Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6866
Gene name
LocationContig_37:54589..56539
Strand+
Gene length (bp)1950
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 3.7E-33 275 511

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47082|AVT1_YEAST Vacuolar amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT1 PE=1 SV=1 204 514 2.0E-59
sp|Q9JHZ9|S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus GN=Slc38a3 PE=2 SV=1 240 430 3.0E-08
sp|Q9DCP2|S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus GN=Slc38a3 PE=1 SV=1 241 430 5.0E-08
sp|Q99624|S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens GN=SLC38A3 PE=1 SV=1 239 443 5.0E-07
sp|P34579|UNC47_CAEEL Vesicular GABA transporter OS=Caenorhabditis elegans GN=unc-47 PE=1 SV=2 232 521 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47082|AVT1_YEAST Vacuolar amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT1 PE=1 SV=1 204 514 2.0E-59
sp|Q9JHZ9|S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus GN=Slc38a3 PE=2 SV=1 240 430 3.0E-08
sp|Q9DCP2|S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus GN=Slc38a3 PE=1 SV=1 241 430 5.0E-08
sp|Q99624|S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens GN=SLC38A3 PE=1 SV=1 239 443 5.0E-07
sp|P34579|UNC47_CAEEL Vesicular GABA transporter OS=Caenorhabditis elegans GN=unc-47 PE=1 SV=2 232 521 1.0E-06
sp|A2VE31|S38A2_BOVIN Sodium-coupled neutral amino acid transporter 2 OS=Bos taurus GN=SLC38A2 PE=2 SV=1 234 448 2.0E-06
sp|Q9JM15|S38A1_RAT Sodium-coupled neutral amino acid transporter 1 OS=Rattus norvegicus GN=Slc38a1 PE=1 SV=1 234 430 2.0E-06
sp|Q8K2P7|S38A1_MOUSE Sodium-coupled neutral amino acid transporter 1 OS=Mus musculus GN=Slc38a1 PE=1 SV=1 234 379 3.0E-06
sp|A1YG32|S38A2_PANPA Sodium-coupled neutral amino acid transporter 2 OS=Pan paniscus GN=SLC38A2 PE=3 SV=1 234 390 4.0E-06
sp|Q96QD8|S38A2_HUMAN Sodium-coupled neutral amino acid transporter 2 OS=Homo sapiens GN=SLC38A2 PE=1 SV=2 234 390 5.0E-06
sp|Q9JHE5|S38A2_RAT Sodium-coupled neutral amino acid transporter 2 OS=Rattus norvegicus GN=Slc38a2 PE=1 SV=1 234 430 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 299 321 22
2 354 376 22
3 381 403 22
4 410 432 22
5 457 479 22
6 492 514 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6866
MASARNQQQRQPSPSGSLTASALAEEEAIIDNDDNDADNDADNDVAGASMSYQARRRSSVGHRFAAMADLGGANS
FRSFARSWRRAANFPEVIPRQPSFVLSPDQGSTTGDEVQYFSYRGPHEPPSQHTSLLAQHFGRLPSPEGEPSAGG
PGLSPARDIPSGREGKALEAEMAVGALPVGSPSSRSSIFAAPPHLATPSIIGSYGSLRSSHYGTVGRMRSRSSLA
RRGSWAVRPDRDAAADEDPDDDDVALGEDQPILVKEVKQGDKFVLAVDGQSTLPQSVFNSINALIGVGLLSLPLA
LRMSGWLIGLSLLTLMALVATHTGKLLGKCMEVDASIITYSDLAYICFGARARLVISALFTLELIGACVALVILF
ADSLDLLLPGVASVDVWKCVCAALVLVLNTMPLRWLSYTSVVGIFSTFGIVCIVLVDGLTKRHTPGSLLEPATTH
LLPSNWLALPLAYGLLASPWGAHCVFPSIYRDMRFPHQWRTGVNVAFSFSYALDMSLAVVGILISRSTRGHW*
Coding >Hirsu2|6866
ATGGCTTCGGCGCGGAACCAGCAGCAGAGGCAGCCCTCGCCGTCCGGCAGCCTGACGGCGAGTGCCTTGGCCGAG
GAGGAGGCCATCATCGATAACGACGATAACGACGCCGATAACGACGCCGATAACGACGTTGCCGGGGCTTCCATG
AGCTACCAGGCACGCAGGCGGTCCTCCGTCGGCCATCGCTTCGCCGCCATGGCCGACTTGGGCGGAGCCAACAGC
TTCAGATCGTTCGCCCGCAGCTGGCGGCGGGCCGCCAACTTCCCCGAGGTCATCCCCCGCCAGCCGAGCTTCGTC
CTGTCCCCCGACCAAGGGTCTACGACCGGGGATGAAGTCCAGTATTTCTCGTACCGCGGGCCTCACGAACCGCCA
TCCCAACACACCAGCCTCCTGGCCCAGCATTTCGGCCGCCTTCCCTCGCCGGAGGGCGAGCCCAGTGCCGGCGGC
CCCGGCCTCTCGCCGGCGAGGGATATCCCGAGCGGGCGGGAGGGCAAGGCTCTGGAGGCGGAGATGGCCGTCGGC
GCCCTGCCTGTTGGGTCGCCGTCCAGTCGCTCCAGCATATTCGCCGCCCCGCCGCACTTGGCGACGCCGTCCATC
ATCGGGAGCTACGGCTCGCTGCGGAGCTCGCACTACGGCACCGTGGGCAGGATGCGGTCGCGCTCGTCCCTGGCT
CGCCGCGGCAGCTGGGCCGTCCGTCCGGACCGGGACGCCGCGGCCGACGAGGACCCCGACGATGACGACGTCGCC
CTCGGCGAGGACCAGCCCATCCTTGTCAAGGAAGTCAAGCAGGGCGACAAGTTCGTCCTGGCCGTCGACGGCCAG
AGCACGCTGCCGCAGTCCGTCTTCAACTCCATCAACGCCCTCATCGGCGTCGGCTTGTTGAGCCTGCCCCTGGCC
CTGAGGATGAGCGGCTGGCTCATCGGCCTGTCGCTGCTGACGCTCATGGCCCTCGTCGCCACCCACACCGGCAAG
CTCCTGGGCAAGTGCATGGAGGTCGACGCCAGCATCATCACCTACTCGGACCTGGCCTACATCTGCTTCGGCGCC
AGGGCGCGCCTCGTCATCTCGGCCCTCTTCACCCTCGAACTGATCGGCGCCTGCGTGGCCCTCGTCATCCTCTTC
GCCGACTCGCTCGACCTGCTGCTGCCCGGCGTGGCGAGTGTGGACGTGTGGAAGTGCGTGTGCGCGGCCCTGGTG
CTCGTCCTGAACACGATGCCCCTCCGCTGGCTCAGCTACACCAGCGTCGTCGGCATCTTTTCCACCTTTGGCATC
GTCTGCATCGTCCTCGTCGACGGCCTGACCAAGCGACACACGCCCGGCTCCCTACTGGAACCGGCGACGACGCAT
CTGCTCCCTTCCAACTGGCTGGCCCTGCCGCTCGCCTACGGCCTGCTGGCGAGCCCCTGGGGCGCCCACTGTGTG
TTCCCATCGATCTACCGGGACATGCGCTTCCCGCACCAGTGGCGGACCGGGGTCAACGTCGCCTTCTCCTTCTCC
TACGCGCTGGACATGAGCCTGGCCGTCGTGGGCATCCTGATATCCCGCTCAACTCGCGGCCACTGGTGA
Transcript >Hirsu2|6866
ATGGCTTCGGCGCGGAACCAGCAGCAGAGGCAGCCCTCGCCGTCCGGCAGCCTGACGGCGAGTGCCTTGGCCGAG
GAGGAGGCCATCATCGATAACGACGATAACGACGCCGATAACGACGCCGATAACGACGTTGCCGGGGCTTCCATG
AGCTACCAGGCACGCAGGCGGTCCTCCGTCGGCCATCGCTTCGCCGCCATGGCCGACTTGGGCGGAGCCAACAGC
TTCAGATCGTTCGCCCGCAGCTGGCGGCGGGCCGCCAACTTCCCCGAGGTCATCCCCCGCCAGCCGAGCTTCGTC
CTGTCCCCCGACCAAGGGTCTACGACCGGGGATGAAGTCCAGTATTTCTCGTACCGCGGGCCTCACGAACCGCCA
TCCCAACACACCAGCCTCCTGGCCCAGCATTTCGGCCGCCTTCCCTCGCCGGAGGGCGAGCCCAGTGCCGGCGGC
CCCGGCCTCTCGCCGGCGAGGGATATCCCGAGCGGGCGGGAGGGCAAGGCTCTGGAGGCGGAGATGGCCGTCGGC
GCCCTGCCTGTTGGGTCGCCGTCCAGTCGCTCCAGCATATTCGCCGCCCCGCCGCACTTGGCGACGCCGTCCATC
ATCGGGAGCTACGGCTCGCTGCGGAGCTCGCACTACGGCACCGTGGGCAGGATGCGGTCGCGCTCGTCCCTGGCT
CGCCGCGGCAGCTGGGCCGTCCGTCCGGACCGGGACGCCGCGGCCGACGAGGACCCCGACGATGACGACGTCGCC
CTCGGCGAGGACCAGCCCATCCTTGTCAAGGAAGTCAAGCAGGGCGACAAGTTCGTCCTGGCCGTCGACGGCCAG
AGCACGCTGCCGCAGTCCGTCTTCAACTCCATCAACGCCCTCATCGGCGTCGGCTTGTTGAGCCTGCCCCTGGCC
CTGAGGATGAGCGGCTGGCTCATCGGCCTGTCGCTGCTGACGCTCATGGCCCTCGTCGCCACCCACACCGGCAAG
CTCCTGGGCAAGTGCATGGAGGTCGACGCCAGCATCATCACCTACTCGGACCTGGCCTACATCTGCTTCGGCGCC
AGGGCGCGCCTCGTCATCTCGGCCCTCTTCACCCTCGAACTGATCGGCGCCTGCGTGGCCCTCGTCATCCTCTTC
GCCGACTCGCTCGACCTGCTGCTGCCCGGCGTGGCGAGTGTGGACGTGTGGAAGTGCGTGTGCGCGGCCCTGGTG
CTCGTCCTGAACACGATGCCCCTCCGCTGGCTCAGCTACACCAGCGTCGTCGGCATCTTTTCCACCTTTGGCATC
GTCTGCATCGTCCTCGTCGACGGCCTGACCAAGCGACACACGCCCGGCTCCCTACTGGAACCGGCGACGACGCAT
CTGCTCCCTTCCAACTGGCTGGCCCTGCCGCTCGCCTACGGCCTGCTGGCGAGCCCCTGGGGCGCCCACTGTGTG
TTCCCATCGATCTACCGGGACATGCGCTTCCCGCACCAGTGGCGGACCGGGGTCAACGTCGCCTTCTCCTTCTCC
TACGCGCTGGACATGAGCCTGGCCGTCGTGGGCATCCTGATATCCCGCTCAACTCGCGGCCACTGGTGA
Gene >Hirsu2|6866
ATGGCTTCGGCGCGGAACCAGCAGCAGAGGCAGCCCTCGCCGTCCGGCAGCCTGACGGCGAGTGCCTTGGCCGAG
GAGGAGGCCATCATCGATAACGACGATAACGACGCCGATAACGACGCCGATAACGACGTTGCCGGGGCTTCCATG
AGCTACCAGGCACGCAGGCGGTAAGCGTCGGGAACCAGCCAGCAATTACTACACCCAACGTCGGGCAACTGATGG
CCCCCCCTCCCCTAGGTCCTCCGTCGGCCATCGCTTCGCCGCCATGGCCGACTTGGGCGGAGCCAACAGCTTCAG
ATCGTTCGCCCGCAGCTGGCGGCGGGCCGCCAACTTCCCCGAGGTCATCCCCCGCCAGCCGAGCTTCGTCCTGTC
CCCCGACCAAGGGTCTACGACCGGGGATGAAGTCCAGTATTTCTCGTACCGCGGGCCTCACGAACCGCCATCCCA
ACACACCAGCCTCCTGGCCCAGCATTTCGGCCGCCTTCCCTCGCCGGAGGGCGAGCCCAGTGCCGGCGGCCCCGG
CCTCTCGCCGGCGAGGGATATCCCGAGCGGGCGGGAGGGCAAGGCTCTGGAGGCGGAGATGGCCGTCGGCGCCCT
GCCTGTTGGGTCGCCGTCCAGTCGCTCCAGCATATTCGCCGCCCCGCCGCACTTGGCGACGCCGTCCATCATCGG
GAGCTACGGCTCGCTGCGGAGCTCGCACTACGGCACCGTGGGCAGGATGCGGTCGCGCTCGTCCCTGGCTCGCCG
CGGCAGCTGGGCCGTCCGTCCGGACCGGGACGCCGCGGCCGACGAGGACCCCGACGATGACGACGTCGCCCTCGG
CGAGGACCAGCCCATCCTTGTCAAGGAAGTCAAGCAGGGCGACAAGTTCGTCCTGGCCGTCGACGGCCAGAGCAC
GCTGCCGCAGTCCGTCTTCAACTCCATCAACGCCCTCATCGGCGTCGGCTTGTTGAGCCTGCCCCTGGCCCTGAG
GATGAGCGGCTGGCTCATCGGCCTGTCGCTGCTGACGCTCATGGCCCTCGTCGCCACCCACACCGGCAAGCTCCT
GGGCAAGTGCATGGAGGTCGACGCCAGCATCATCACCTACTCGGACCTGGCCTACATCTGCTTCGGCGCCAGGGC
GCGCCTCGTCATCTCGGCCCTCTTCACCCTCGAACTGATCGGCGCCTGCGTGGCCCTCGTCATCCTCTTCGCCGA
CTCGCTCGACCTGCTGCTGCCCGGCGTGGCGAGTGTGGACGTGTGGAAGTGCGTGTGCGCGGCCCTGGTGCTCGT
CCTGAACACGATGCCCCTCCGCTGGCTCAGCTACACCAGCGTCGTCGGCATCTTTTCCACCTTTGGCAGTAAGCA
GCCAGTCACACACACACACCATGCCTTCGGGGGCGGCGTCGACGAATGGGTTGCTGACGCCAGGCTCAAGTCGTC
TGCATCGTCCTCGTCGACGGCCTGACCAAGCGACACACGCCCGGCTCCCTACTGGAACCGGCGACGACGCATCTG
CTCCCTTCCAACTGGCTGGCCCTGCCGCTCGCCTACGGCCTGCTGGCGAGCCCCTGGGGCGCCCACTGTGTGTTC
CCATCGGTACGGGCCCCGCGACCCCGACGTCGGTTCGCGATGCTGACGCCCCCCGTCCCAGATCTACCGGGACAT
GCGCTTCCCGCACCAGTGGCGGACCGGGGTCAACGTCGCCTTCTCCTTCTCCGTTCGTCTCCTCAACCCTCCCGT
CCCCTCCGTCCCGCCGCGCCTAACGAGCGGCCTCCCGGCAGTACGCGCTGGACATGAGCCTGGCCGTCGTGGGCA
TCCTGATGTTCGGCGACGGCACGCAGGAGACGATCACGGCCAACATCATACAGACGAGCGGCTTCCCGCGGGCCT
CGACGGTGCTCATGTGCGTCTTCATCGCCATCATCCCCCTGACCAAGATCCCGCTCAACTCGCGGCCACTGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail