp|P40903|ISP6_SCHPO Sexual differentiation process putative subtilase-type proteinase isp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp6 PE=2 SV=1 5 255 7.0E-33
sp|Q64K36|SUB7_ARTBE Subtilisin-like protease 7 OS=Arthroderma benhamiae GN=SUB7 PE=1 SV=1 6 253 1.0E-32
sp|D4APA9|SUB7_ARTBC Subtilisin-like protease 7 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB7 PE=1 SV=2 6 253 1.0E-32
sp|B8XGQ7|SUB4_TRITO Subtilisin-like protease 4 OS=Trichophyton tonsurans GN=SUB4 PE=3 SV=1 6 253 2.0E-32
sp|A7UKV6|SUB4_TRIEQ Subtilisin-like protease 4 (Fragment) OS=Trichophyton equinum GN=SUB4 PE=3 SV=1 6 252 2.0E-32
sp|A1XIH5|SUB7_TRISD Subtilisin-like protease 7 OS=Trichophyton soudanense GN=SUB7 PE=1 SV=1 6 253 3.0E-32
sp|P29118|ALP_ACRCH Alkaline proteinase OS=Acremonium chrysogenum GN=ALP PE=3 SV=1 6 252 1.0E-31
sp|D4D6Q4|SUB4_TRIVH Subtilisin-like protease 4 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB4 PE=3 SV=1 6 253 1.0E-31
sp|Q5VJ74|SUB4_TRIVC Subtilisin-like protease 4 OS=Trichophyton verrucosum GN=SUB4 PE=3 SV=1 6 253 1.0E-31
sp|Q64K33|SUB4_ARTBE Subtilisin-like protease 4 OS=Arthroderma benhamiae GN=SUB4 PE=3 SV=1 6 253 1.0E-31
sp|D4AXW3|SUB4_ARTBC Subtilisin-like protease 4 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB4 PE=1 SV=2 6 253 1.0E-31
sp|Q69F35|SUB4_TRIRU Subtilisin-like protease 4 OS=Trichophyton rubrum GN=SUB4 PE=1 SV=1 6 253 1.0E-31
sp|Q69F34|SUB5_TRIRU Subtilisin-like protease 5 OS=Trichophyton rubrum GN=SUB5 PE=2 SV=1 6 253 5.0E-31
sp|D4D0F5|SUB5_TRIVH Subtilisin-like protease 5 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB5 PE=3 SV=1 6 253 6.0E-31
sp|Q5VJ73|SUB5_TRIVC Subtilisin-like protease 5 OS=Trichophyton verrucosum GN=SUB5 PE=3 SV=1 6 253 6.0E-31
sp|Q64K32|SUB5_ARTBE Subtilisin-like protease 5 OS=Arthroderma benhamiae GN=SUB5 PE=3 SV=1 6 253 7.0E-31
sp|B8XGQ8|SUB5_TRITO Subtilisin-like protease 5 OS=Trichophyton tonsurans GN=SUB5 PE=3 SV=1 6 253 1.0E-30
sp|B6VA87|SUB5_TRIEQ Subtilisin-like protease 5 OS=Trichophyton equinum GN=SUB5 PE=3 SV=1 6 253 1.0E-30
sp|E4UWA4|SUB4_ARTGP Subtilisin-like protease 4 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB4 PE=3 SV=1 6 253 2.0E-30
sp|P80146|SEPR_THESR Extracellular serine proteinase OS=Thermus sp. (strain Rt41A) PE=1 SV=3 1 251 3.0E-30
sp|Q03420|ALP_HYPAT Alkaline proteinase OS=Hypocrea atroviridis GN=prb1 PE=1 SV=1 6 252 3.0E-30
sp|C5FXZ6|SUB4_ARTOC Subtilisin-like protease 4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB4 PE=3 SV=1 6 253 3.0E-30
sp|C5NZ69|SUB7C_COCP7 Subtilisin-like protease CPC735_013700 OS=Coccidioides posadasii (strain C735) GN=CPC735_013700 PE=3 SV=1 6 251 4.0E-30
sp|C5P9H3|SUB7D_COCP7 Subtilisin-like protease CPC735_005570 OS=Coccidioides posadasii (strain C735) GN=CPC735_005570 PE=3 SV=1 6 253 7.0E-30
sp|Q9UTS0|PSP3_SCHPO Subtilase-type proteinase psp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psp3 PE=2 SV=1 6 254 2.0E-29
sp|C5P4Z8|SUB8_COCP7 Subtilisin-like protease CPC735_031240 OS=Coccidioides posadasii (strain C735) GN=CPC735_031240 PE=3 SV=1 5 281 2.0E-29
sp|Q9Y778|SMP1_MAGPO Subtilisin-like proteinase Mp1 OS=Magnaporthiopsis poae PE=1 SV=1 5 252 4.0E-29
sp|P25036|YSP3_YEAST Subtilisin-like protease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP3 PE=2 SV=2 6 252 1.0E-28
sp|C5NZT2|SUB4B_COCP7 Subtilisin-like protease CPC735_012930 OS=Coccidioides posadasii (strain C735) GN=CPC735_012930 PE=3 SV=1 6 251 2.0E-28
sp|P09232|PRTB_YEAST Cerevisin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRB1 PE=1 SV=1 18 252 2.0E-28
sp|C5P906|SUB2B_COCP7 Subtilisin-like protease CPC735_003880 OS=Coccidioides posadasii (strain C735) GN=CPC735_003880 PE=3 SV=1 5 262 4.0E-28
sp|P08594|AQL1_THEAQ Aqualysin-1 OS=Thermus aquaticus GN=pstI PE=1 SV=2 6 211 5.0E-28
sp|D4DLI5|SUB2_TRIVH Subtilisin-like protease 2 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB2 PE=3 SV=2 5 256 5.0E-28
sp|Q5VJ76|SUB2_TRIVC Subtilisin-like protease 2 OS=Trichophyton verrucosum GN=SUB2 PE=3 SV=2 5 256 6.0E-28
sp|P33295|PEPC_ASPNG Subtilisin-like serine protease pepC OS=Aspergillus niger GN=pepC PE=3 SV=1 5 259 9.0E-28
sp|B6VA85|SUB2_TRIEQ Subtilisin-like protease 2 OS=Trichophyton equinum GN=SUB2 PE=3 SV=1 5 256 1.0E-27
sp|Q64K35|SUB2_ARTBE Subtilisin-like protease 2 OS=Arthroderma benhamiae GN=SUB2 PE=3 SV=2 5 256 2.0E-27
sp|D4AZ75|SUB2_ARTBC Subtilisin-like protease 2 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB2 PE=2 SV=2 5 256 2.0E-27
sp|B8XGQ5|SUB2_TRITO Subtilisin-like protease 2 OS=Trichophyton tonsurans GN=SUB2 PE=3 SV=2 5 256 2.0E-27
sp|P87184|ALP2_ASPFU Alkaline protease 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=alp2 PE=1 SV=1 5 252 4.0E-27
sp|B0Y473|ALP2_ASPFC Alkaline protease 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=alp2 PE=3 SV=1 5 252 4.0E-27
sp|C5P6D1|SUB2A_COCP7 Subtilisin-like protease CPC735_023170 OS=Coccidioides posadasii (strain C735) GN=CPC735_023170 PE=3 SV=1 5 253 4.0E-27
sp|C5PGK9|SUB7A_COCP7 Subtilisin-like protease CPC735_050320 OS=Coccidioides posadasii (strain C735) GN=CPC735_050320 PE=3 SV=1 6 252 1.0E-26
sp|P59996|PCSK9_RAT Proprotein convertase subtilisin/kexin type 9 OS=Rattus norvegicus GN=Pcsk9 PE=1 SV=1 28 237 2.0E-26
sp|Q80W65|PCSK9_MOUSE Proprotein convertase subtilisin/kexin type 9 OS=Mus musculus GN=Pcsk9 PE=1 SV=2 28 249 3.0E-26
sp|C5G168|SUB2_ARTOC Subtilisin-like protease 2 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB2 PE=3 SV=1 5 256 3.0E-26
sp|E4UZP9|SUB2_ARTGP Subtilisin-like protease 2 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB2 PE=3 SV=1 5 266 6.0E-26
sp|P58371|SPM1_MAGO7 Subtilisin-like proteinase Spm1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SPM1 PE=3 SV=1 5 252 7.0E-26
sp|D4AX50|SUB8_ARTBC Subtilisin-like protease 8 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB8 PE=3 SV=1 5 252 1.0E-25
sp|Q8J0D8|SUB2_ARTOT Subtilisin-like protease 2 OS=Arthroderma otae GN=SUB2 PE=3 SV=2 23 256 2.0E-25
sp|P16588|PROA_VIBAL Alkaline serine exoprotease A OS=Vibrio alginolyticus GN=proA PE=3 SV=1 5 211 3.0E-25
sp|Q69F57|SUB2_TRIRU Subtilisin-like protease 2 OS=Trichophyton rubrum GN=SUB2 PE=3 SV=2 5 256 3.0E-25
sp|D4DKQ4|SUB8_TRIVH Subtilisin-like protease 8 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB8 PE=3 SV=1 5 252 5.0E-25
sp|C5NZ70|SUB2C_COCP7 Subtilisin-like protease CPC735_013710 OS=Coccidioides posadasii (strain C735) GN=CPC735_013710 PE=3 SV=1 5 255 2.0E-24
sp|D4APE3|SUB11_ARTBC Subtilisin-like protease 11 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SUB11 PE=3 SV=1 6 253 8.0E-24
sp|P25381|RRT12_YEAST Subtilase-type proteinase RRT12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRT12 PE=1 SV=1 27 273 1.0E-23
sp|C5FII2|SUB8_ARTOC Subtilisin-like protease 8 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB8 PE=3 SV=1 5 262 1.0E-23
sp|E4V5C5|SUB11_ARTGP Subtilisin-like protease 11 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=SUB11 PE=3 SV=1 6 253 3.0E-23
sp|P09230|AEP_YARLI Alkaline extracellular protease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=XPR2 PE=1 SV=1 6 252 4.0E-23
sp|C5FZ39|SUB11_ARTOC Subtilisin-like protease 11 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SUB11 PE=3 SV=1 6 253 5.0E-23
sp|D4CZ60|SUB11_TRIVH Subtilisin-like protease 11 OS=Trichophyton verrucosum (strain HKI 0517) GN=SUB11 PE=3 SV=1 6 251 2.0E-22
sp|G1X8P8|SPAZ_ARTOA Cuticle-degrading serine protease OS=Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) PE=1 SV=1 2 252 8.0E-22
sp|A8T655|PCSK9_PANPA Proprotein convertase subtilisin/kexin type 9 OS=Pan paniscus GN=PCSK9 PE=2 SV=2 28 249 2.0E-20
sp|P16396|SUBE_BACSU Minor extracellular protease Epr OS=Bacillus subtilis (strain 168) GN=epr PE=2 SV=1 15 216 4.0E-20
sp|A8T658|PCSK9_PONPY Proprotein convertase subtilisin/kexin type 9 OS=Pongo pygmaeus GN=PCSK9 PE=2 SV=1 28 249 5.0E-20
sp|A8T644|PCSK9_PANTR Proprotein convertase subtilisin/kexin type 9 OS=Pan troglodytes GN=PCSK9 PE=2 SV=1 28 249 8.0E-20
sp|Q8NBP7|PCSK9_HUMAN Proprotein convertase subtilisin/kexin type 9 OS=Homo sapiens GN=PCSK9 PE=1 SV=3 28 249 8.0E-20
sp|A8T650|PCSK9_GORGO Proprotein convertase subtilisin/kexin type 9 OS=Gorilla gorilla gorilla GN=PCSK9 PE=2 SV=1 28 249 9.0E-20
sp|A8T682|PCSK9_SAGLB Proprotein convertase subtilisin/kexin type 9 OS=Saguinus labiatus GN=PCSK9 PE=2 SV=1 28 249 1.0E-19
sp|G3FNQ9|SPAZ_ARTOL Cuticle-degrading serine protease OS=Arthrobotrys oligospora PE=1 SV=2 2 228 1.0E-19
sp|A8T6A6|PCSK9_LAGLA Proprotein convertase subtilisin/kexin type 9 OS=Lagothrix lagotricha GN=PCSK9 PE=2 SV=1 28 249 3.0E-19
sp|A8T666|PCSK9_MACMU Proprotein convertase subtilisin/kexin type 9 OS=Macaca mulatta GN=PCSK9 PE=2 SV=1 28 249 4.0E-19
sp|A8T662|PCSK9_MACNE Proprotein convertase subtilisin/kexin type 9 OS=Macaca nemestrina GN=PCSK9 PE=2 SV=1 28 249 4.0E-19
sp|A8T672|PCSK9_COLGU Proprotein convertase subtilisin/kexin type 9 OS=Colobus guereza GN=PCSK9 PE=2 SV=1 28 249 4.0E-19
sp|A8T6A1|PCSK9_ATEGE Proprotein convertase subtilisin/kexin type 9 OS=Ateles geoffroyi GN=PCSK9 PE=2 SV=1 28 249 5.0E-19
sp|A8T695|PCSK9_SAIBB Proprotein convertase subtilisin/kexin type 9 OS=Saimiri boliviensis boliviensis GN=PCSK9 PE=2 SV=1 28 249 1.0E-18
sp|Q8SQJ3|SPL1_ENCCU Putative subtilisin-like proteinase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SPL1 PE=2 SV=1 6 212 1.0E-18
sp|A8T677|PCSK9_CALMO Proprotein convertase subtilisin/kexin type 9 OS=Callicebus moloch GN=PCSK9 PE=2 SV=1 28 249 2.0E-18
sp|P29599|SUBB_BACLE Subtilisin BL OS=Bacillus lentus PE=1 SV=1 16 216 3.0E-18
sp|A8T688|PCSK9_CALJA Proprotein convertase subtilisin/kexin type 9 OS=Callithrix jacchus GN=PCSK9 PE=2 SV=1 28 249 3.0E-18
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 24 233 3.0E-17
sp|Q99405|PRTM_BACSK M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 16 215 7.0E-17
sp|P41362|ELYA_BACCS Alkaline protease OS=Bacillus clausii PE=1 SV=1 16 215 2.0E-16
sp|P29600|SUBS_BACLE Subtilisin Savinase OS=Bacillus lentus PE=1 SV=1 16 216 2.0E-16
sp|P27693|ELYA_BACAO Alkaline protease OS=Bacillus alcalophilus PE=1 SV=1 16 215 2.0E-16
sp|P54423|WPRA_BACSU Cell wall-associated protease OS=Bacillus subtilis (strain 168) GN=wprA PE=1 SV=2 24 215 2.0E-16
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 16 233 9.0E-15
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 16 233 1.0E-14
sp|Q5JIZ5|TKSP_THEKO Subtilisin-like serine protease OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1689 PE=1 SV=1 15 212 2.0E-14
sp|P41363|ELYA_BACHD Thermostable alkaline protease OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH0855 PE=1 SV=2 16 233 2.0E-14
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 16 215 3.0E-14
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 16 233 3.0E-14
sp|P20724|ELYA_BACYA Alkaline elastase YaB OS=Bacillus sp. (strain YaB) GN=ale PE=1 SV=1 16 215 1.0E-13
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 16 233 3.0E-13
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 16 233 3.0E-13
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 24 212 5.0E-13
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 23 226 1.0E-11
sp|P42780|BPRX_DICNO Extracellular subtilisin-like protease OS=Dichelobacter nodosus PE=3 SV=1 21 256 4.0E-11
sp|P00780|SUBT_BACLI Subtilisin Carlsberg OS=Bacillus licheniformis GN=apr PE=1 SV=1 16 216 5.0E-11
sp|P29140|ISP_BACCS Intracellular alkaline protease OS=Bacillus clausii PE=3 SV=1 23 242 1.0E-10
sp|P04072|THET_THEVU Thermitase OS=Thermoactinomyces vulgaris PE=1 SV=1 27 215 2.0E-10
sp|P58502|TKSU_THEKO Tk-subtilisin OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1675 PE=1 SV=1 27 255 3.0E-10
sp|P23314|EXPR_XANCP Extracellular protease OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC0851 PE=3 SV=1 28 212 7.0E-09
sp|P00782|SUBT_BACAM Subtilisin BPN' OS=Bacillus amyloliquefaciens GN=apr PE=1 SV=1 28 216 4.0E-08
sp|P42779|BPRV_DICNO Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 28 212 4.0E-08
sp|O31788|APRX_BACSU Serine protease AprX OS=Bacillus subtilis (strain 168) GN=aprX PE=1 SV=1 21 212 6.0E-07
sp|P72186|PLS_PYRFU Pyrolysin OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pls PE=1 SV=2 24 231 7.0E-07
sp|P28842|SUBT_BACS9 Subtilisin OS=Bacillus sp. (strain TA39) GN=sub1 PE=1 SV=1 15 215 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular Signal peptide 0.5221 0.2929 0.842 0.1841 0.1702 0.0734 0.0524 0.0857 0.0414 0.0012

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7989
Ophiocordyceps australis 1348a (Ghana) OphauG2|3318
Ophiocordyceps australis 1348a (Ghana) OphauG2|2925
Ophiocordyceps australis 1348a (Ghana) OphauG2|1193
Ophiocordyceps australis map64 (Brazil) OphauB2|253
Ophiocordyceps australis map64 (Brazil) OphauB2|7713
Ophiocordyceps australis map64 (Brazil) OphauB2|1679
Ophiocordyceps australis map64 (Brazil) OphauB2|1712
Ophiocordyceps australis map64 (Brazil) OphauB2|7712
Ophiocordyceps australis map64 (Brazil) OphauB2|7690
Ophiocordyceps camponoti-floridani Ophcf2|01612
Ophiocordyceps camponoti-floridani Ophcf2|07156
Ophiocordyceps camponoti-floridani Ophcf2|01394
Ophiocordyceps camponoti-floridani Ophcf2|01472
Ophiocordyceps camponoti-floridani Ophcf2|03524
Ophiocordyceps camponoti-floridani Ophcf2|05924
Ophiocordyceps camponoti-rufipedis Ophun1|1061
Ophiocordyceps camponoti-rufipedis Ophun1|1907
Ophiocordyceps camponoti-rufipedis Ophun1|3328
Ophiocordyceps camponoti-rufipedis Ophun1|3338
Ophiocordyceps camponoti-rufipedis Ophun1|4619
Ophiocordyceps camponoti-rufipedis Ophun1|5894
Ophiocordyceps camponoti-rufipedis Ophun1|6107
Ophiocordyceps camponoti-rufipedis Ophun1|6223
Ophiocordyceps camponoti-rufipedis Ophun1|715
Ophiocordyceps camponoti-rufipedis Ophun1|6839
Ophiocordyceps kimflemingae Ophio5|1093
Ophiocordyceps kimflemingae Ophio5|2196
Ophiocordyceps kimflemingae Ophio5|2289
Ophiocordyceps kimflemingae Ophio5|3103
Ophiocordyceps kimflemingae Ophio5|315
Ophiocordyceps kimflemingae Ophio5|8474
Ophiocordyceps subramaniannii Hirsu2|7570
Ophiocordyceps subramaniannii Hirsu2|6907
Ophiocordyceps subramaniannii Hirsu2|6876 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6875
Ophiocordyceps subramaniannii Hirsu2|4430
Ophiocordyceps subramaniannii Hirsu2|4429
Ophiocordyceps subramaniannii Hirsu2|11133
Ophiocordyceps subramaniannii Hirsu2|11098
Ophiocordyceps subramaniannii Hirsu2|11097

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6876
MWSTVEFGGRAKYLVSFISGEKTDIYGHGTHIAGIIGGNTYGVAKKTDIYGVKVLDKKNEGMVDGFIKGLDYVAT
HQAKMRKQGKCKKGVVINMSISTPPSKILNDAVTKLINKNVFLAVSAGNAGILASKRSPAQGSIACVVGGTNEND
KLYSDPARGLSSNYGKRVDIFAPGQDILSAASNAATGGGDSPGYMSGTSQAVPHVVGIAALLAAKEGLSGTKALC
DRIKQLGTKDVIVNQKKNTVNLMAYNGAEDEPSNETIEQDFCDANTKEGCSPQIEKPFTVQDAVTTGEDPNACSH
FKRLHIQLVTAGHIVAGTWDYVNINFGKENTLLAKSPARKEVDEVDIDPRKGFGATDGKIRVSDIKKFTLSLSED
KKGHNPDWWRLKGITLVGTCAGSGRMAQITRFAELYKWMERSDQTDSFTGEIKIEEWQWQSEDKDTATLAVQPPG
RPDACSHFKLLEAELKLGNGYFEGTWDDIELCFDGRPKCHILAREPEHGTDRTTPVNLKEIFGSEVIPAPGFRAI
KVYSKTGANRSNADTDWWKYDGITLRGHCQGSPRVVEALKFANKDEWVIRKENDYRTQIASGELAANEWRWVKKD
*
Coding >Hirsu2|6876
ATGTGGTCGACAGTGGAGTTTGGCGGCCGGGCGAAATATCTTGTTTCCTTCATCTCGGGAGAGAAAACCGACATT
TACGGTCACGGCACACATATTGCAGGCATCATCGGCGGTAACACGTACGGCGTGGCAAAGAAGACAGACATTTAC
GGGGTCAAGGTGCTCGATAAAAAGAACGAAGGCATGGTAGATGGCTTCATAAAGGGGCTCGACTATGTTGCCACG
CACCAGGCTAAGATGCGAAAACAAGGAAAATGTAAGAAGGGTGTCGTCATCAACATGTCTATCAGCACGCCGCCG
TCCAAGATATTGAACGACGCGGTGACCAAGCTTATCAACAAGAATGTCTTCCTGGCCGTATCCGCCGGGAACGCA
GGCATCCTTGCCAGCAAGCGGTCACCGGCCCAGGGGTCTATCGCTTGCGTCGTGGGCGGCACCAACGAAAATGAC
AAGCTCTACTCGGATCCTGCCAGGGGCCTTTCCAGCAACTACGGCAAGCGCGTCGACATATTCGCCCCCGGACAG
GACATTCTCTCGGCCGCCAGCAACGCCGCCACCGGCGGTGGGGACTCGCCGGGCTACATGAGCGGCACTTCGCAG
GCCGTGCCGCACGTCGTCGGCATCGCGGCGTTGCTGGCGGCCAAGGAGGGCCTCAGCGGCACCAAGGCCCTGTGC
GACCGCATCAAGCAGCTCGGGACCAAGGACGTGATTGTTAACCAGAAAAAGAACACAGTTAATCTCATGGCCTAC
AACGGCGCCGAGGATGAGCCGTCCAATGAGACGATCGAGCAGGACTTTTGCGATGCAAACACCAAGGAGGGATGC
AGCCCGCAGATCGAGAAGCCCTTCACCGTCCAAGACGCCGTCACAACGGGCGAGGATCCGAATGCCTGTAGCCAC
TTCAAGCGCCTCCACATCCAGCTTGTTACGGCTGGCCACATTGTGGCTGGGACCTGGGACTATGTCAATATCAAC
TTCGGCAAGGAAAACACGTTACTCGCCAAGAGCCCAGCTAGAAAGGAGGTGGATGAGGTAGACATTGACCCCAGG
AAGGGCTTCGGGGCAACTGATGGGAAGATCCGGGTCTCGGATATTAAGAAGTTCACTCTTTCTCTCAGCGAAGAC
AAGAAAGGACATAACCCCGATTGGTGGAGGCTGAAGGGGATCACGTTGGTGGGAACCTGCGCCGGATCAGGTCGG
ATGGCGCAGATTACCAGGTTCGCGGAGCTCTACAAATGGATGGAGCGCTCGGATCAGACAGACTCGTTTACCGGC
GAGATCAAGATCGAGGAATGGCAATGGCAATCCGAGGACAAGGACACGGCGACGCTGGCGGTGCAGCCCCCCGGG
CGGCCCGACGCCTGCTCCCACTTCAAGCTTCTCGAGGCCGAATTGAAGCTGGGCAATGGCTACTTCGAGGGCACA
TGGGACGACATCGAGCTCTGCTTTGACGGCCGGCCCAAGTGTCACATTCTCGCCAGGGAACCCGAGCATGGCACC
GATAGGACAACCCCGGTCAACCTAAAGGAAATCTTCGGGTCCGAGGTCATTCCCGCGCCGGGCTTCCGTGCCATC
AAGGTTTACAGCAAGACGGGCGCAAATAGGAGCAATGCGGACACAGACTGGTGGAAGTATGACGGCATTACATTG
CGGGGACACTGCCAGGGCTCGCCCAGAGTGGTCGAGGCCCTCAAGTTCGCGAATAAGGATGAATGGGTCATTCGC
AAGGAGAATGACTATAGGACCCAGATTGCCTCTGGCGAGCTGGCTGCCAATGAGTGGCGCTGGGTGAAGAAAGAC
TAG
Transcript >Hirsu2|6876
ATGTGGTCGACAGTGGAGTTTGGCGGCCGGGCGAAATATCTTGTTTCCTTCATCTCGGGAGAGAAAACCGACATT
TACGGTCACGGCACACATATTGCAGGCATCATCGGCGGTAACACGTACGGCGTGGCAAAGAAGACAGACATTTAC
GGGGTCAAGGTGCTCGATAAAAAGAACGAAGGCATGGTAGATGGCTTCATAAAGGGGCTCGACTATGTTGCCACG
CACCAGGCTAAGATGCGAAAACAAGGAAAATGTAAGAAGGGTGTCGTCATCAACATGTCTATCAGCACGCCGCCG
TCCAAGATATTGAACGACGCGGTGACCAAGCTTATCAACAAGAATGTCTTCCTGGCCGTATCCGCCGGGAACGCA
GGCATCCTTGCCAGCAAGCGGTCACCGGCCCAGGGGTCTATCGCTTGCGTCGTGGGCGGCACCAACGAAAATGAC
AAGCTCTACTCGGATCCTGCCAGGGGCCTTTCCAGCAACTACGGCAAGCGCGTCGACATATTCGCCCCCGGACAG
GACATTCTCTCGGCCGCCAGCAACGCCGCCACCGGCGGTGGGGACTCGCCGGGCTACATGAGCGGCACTTCGCAG
GCCGTGCCGCACGTCGTCGGCATCGCGGCGTTGCTGGCGGCCAAGGAGGGCCTCAGCGGCACCAAGGCCCTGTGC
GACCGCATCAAGCAGCTCGGGACCAAGGACGTGATTGTTAACCAGAAAAAGAACACAGTTAATCTCATGGCCTAC
AACGGCGCCGAGGATGAGCCGTCCAATGAGACGATCGAGCAGGACTTTTGCGATGCAAACACCAAGGAGGGATGC
AGCCCGCAGATCGAGAAGCCCTTCACCGTCCAAGACGCCGTCACAACGGGCGAGGATCCGAATGCCTGTAGCCAC
TTCAAGCGCCTCCACATCCAGCTTGTTACGGCTGGCCACATTGTGGCTGGGACCTGGGACTATGTCAATATCAAC
TTCGGCAAGGAAAACACGTTACTCGCCAAGAGCCCAGCTAGAAAGGAGGTGGATGAGGTAGACATTGACCCCAGG
AAGGGCTTCGGGGCAACTGATGGGAAGATCCGGGTCTCGGATATTAAGAAGTTCACTCTTTCTCTCAGCGAAGAC
AAGAAAGGACATAACCCCGATTGGTGGAGGCTGAAGGGGATCACGTTGGTGGGAACCTGCGCCGGATCAGGTCGG
ATGGCGCAGATTACCAGGTTCGCGGAGCTCTACAAATGGATGGAGCGCTCGGATCAGACAGACTCGTTTACCGGC
GAGATCAAGATCGAGGAATGGCAATGGCAATCCGAGGACAAGGACACGGCGACGCTGGCGGTGCAGCCCCCCGGG
CGGCCCGACGCCTGCTCCCACTTCAAGCTTCTCGAGGCCGAATTGAAGCTGGGCAATGGCTACTTCGAGGGCACA
TGGGACGACATCGAGCTCTGCTTTGACGGCCGGCCCAAGTGTCACATTCTCGCCAGGGAACCCGAGCATGGCACC
GATAGGACAACCCCGGTCAACCTAAAGGAAATCTTCGGGTCCGAGGTCATTCCCGCGCCGGGCTTCCGTGCCATC
AAGGTTTACAGCAAGACGGGCGCAAATAGGAGCAATGCGGACACAGACTGGTGGAAGTATGACGGCATTACATTG
CGGGGACACTGCCAGGGCTCGCCCAGAGTGGTCGAGGCCCTCAAGTTCGCGAATAAGGATGAATGGGTCATTCGC
AAGGAGAATGACTATAGGACCCAGATTGCCTCTGGCGAGCTGGCTGCCAATGAGTGGCGCTGGGTGAAGAAAGAC
TAG
Gene >Hirsu2|6876
ATGTGGTCGACAGTGGTCTCGACGACACACACAAGGTAAAACGATCTATGTCACCGCCCTCTATCCGCGTGTACG
CCCATCAGGCACCACAAAGCACACGTGTTGTGACGTACCGAGCTGAGAGAAACGTTACAGGAGTTTGGCGGCCGG
GCGAAATATCTTGTTTCCTTCATCTCGGGAGAGAAAACCGACATTTACGGTCACGGCACACATATTGCAGGCATC
ATCGGCGGTAACACGTACGGCGTGGCAAAGAAGACAGACATTTACGGGGTCAAGGTGCTCGATAAAAAGAACGAA
GGCATGGTAGATGGCTTCATAAAGGGGCTCGACTATGTTGCCACGCACCAGGCTAAGATGCGAAAACAAGGAAAA
TGTAAGAAGGGTGTCGTCATCAACATGTCTATCAGCACGCCGCCGTCCAAGATATTGAACGACGCGGTGACCAAG
CTTATCAACAAGAATGTCTTCCTGGCCGTATCCGCCGGGAACGCAGGCATCCTTGCCAGCAAGCGGTCACCGGCC
CAGGGGTCTATCGCTTGCGTCGTGGGCGGCACCAACGAAAATGACAAGCTCTACTCGGATCCTGCCAGGGGCCTT
TCCAGCAACTACGGCAAGCGCGTCGACATATTCGCCCCCGGACAGGACATTCTCTCGGCCGCCAGCAACGCCGCC
ACCGGCGGTGGGGACTCGCCGGGCTACATGAGCGGCACTTCGCAGGCCGTGCCGCACGTCGTCGGCATCGCGGCG
TTGCTGGCGGCCAAGGAGGGCCTCAGCGGCACCAAGGCCCTGTGCGACCGCATCAAGCAGCTCGGGACCAAGGAC
GTGATTGTTAACCAGAAAAAGAACACAGTTAATCTCATGGCCTACAACGGCGCCGAGGATGAGCCGTCCAATGAG
ACGATCGAGCAGGACTTTTGCGATGCAAACACCAAGGAGGGATGCAGCCCGCAGATCGAGAAGCCCTTCACCGTC
CAAGACGCCGTCACAACGGGCGAGGATCCGAATGCCTGTAGCCACTTCAAGCGCCTCCACATCCAGCTTGTTACG
GCTGGCCACATTGTGGCTGGGACCTGGGACTATGTCAATATCAACTTCGGCAAGGAAAACACGTTACTCGCCAAG
AGCCCAGCTAGAAAGGAGGTGGATGAGGTAGACATTGACCCCAGGAAGGGCTTCGGGGCAACTGATGGGAAGATC
CGGGTCTCGGATATTAAGAAGTTCACTCTTTCTCTCAGCGAAGACAAGAAAGGACATAACCCCGATTGGTGGAGG
CTGAAGGGTAAGAAATACACTTCGACTGGCATGGGCGGATGGGGCTAACCTAGCTCAAGGGATCACGTTGGTGGG
AACCTGCGCCGGATCAGGTCGGATGGCGCAGATTACCAGGTTCGCGGAGCTCTACAAATGGATGGAGCGCTCGGA
TCAGACAGACTCGTTTACCGGCGAGATCAAGATCGAGGAATGGCAATGGCAATCCGAGGACAAGGACACGGCGAC
GCTGGCGGTGCAGCCCCCCGGGCGGCCCGACGCCTGCTCCCACTTCAAGCTTCTCGAGGCCGAATTGAAGCTGGG
CAATGGCTACTTCGAGGGCACATGGGACGACATCGAGCTCTGCTTTGACGGCCGGCCCAAGTGTCACATTCTCGC
CAGGGAACCCGAGCATGGCACCGATAGGACAACCCCGGTCAACCTAAAGGAAATCTTCGGGTCCGAGGTCATTCC
CGCGCCGGGCTTCCGTGCCATCAAGGTTTACAGCAAGACGGGCGCAAATAGGAGCAATGCGGACACAGACTGGTG
GAAGTATGACGGTACGTTGTTTCCGTCCGATATATGGAATTGAGCACATGGACTAATGGTCGACTCGCCACAAGG
CATTACATTGCGGGGACACTGCCAGGGCTCGCCCAGAGTGGTCGAGGCCCTCAAGTTCGCGAATAAGGATGAATG
GGTCATTCGCAAGGAGAATGACTATAGGACCCAGATTGCCTCTGGCGAGCTGGCTGCCAATGAGTGGCGCTGGGT
GAAGAAAGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail