Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6875
Gene name
LocationContig_371:6034..6361
Strand+
Gene length (bp)327
Transcript length (bp)327
Coding sequence length (bp)327
Protein length (aa) 109

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P29138|CUDP_METAN Cuticle-degrading protease OS=Metarhizium anisopliae GN=PR1 PE=1 SV=1 1 97 1.0E-10
sp|P23653|PRTR_ENGAL Proteinase R OS=Engyodontium album GN=PROR PE=1 SV=1 23 97 3.0E-09
sp|P06873|PRTK_ENGAL Proteinase K OS=Engyodontium album GN=PROK PE=1 SV=2 23 97 7.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6875
MHLSYLFAVVPLAAGASIPPTGRAEPAPLVSHDPADNVELSSEHIVKFKDGTHESTVHQVLANLEGNSSHIFDDV
FHGFSKNLNETELDFVRNHPEVRAPAHTLKGVH*
Coding >Hirsu2|6875
ATGCACCTGTCTTACCTCTTCGCGGTTGTACCGCTCGCGGCCGGCGCTTCGATCCCGCCCACGGGGCGTGCCGAA
CCGGCGCCTCTTGTGTCGCACGATCCCGCGGACAATGTTGAACTGAGCAGTGAGCACATTGTCAAGTTCAAGGAC
GGCACCCACGAGTCGACAGTGCACCAGGTCTTGGCCAACCTAGAAGGCAACTCGTCTCACATCTTTGACGACGTC
TTCCACGGCTTCTCCAAGAACCTGAACGAGACCGAGCTCGACTTTGTGCGGAACCACCCGGAAGTAAGAGCTCCC
GCGCACACTCTGAAAGGTGTCCATTAA
Transcript >Hirsu2|6875
ATGCACCTGTCTTACCTCTTCGCGGTTGTACCGCTCGCGGCCGGCGCTTCGATCCCGCCCACGGGGCGTGCCGAA
CCGGCGCCTCTTGTGTCGCACGATCCCGCGGACAATGTTGAACTGAGCAGTGAGCACATTGTCAAGTTCAAGGAC
GGCACCCACGAGTCGACAGTGCACCAGGTCTTGGCCAACCTAGAAGGCAACTCGTCTCACATCTTTGACGACGTC
TTCCACGGCTTCTCCAAGAACCTGAACGAGACCGAGCTCGACTTTGTGCGGAACCACCCGGAAGTAAGAGCTCCC
GCGCACACTCTGAAAGGTGTCCATTAA
Gene >Hirsu2|6875
ATGCACCTGTCTTACCTCTTCGCGGTTGTACCGCTCGCGGCCGGCGCTTCGATCCCGCCCACGGGGCGTGCCGAA
CCGGCGCCTCTTGTGTCGCACGATCCCGCGGACAATGTTGAACTGAGCAGTGAGCACATTGTCAAGTTCAAGGAC
GGCACCCACGAGTCGACAGTGCACCAGGTCTTGGCCAACCTAGAAGGCAACTCGTCTCACATCTTTGACGACGTC
TTCCACGGCTTCTCCAAGAACCTGAACGAGACCGAGCTCGACTTTGTGCGGAACCACCCGGAAGTAAGAGCTCCC
GCGCACACTCTGAAAGGTGTCCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail