Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6873
Gene name
LocationContig_370:15748..17043
Strand+
Gene length (bp)1295
Transcript length (bp)1170
Coding sequence length (bp)1170
Protein length (aa) 390

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AZK9|ECM33_ARTBC Cell surface GPI-anchored protein ARB_01627 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01627 PE=1 SV=1 6 362 3.0E-43
sp|O74411|MEU10_SCHPO Meiotic expression up-regulated protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu10 PE=3 SV=1 17 338 9.0E-33
sp|Q4WNS8|ECM33_ASPFU Protein ecm33 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ecm33 PE=1 SV=1 39 352 2.0E-32
sp|P25380|SPS22_YEAST Sporulation-specific protein 22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS22 PE=3 SV=1 24 346 2.0E-25
sp|B5VE42|ECM33_YEAS6 Cell wall protein ECM33 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=ECM33 PE=3 SV=2 39 337 3.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AZK9|ECM33_ARTBC Cell surface GPI-anchored protein ARB_01627 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01627 PE=1 SV=1 6 362 3.0E-43
sp|O74411|MEU10_SCHPO Meiotic expression up-regulated protein 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu10 PE=3 SV=1 17 338 9.0E-33
sp|Q4WNS8|ECM33_ASPFU Protein ecm33 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ecm33 PE=1 SV=1 39 352 2.0E-32
sp|P25380|SPS22_YEAST Sporulation-specific protein 22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS22 PE=3 SV=1 24 346 2.0E-25
sp|B5VE42|ECM33_YEAS6 Cell wall protein ECM33 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=ECM33 PE=3 SV=2 39 337 3.0E-25
sp|C7GQJ1|ECM33_YEAS2 Cell wall protein ECM33 OS=Saccharomyces cerevisiae (strain JAY291) GN=ECM33 PE=3 SV=1 1 337 4.0E-25
sp|P38248|ECM33_YEAST Cell wall protein ECM33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM33 PE=1 SV=3 39 337 8.0E-24
sp|A6ZL22|ECM33_YEAS7 Cell wall protein ECM33 OS=Saccharomyces cerevisiae (strain YJM789) GN=ECM33 PE=3 SV=2 39 337 1.0E-23
sp|P08459|SPS2_YEAST Sporulation-specific protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS2 PE=1 SV=2 39 368 2.0E-22
sp|Q12355|PST1_YEAST Cell wall mannoprotein PST1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PST1 PE=1 SV=1 39 338 1.0E-20
sp|A6ZY20|PST1_YEAS7 Cell wall mannoprotein PST1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PST1 PE=3 SV=1 39 338 1.0E-20
sp|Q5AGC4|ECM33_CANAL Cell surface GPI-anchored protein ECM33 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ECM331 PE=1 SV=1 6 342 6.0E-20
sp|O13960|ECM33_SCHPO Cell wall protein ecm33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ecm33 PE=1 SV=2 18 312 2.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6873
MHSVAILSALAAIGTSLVSGATTCSQEIHITEPTPVIDCDVVDANVIVDENVNGMLSIEGPKQLKKDFIIRNATK
LLGVSSSSVNSVGGRLILDGCQLLSSFNMQSLTSVNILQFVNLPQLSAMTLGTEGVTKASSIIITDTFISNLTGL
NFAQATTIEISNNAKLTTFTSVLVNVTKSLKLTNNGNNMQVSMPNLELAGDVQFRQVKSFDAPVLSKAESIKFND
SPELLSVSANNLTEISASLTFINNRKLSKLQFKALKTIKGDMTVQNNTALKEIDGFPKLESVGNILLRGVFEDVN
LPSLKDVKGSATATSTTDISNFCGRFDKLKSDGNIRGKMSCTSNNKNANEGDGSGGQSNSDKEKDAAGIVNVNTA
LLGLALFAAVAQLL*
Coding >Hirsu2|6873
ATGCACTCCGTCGCCATCCTCTCGGCCCTCGCGGCCATCGGCACCAGCCTCGTCTCTGGTGCCACGACGTGTTCG
CAGGAAATCCACATCACCGAGCCTACTCCCGTCATCGACTGTGACGTGGTCGACGCCAACGTCATCGTCGACGAG
AATGTGAACGGCATGCTGAGCATCGAGGGCCCCAAGCAGCTCAAGAAGGACTTCATCATTCGCAATGCCACCAAG
CTGCTGGGCGTCTCGAGCAGTTCCGTCAACTCGGTGGGCGGCAGGCTGATTCTCGACGGCTGCCAGCTCCTCAGC
AGCTTCAACATGCAGTCGCTCACGTCGGTCAACATCCTGCAATTCGTCAACCTGCCCCAACTGAGCGCCATGACC
CTGGGCACCGAGGGCGTCACCAAGGCCAGCTCCATCATCATCACCGATACCTTCATCAGCAACCTGACGGGCCTC
AACTTCGCCCAGGCTACCACGATCGAAATCTCGAACAATGCTAAACTCACCACGTTCACTTCCGTTCTTGTTAAC
GTCACAAAGTCGCTCAAGCTCACCAACAACGGCAACAACATGCAGGTCAGCATGCCCAACCTCGAGCTTGCCGGC
GACGTCCAGTTCCGCCAGGTCAAGAGCTTCGATGCCCCCGTCCTGAGCAAGGCCGAATCCATCAAGTTCAACGAC
AGCCCCGAGCTGCTGTCCGTCTCGGCCAACAACCTGACGGAGATCTCGGCCAGTCTGACCTTCATCAACAACCGG
AAGCTCAGCAAGCTCCAGTTCAAGGCCCTCAAGACGATCAAGGGTGACATGACCGTCCAGAACAACACGGCCCTC
AAGGAGATCGACGGCTTCCCTAAGCTGGAGTCCGTCGGCAACATCCTGCTGCGCGGTGTCTTCGAAGACGTCAAC
CTGCCGAGCCTTAAGGACGTCAAGGGCAGCGCCACGGCCACGTCGACCACCGACATCTCCAACTTCTGCGGCCGC
TTTGACAAGCTCAAGTCCGACGGTAACATCCGCGGAAAGATGTCTTGCACGAGCAACAACAAGAACGCCAACGAG
GGCGACGGCTCCGGCGGCCAGAGCAACAGCGACAAGGAGAAGGACGCCGCCGGCATCGTCAACGTCAACACGGCG
CTGCTCGGCCTCGCCCTCTTCGCCGCGGTCGCCCAGCTGCTGTAA
Transcript >Hirsu2|6873
ATGCACTCCGTCGCCATCCTCTCGGCCCTCGCGGCCATCGGCACCAGCCTCGTCTCTGGTGCCACGACGTGTTCG
CAGGAAATCCACATCACCGAGCCTACTCCCGTCATCGACTGTGACGTGGTCGACGCCAACGTCATCGTCGACGAG
AATGTGAACGGCATGCTGAGCATCGAGGGCCCCAAGCAGCTCAAGAAGGACTTCATCATTCGCAATGCCACCAAG
CTGCTGGGCGTCTCGAGCAGTTCCGTCAACTCGGTGGGCGGCAGGCTGATTCTCGACGGCTGCCAGCTCCTCAGC
AGCTTCAACATGCAGTCGCTCACGTCGGTCAACATCCTGCAATTCGTCAACCTGCCCCAACTGAGCGCCATGACC
CTGGGCACCGAGGGCGTCACCAAGGCCAGCTCCATCATCATCACCGATACCTTCATCAGCAACCTGACGGGCCTC
AACTTCGCCCAGGCTACCACGATCGAAATCTCGAACAATGCTAAACTCACCACGTTCACTTCCGTTCTTGTTAAC
GTCACAAAGTCGCTCAAGCTCACCAACAACGGCAACAACATGCAGGTCAGCATGCCCAACCTCGAGCTTGCCGGC
GACGTCCAGTTCCGCCAGGTCAAGAGCTTCGATGCCCCCGTCCTGAGCAAGGCCGAATCCATCAAGTTCAACGAC
AGCCCCGAGCTGCTGTCCGTCTCGGCCAACAACCTGACGGAGATCTCGGCCAGTCTGACCTTCATCAACAACCGG
AAGCTCAGCAAGCTCCAGTTCAAGGCCCTCAAGACGATCAAGGGTGACATGACCGTCCAGAACAACACGGCCCTC
AAGGAGATCGACGGCTTCCCTAAGCTGGAGTCCGTCGGCAACATCCTGCTGCGCGGTGTCTTCGAAGACGTCAAC
CTGCCGAGCCTTAAGGACGTCAAGGGCAGCGCCACGGCCACGTCGACCACCGACATCTCCAACTTCTGCGGCCGC
TTTGACAAGCTCAAGTCCGACGGTAACATCCGCGGAAAGATGTCTTGCACGAGCAACAACAAGAACGCCAACGAG
GGCGACGGCTCCGGCGGCCAGAGCAACAGCGACAAGGAGAAGGACGCCGCCGGCATCGTCAACGTCAACACGGCG
CTGCTCGGCCTCGCCCTCTTCGCCGCGGTCGCCCAGCTGCTGTAA
Gene >Hirsu2|6873
ATGCACTCCGTCGCCATCCTCTCGGCCCTCGCGGCCATCGGCACCAGCCTCGTCTCTGGTAAGCCGCTCGCCTCG
GCCTTCTTGCCGTCCCTCACGTCTCCTCCGTTGCTGACCAGCCGCGGTCCTGCAGGTGCCACGACGTGTTCGCAG
GAAATCCACATCACCGAGCCTACTCCCGTCATCGACTGTGACGTGGTCGACGCCAACGTCATCGTCGACGAGAAT
GTGAACGGCATGCTGAGCATCGAGGGCCCCAAGCAGCTCAAGAAGGACTTCATCATTCGCAATGCCACCAAGCTG
CTGGGCGTCTCGAGCAGTTCCGTCAACTCGGTGGGCGGCAGGCTGATTCTCGACGGCTGCCAGCTCCTCAGCAGC
TTCAACATGCAGTCGCTCACGTCGGTCAACATCCTGCAATTCGTCAACCTGCCCCAACTGAGCGCCATGACCCTG
GGCACCGAGGGCGTCACCAAGGCCAGCTCCATCATCATCACCGATACCTTCATCAGCAACCTGACGGGCCTCAAC
TTCGCCCAGGCTACCACGATCGAAATCTCGAACAATGCTAAACTCACCACGTTCACTTCCGTTCTTGTTAACGTC
ACAAAGTCGCTCAAGCTCACCAACAACGGCAACAACATGCAGGTCAGCATGCCCAACCTCGAGCTTGCCGGCGAC
GTCCAGTTCCGCCAGGTCAAGAGCTTCGATGCCCCCGTCCTGAGCAAGGCCGAATCCATCAAGTTCAACGACAGC
CCCGAGCTGCTGTCCGTCTCGGCCAACAACCTGACGGAGATCTCGGCCAGTCTGACCTTCATCAACAACCGGAAG
CTCAGCAAGCTCCAGTTCAAGGCCCTCAAGACGATCAAGGGTGACATGACCGTCCAGAACAACACGGCCCTCAAG
GAGATCGACGGCTTCCCTAAGCTGGAGTCCGTCGGCAACATCCTGCTGCGCGGTGTCTTCGAAGAGTACGTCTCC
CCCTCCCCGCCGTGCACGCACAGGCCGACTGACACCGGGACAGCGTCAACCTGCCGAGCCTTAAGGACGTCAAGG
GCAGCGCCACGGCCACGTCGACCACCGACATCTCCAACTTCTGCGGCCGCTTTGACAAGCTCAAGTCCGACGGTA
ACATCCGCGGAAAGATGTCTTGCACGAGCAACAACAAGAACGCCAACGAGGGCGACGGCTCCGGCGGCCAGAGCA
ACAGCGACAAGGAGAAGGACGCCGCCGGCATCGTCAACGTCAACACGGCGCTGCTCGGCCTCGCCCTCTTCGCCG
CGGTCGCCCAGCTGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail