Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6874
Gene name
LocationContig_370:17817..19533
Strand-
Gene length (bp)1716
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01585 G-patch G-patch domain 2.4E-13 343 383
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.6E-04 447 491

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P42698|DR111_ARATH DNA-damage-repair/toleration protein DRT111, chloroplastic OS=Arabidopsis thaliana GN=DRT111 PE=1 SV=2 306 506 1.0E-18
sp|Q8JZX4|SPF45_MOUSE Splicing factor 45 OS=Mus musculus GN=Rbm17 PE=1 SV=1 331 506 2.0E-15
sp|Q96I25|SPF45_HUMAN Splicing factor 45 OS=Homo sapiens GN=RBM17 PE=1 SV=1 331 506 7.0E-15
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 414 508 1.0E-08
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 414 508 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P42698|DR111_ARATH DNA-damage-repair/toleration protein DRT111, chloroplastic OS=Arabidopsis thaliana GN=DRT111 PE=1 SV=2 306 506 1.0E-18
sp|Q8JZX4|SPF45_MOUSE Splicing factor 45 OS=Mus musculus GN=Rbm17 PE=1 SV=1 331 506 2.0E-15
sp|Q96I25|SPF45_HUMAN Splicing factor 45 OS=Homo sapiens GN=RBM17 PE=1 SV=1 331 506 7.0E-15
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 414 508 1.0E-08
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 414 508 1.0E-08
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 414 508 1.0E-08
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 414 508 1.0E-08
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 414 508 2.0E-08
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 414 508 1.0E-07
sp|Q8T6B9|PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster GN=pUf68 PE=1 SV=2 414 506 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6874
MAAPPPPPPPPPPARGGLSLYDNLHDPNDPAPAGTISAAPVLYGQAEAASAEAKKPVDPALRFQPQIRRPAVKQA
KAKPTFPKGIPKTISAPAAATAVAAAVPAAPKTTLADWTATEEDEWMYGAGERPQRGGRKRKRKKNQQDEPEDIN
WDEFYDPGKPTNVEQYLKSDEKVSEVLEWKALLYRHRKRQYRSDSSSDEDEDMERPPQNRFAPPPAHVFAPPPPP
SPPQPTPDDRTGEGAFARRLALSSDQAASPEAAPASQPPPSPPPPPPPRSPSPPPPAGSATISREPVLYAQPRAA
GNREEGEGEGESEGEDPQAAAGLGADSDSGGPSTRSRVPGQAGFAQRLMSKYGWTKGTGLGANESGIVNPLRVQV
EKRRKKADAEGGGWAEPGGKGKILGGRRKDEEGRFGKMSEVIVLRNMLESMPDLQGEIAGGLGQEIGEECGEKYG
RVERLFIDQDARQVFIKFTDQVSALRAVNELDGRVFNGNAIAPRFYDAERFEQGDYGAP*
Coding >Hirsu2|6874
ATGGCAGCGCCGCCGCCGCCGCCGCCGCCGCCGCCTCCTGCGCGAGGCGGGCTCTCGCTATACGACAACCTGCAC
GACCCCAACGATCCAGCTCCCGCGGGAACGATATCCGCAGCGCCTGTCCTCTACGGCCAAGCCGAGGCCGCCTCC
GCCGAGGCCAAGAAGCCAGTCGACCCAGCCTTGCGCTTCCAGCCCCAAATCCGCCGGCCGGCCGTCAAGCAAGCC
AAGGCCAAGCCGACGTTTCCCAAGGGGATCCCCAAAACCATCTCGGCCCCCGCTGCTGCCACAGCCGTCGCCGCG
GCTGTCCCGGCCGCGCCGAAGACGACGCTCGCAGACTGGACGGCCACGGAGGAGGACGAGTGGATGTACGGCGCG
GGCGAGAGGCCTCAGCGAGGTGGTCGAAAGAGGAAACGAAAGAAGAACCAGCAGGACGAGCCCGAGGACATCAAC
TGGGACGAATTCTACGACCCAGGGAAGCCGACCAACGTTGAGCAGTACCTAAAAAGCGACGAGAAGGTGTCCGAG
GTGCTTGAATGGAAAGCACTGCTGTACAGGCACCGAAAGCGGCAGTATCGCAGTGACTCCTCGAGTGACGAGGAT
GAAGACATGGAGCGCCCCCCGCAGAACCGGTTTGCTCCCCCCCCAGCCCACGTGTTCGCGCCGCCGCCGCCGCCC
TCACCTCCACAGCCTACTCCCGACGACCGCACCGGCGAGGGTGCCTTTGCGCGCCGGCTGGCCTTGTCTTCAGAT
CAAGCTGCGTCGCCGGAGGCGGCCCCTGCCTCGCAACCACCACCTTCCCCGCCGCCGCCGCCGCCTCCCCGAAGC
CCCTCCCCTCCACCCCCTGCGGGCTCGGCCACCATATCGCGCGAACCCGTGCTATACGCGCAGCCGCGCGCTGCA
GGAAACAGAGAAGAGGGCGAGGGCGAGGGCGAGAGCGAGGGCGAAGATCCACAGGCGGCAGCCGGCCTTGGCGCC
GACTCCGACTCCGGCGGACCGTCGACGCGCTCCAGGGTGCCGGGCCAGGCCGGCTTCGCGCAGCGGCTGATGAGC
AAGTACGGCTGGACCAAGGGCACCGGCCTGGGCGCAAACGAGTCGGGCATCGTCAACCCGCTGCGGGTGCAGGTG
GAGAAGCGGCGGAAGAAGGCGGACGCCGAGGGCGGCGGCTGGGCCGAGCCCGGCGGCAAGGGCAAGATCCTCGGC
GGGCGGCGCAAGGACGAGGAGGGCCGCTTCGGCAAGATGAGCGAGGTGATCGTGCTGCGCAACATGCTGGAGAGC
ATGCCCGACCTGCAGGGCGAGATCGCCGGCGGCCTCGGCCAGGAGATCGGCGAGGAGTGCGGCGAGAAGTACGGC
CGCGTGGAACGGCTCTTCATCGACCAGGACGCGCGCCAGGTCTTCATCAAGTTCACGGACCAGGTGTCCGCCCTG
CGGGCCGTCAACGAGCTCGACGGGCGCGTCTTCAACGGCAACGCCATCGCCCCGCGCTTCTACGACGCCGAGCGC
TTCGAGCAGGGCGACTACGGCGCCCCTTAG
Transcript >Hirsu2|6874
ATGGCAGCGCCGCCGCCGCCGCCGCCGCCGCCGCCTCCTGCGCGAGGCGGGCTCTCGCTATACGACAACCTGCAC
GACCCCAACGATCCAGCTCCCGCGGGAACGATATCCGCAGCGCCTGTCCTCTACGGCCAAGCCGAGGCCGCCTCC
GCCGAGGCCAAGAAGCCAGTCGACCCAGCCTTGCGCTTCCAGCCCCAAATCCGCCGGCCGGCCGTCAAGCAAGCC
AAGGCCAAGCCGACGTTTCCCAAGGGGATCCCCAAAACCATCTCGGCCCCCGCTGCTGCCACAGCCGTCGCCGCG
GCTGTCCCGGCCGCGCCGAAGACGACGCTCGCAGACTGGACGGCCACGGAGGAGGACGAGTGGATGTACGGCGCG
GGCGAGAGGCCTCAGCGAGGTGGTCGAAAGAGGAAACGAAAGAAGAACCAGCAGGACGAGCCCGAGGACATCAAC
TGGGACGAATTCTACGACCCAGGGAAGCCGACCAACGTTGAGCAGTACCTAAAAAGCGACGAGAAGGTGTCCGAG
GTGCTTGAATGGAAAGCACTGCTGTACAGGCACCGAAAGCGGCAGTATCGCAGTGACTCCTCGAGTGACGAGGAT
GAAGACATGGAGCGCCCCCCGCAGAACCGGTTTGCTCCCCCCCCAGCCCACGTGTTCGCGCCGCCGCCGCCGCCC
TCACCTCCACAGCCTACTCCCGACGACCGCACCGGCGAGGGTGCCTTTGCGCGCCGGCTGGCCTTGTCTTCAGAT
CAAGCTGCGTCGCCGGAGGCGGCCCCTGCCTCGCAACCACCACCTTCCCCGCCGCCGCCGCCGCCTCCCCGAAGC
CCCTCCCCTCCACCCCCTGCGGGCTCGGCCACCATATCGCGCGAACCCGTGCTATACGCGCAGCCGCGCGCTGCA
GGAAACAGAGAAGAGGGCGAGGGCGAGGGCGAGAGCGAGGGCGAAGATCCACAGGCGGCAGCCGGCCTTGGCGCC
GACTCCGACTCCGGCGGACCGTCGACGCGCTCCAGGGTGCCGGGCCAGGCCGGCTTCGCGCAGCGGCTGATGAGC
AAGTACGGCTGGACCAAGGGCACCGGCCTGGGCGCAAACGAGTCGGGCATCGTCAACCCGCTGCGGGTGCAGGTG
GAGAAGCGGCGGAAGAAGGCGGACGCCGAGGGCGGCGGCTGGGCCGAGCCCGGCGGCAAGGGCAAGATCCTCGGC
GGGCGGCGCAAGGACGAGGAGGGCCGCTTCGGCAAGATGAGCGAGGTGATCGTGCTGCGCAACATGCTGGAGAGC
ATGCCCGACCTGCAGGGCGAGATCGCCGGCGGCCTCGGCCAGGAGATCGGCGAGGAGTGCGGCGAGAAGTACGGC
CGCGTGGAACGGCTCTTCATCGACCAGGACGCGCGCCAGGTCTTCATCAAGTTCACGGACCAGGTGTCCGCCCTG
CGGGCCGTCAACGAGCTCGACGGGCGCGTCTTCAACGGCAACGCCATCGCCCCGCGCTTCTACGACGCCGAGCGC
TTCGAGCAGGGCGACTACGGCGCCCCTTAG
Gene >Hirsu2|6874
ATGGCAGCGCCGCCGCCGCCGCCGCCGCCGCCGCCTCCTGCGCGAGGCGGGCTCTCGCTATACGACAACCTGCAC
GACCCCAACGATCCAGCTCCCGCGGGAACGATATCCGCAGCGCCTGTCCTCTACGGCCAAGCCGAGGCCGCCTCC
GCCGAGGCCAAGAAGCCAGTCGACCCAGCCTTGCGCTTCCAGCCCCAAATCCGCCGGCCGGCCGTCAAGCAAGCC
AAGGCCAAGCCGACGTTTCCCAAGGGGATCCCCAAAACCATCTCGGCCCCCGCTGCTGCCACAGCCGTCGCCGCG
GCTGTCCCGGCCGCGCCGAAGACGACGCTCGCAGACTGGACGGCCACGGAGGAGGACGAGTGGATGTACGGCGCG
GGCGAGAGGCCTCAGCGAGGTGGTCGAAAGAGGAAACGAAAGAAGAACCAGCAGGACGAGCCCGAGGACATCAAC
TGGGACGAATTCTACGACCCAGGGAAGCCGACCAACGTTGAGCAGTACCTAAAAAGCGACGAGAAGGTGTCCGAG
GTGCTTGAATGGAAAGCACTGCTGTACAGGCACCGAAAGCGGCAGTATCGCAGTGACTCCTCGAGTGACGAGGAT
GAAGACATGGAGCGCCCCCCGCAGAGTGAGTGTCTTTCGAACGGTTGGCTGTGAGGAAGGCCACTTGCTGACAGG
GTGTGCCTCAGACCGGTTTGCTCCCCCCCCAGCCCACGTGTTCGCGCCGCCGCCGCCGCCCTCACCTCCACAGCC
TACTCCCGACGACCGCACCGGCGAGGGTGCCTTTGCGCGCCGGCTGGCCTTGTCTTCAGATCAAGCTGCGTCGCC
GGAGGCGGCCCCTGCCTCGCAACCACCACCTTCCCCGCCGCCGCCGCCGCCTCCCCGAAGCCCCTCCCCTCCACC
CCCTGCGGGCTCGGCCACCATATCGCGCGAACCCGTGCTATACGCGCAGCCGCGCGCTGCAGGAAACAGAGAAGA
GGGCGAGGGCGAGGGCGAGAGCGAGGGCGAAGATCCACAGGCGGCAGCCGGCCTTGGCGCCGACTCCGACTCCGG
CGGACCGTCGACGCGCTCCAGGGTGCCGGGCCAGGCCGGCTTCGCGCAGCGGCTGATGAGCAAGTACGGCTGGAC
CAAGGGCACCGGCCTGGGCGCAAACGAGTCGGGCATCGTCAACCCGCTGCGGGTGCAGGTGGAGAAGCGGCGGAA
GAAGGCGGACGCCGAGGGCGGCGGCTGGGCCGAGCCCGGCGGCAAGGGCAAGATCCTCGGCGGGCGGCGCAAGGA
CGAGGAGGGCCGCTTCGGCAAGATGAGCGAGGTGATCGTGCTGCGCAACATGCTGGAGAGCATGCCCGACCTGCA
GGGCGAGATCGCCGGCGGCCTCGGCCAGGAGATCGGCGAGGAGTGCGGCGAGAAGGTGAGGCGCCCGCGCCCCGG
CCACGCAAGCCAAGCGCACACAACCAGCTAACGCGGGGAACACACAGTACGGCCGCGTGGAACGGCTCTTCATCG
ACCAGGACGCGCGCCAGGTCTTCATCAAGTTCACGGACCAGGTGTCCGCCCTGCGGGTACGTCCTGTCCCCCTCC
CCCTCCCCCCTCCCCTTTCGCTCGCTGACGGCGCGCCAGGCCGTCAACGAGCTCGACGGGCGCGTCTTCAACGGC
AACGCCATCGCCCCGCGCTTCTACGACGCCGAGCGCTTCGAGCAGGGCGACTACGGCGCCCCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail