Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6862
Gene name
LocationContig_37:42561..43726
Strand-
Gene length (bp)1165
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04116 FA_hydroxylase Fatty acid hydroxylase superfamily 5.5E-25 169 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SBB6|ERG3_NEUCR Probable Delta(7)-sterol 5(6)-desaturase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06207 PE=3 SV=1 1 345 6.0E-174
sp|Q8J207|ERG3_LEPMC Delta(7)-sterol 5(6)-desaturase OS=Leptosphaeria maculans GN=ERG3 PE=3 SV=1 1 347 6.0E-155
sp|Q754B9|ERG3_ASHGO Delta(7)-sterol 5(6)-desaturase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG3 PE=3 SV=2 1 337 2.0E-107
sp|P50860|ERG3_CANGA Delta(7)-sterol 5(6)-desaturase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG3 PE=3 SV=1 1 347 6.0E-107
sp|O93875|ERG3_CANAX Delta(7)-sterol 5(6)-desaturase OS=Candida albicans GN=ERG3 PE=3 SV=1 1 337 3.0E-105
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SBB6|ERG3_NEUCR Probable Delta(7)-sterol 5(6)-desaturase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06207 PE=3 SV=1 1 345 6.0E-174
sp|Q8J207|ERG3_LEPMC Delta(7)-sterol 5(6)-desaturase OS=Leptosphaeria maculans GN=ERG3 PE=3 SV=1 1 347 6.0E-155
sp|Q754B9|ERG3_ASHGO Delta(7)-sterol 5(6)-desaturase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG3 PE=3 SV=2 1 337 2.0E-107
sp|P50860|ERG3_CANGA Delta(7)-sterol 5(6)-desaturase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG3 PE=3 SV=1 1 347 6.0E-107
sp|O93875|ERG3_CANAX Delta(7)-sterol 5(6)-desaturase OS=Candida albicans GN=ERG3 PE=3 SV=1 1 337 3.0E-105
sp|P32353|ERG3_YEAST Delta(7)-sterol 5(6)-desaturase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG3 PE=1 SV=1 1 347 4.0E-105
sp|O94457|ERG31_SCHPO Delta(7)-sterol 5(6)-desaturase erg31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg31 PE=3 SV=1 68 345 2.0E-101
sp|Q8NJ57|ERG3_CANDC Delta(7)-sterol 5(6)-desaturase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ERG3 PE=3 SV=1 1 337 1.0E-100
sp|O13666|ERG32_SCHPO Delta(7)-sterol 5(6)-desaturase erg32 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg32 PE=3 SV=1 1 347 5.0E-94
sp|O75845|SC5D_HUMAN Lathosterol oxidase OS=Homo sapiens GN=SC5D PE=1 SV=2 63 321 2.0E-83
sp|O88822|SC5D_MOUSE Lathosterol oxidase OS=Mus musculus GN=Sc5d PE=2 SV=2 63 324 2.0E-82
sp|Q9EQS5|SC5D_RAT Lathosterol oxidase OS=Rattus norvegicus GN=Sc5d PE=1 SV=1 63 324 3.0E-82
sp|Q9M883|SC5D2_ARATH Putative Delta(7)-sterol-C5(6)-desaturase 2 OS=Arabidopsis thaliana GN=HDF7 PE=3 SV=1 88 301 4.0E-21
sp|Q39208|SC5D1_ARATH Delta(7)-sterol-C5(6)-desaturase 1 OS=Arabidopsis thaliana GN=STE1 PE=1 SV=2 121 314 4.0E-20
sp|Q9ZT29|SC5D_TOBAC Delta(7)-sterol-C5(6)-desaturase OS=Nicotiana tabacum PE=2 SV=1 84 310 9.0E-20
sp|Q9AST3|SBH2_ARATH Sphinganine C4-monooxygenase 2 OS=Arabidopsis thaliana GN=SBH2 PE=1 SV=1 82 314 2.0E-11
sp|Q55D54|MSMOB_DICDI Putative methylsterol monooxygenase DDB_G0269788 OS=Dictyostelium discoideum GN=DDB_G0269788 PE=3 SV=1 159 314 3.0E-10
sp|Q55D52|MSMOA_DICDI Putative methylsterol monooxygenase DDB_G0270946 OS=Dictyostelium discoideum GN=DDB_G0270946 PE=3 SV=2 116 314 4.0E-10
sp|Q9GKT2|FXDC2_MACFA Fatty acid hydroxylase domain-containing protein 2 OS=Macaca fascicularis GN=FAXDC2 PE=2 SV=1 124 295 2.0E-09
sp|Q96IV6|FXDC2_HUMAN Fatty acid hydroxylase domain-containing protein 2 OS=Homo sapiens GN=FAXDC2 PE=2 SV=1 157 295 3.0E-09
sp|Q9CRA4|MSMO1_MOUSE Methylsterol monooxygenase 1 OS=Mus musculus GN=Msmo1 PE=1 SV=1 180 314 7.0E-09
sp|Q5R574|MSMO1_PONAB Methylsterol monooxygenase 1 OS=Pongo abelii GN=MSMO1 PE=2 SV=1 132 313 1.0E-08
sp|Q15800|MSMO1_HUMAN Methylsterol monooxygenase 1 OS=Homo sapiens GN=MSMO1 PE=1 SV=1 132 313 1.0E-08
sp|Q5ZLL6|MSMO1_CHICK Methylsterol monooxygenase 1 OS=Gallus gallus GN=MSMO1 PE=2 SV=1 180 313 2.0E-08
sp|Q8L7W5|SMO11_ARATH Methylsterol monooxygenase 1-1 OS=Arabidopsis thaliana GN=SMO1-1 PE=1 SV=1 167 314 2.0E-08
sp|P53045|MSMO_YEAST Methylsterol monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG25 PE=1 SV=1 159 313 2.0E-08
sp|F4JLZ6|SMO13_ARATH Methylsterol monooxygenase 1-3 OS=Arabidopsis thaliana GN=SMO1-3 PE=2 SV=1 159 295 2.0E-08
sp|O35532|MSMO1_RAT Methylsterol monooxygenase 1 OS=Rattus norvegicus GN=Msmo1 PE=2 SV=1 180 314 3.0E-08
sp|Q6UGB2|MSMO1_PIG Methylsterol monooxygenase 1 OS=Sus scrofa GN=MSMO1 PE=2 SV=1 136 313 4.0E-08
sp|Q7ZW77|MSMO1_DANRE Methylsterol monooxygenase 1 OS=Danio rerio GN=msmo1 PE=2 SV=1 180 295 9.0E-08
sp|Q8VYI1|SBH1_ARATH Sphinganine C4-monooxygenase 1 OS=Arabidopsis thaliana GN=SBH1 PE=1 SV=1 167 296 1.0E-07
sp|Q1EC69|SMO12_ARATH Methylsterol monooxygenase 1-2 OS=Arabidopsis thaliana GN=SMO1-2 PE=2 SV=1 165 314 2.0E-07
sp|Q4R4Q4|MSMO1_MACFA Methylsterol monooxygenase 1 OS=Macaca fascicularis GN=MSMO1 PE=2 SV=1 136 295 2.0E-06
sp|P38992|SUR2_YEAST Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR2 PE=1 SV=1 160 330 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0008610 lipid biosynthetic process Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0009058 biosynthetic process No
GO:0043167 ion binding No
GO:1901576 organic substance biosynthetic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0006629 lipid metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 82 104 22
2 130 149 19
3 161 183 22
4 231 253 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6862
MDIVLELTDTFIADYVYAYLFPARPAPYDFPQATAANVSQQTFSAWTYRPATKFLQVQPSQAAYTTSLPRDHPYR
QLATLYFITWIFGIIVYFLFATLSYFLIFDKRTLDHPKFIKNQIWLEIKQANKSMPLMAIFTVPFFLLEVRGYGK
LYDTTDEGPGLWYNILQFPLFLLFTDFCIYWIHRYLHHPLIYKRLHKPHHKWIMPTPYASHAFHPMDGFAQSLPY
HIFPFIFPLQKMAFVCLFVFVNFWSILIHDGEYLTNNPVVNGAACHSLHHSRFEVNYGQFFTAFDRLGGTYRRPE
AWMFEREKKMSKKQWTKESRAVDEFVKEIEGTDERTYGPDSAAKKIN*
Coding >Hirsu2|6862
ATGGATATCGTCCTCGAGCTCACCGACACCTTCATCGCCGACTACGTCTACGCCTACCTTTTCCCCGCCCGCCCC
GCGCCCTACGACTTCCCCCAAGCCACCGCGGCCAACGTCTCCCAGCAGACTTTTTCCGCCTGGACATACCGGCCC
GCGACCAAGTTCCTCCAGGTCCAGCCCTCCCAGGCCGCCTACACGACGTCGCTGCCGCGCGACCATCCCTATCGC
CAGCTCGCCACGCTATACTTTATTACCTGGATCTTCGGCATCATCGTCTATTTCCTCTTCGCCACCCTCTCCTAC
TTCCTCATCTTCGACAAGCGCACCCTGGATCATCCCAAGTTCATCAAGAATCAGATATGGCTCGAGATCAAGCAG
GCAAACAAGTCGATGCCCCTTATGGCCATCTTCACCGTCCCCTTCTTCCTCCTTGAGGTCCGCGGCTACGGAAAG
CTCTACGATACGACCGACGAAGGGCCGGGTCTGTGGTACAACATCCTGCAGTTCCCCCTCTTCCTCCTCTTCACG
GACTTTTGCATTTACTGGATCCACCGATACCTACACCATCCCCTCATCTACAAGCGTCTTCACAAGCCTCACCAC
AAGTGGATCATGCCCACGCCTTACGCCAGCCACGCCTTCCACCCGATGGACGGTTTCGCCCAGTCGCTTCCTTAC
CACATCTTCCCCTTCATCTTCCCACTGCAGAAGATGGCTTTCGTCTGCCTCTTCGTCTTCGTCAACTTCTGGTCC
ATCCTCATCCACGACGGAGAATATCTCACCAACAACCCTGTCGTCAACGGCGCCGCCTGCCACTCCCTACACCAC
TCTCGCTTCGAGGTCAACTACGGCCAGTTCTTCACGGCCTTTGACCGTCTCGGCGGCACCTACAGGCGGCCCGAG
GCCTGGATGTTTGAGCGGGAGAAGAAGATGTCGAAAAAGCAGTGGACCAAGGAATCGCGAGCCGTCGACGAGTTT
GTCAAGGAGATCGAGGGTACCGACGAACGCACCTATGGCCCCGACTCGGCTGCCAAGAAAATCAACTGA
Transcript >Hirsu2|6862
ATGGATATCGTCCTCGAGCTCACCGACACCTTCATCGCCGACTACGTCTACGCCTACCTTTTCCCCGCCCGCCCC
GCGCCCTACGACTTCCCCCAAGCCACCGCGGCCAACGTCTCCCAGCAGACTTTTTCCGCCTGGACATACCGGCCC
GCGACCAAGTTCCTCCAGGTCCAGCCCTCCCAGGCCGCCTACACGACGTCGCTGCCGCGCGACCATCCCTATCGC
CAGCTCGCCACGCTATACTTTATTACCTGGATCTTCGGCATCATCGTCTATTTCCTCTTCGCCACCCTCTCCTAC
TTCCTCATCTTCGACAAGCGCACCCTGGATCATCCCAAGTTCATCAAGAATCAGATATGGCTCGAGATCAAGCAG
GCAAACAAGTCGATGCCCCTTATGGCCATCTTCACCGTCCCCTTCTTCCTCCTTGAGGTCCGCGGCTACGGAAAG
CTCTACGATACGACCGACGAAGGGCCGGGTCTGTGGTACAACATCCTGCAGTTCCCCCTCTTCCTCCTCTTCACG
GACTTTTGCATTTACTGGATCCACCGATACCTACACCATCCCCTCATCTACAAGCGTCTTCACAAGCCTCACCAC
AAGTGGATCATGCCCACGCCTTACGCCAGCCACGCCTTCCACCCGATGGACGGTTTCGCCCAGTCGCTTCCTTAC
CACATCTTCCCCTTCATCTTCCCACTGCAGAAGATGGCTTTCGTCTGCCTCTTCGTCTTCGTCAACTTCTGGTCC
ATCCTCATCCACGACGGAGAATATCTCACCAACAACCCTGTCGTCAACGGCGCCGCCTGCCACTCCCTACACCAC
TCTCGCTTCGAGGTCAACTACGGCCAGTTCTTCACGGCCTTTGACCGTCTCGGCGGCACCTACAGGCGGCCCGAG
GCCTGGATGTTTGAGCGGGAGAAGAAGATGTCGAAAAAGCAGTGGACCAAGGAATCGCGAGCCGTCGACGAGTTT
GTCAAGGAGATCGAGGGTACCGACGAACGCACCTATGGCCCCGACTCGGCTGCCAAGAAAATCAACTGA
Gene >Hirsu2|6862
ATGGATATCGTCCTCGAGCTCACCGACACCTTCATCGCCGACTACGTCTACGCCTACCTTTTCCCCGCCCGCCCC
GCGCCCTACGACTTCCCCCAAGCCACCGCGGCCAACGTCTCCCAGCAGACTTTTTCCGCCTGGACATACCGGCCC
GCGACCAAGTTCCTCCAGGTCCAGCCCTCCCAGGCCGCCTACACGACGTCGCTGCCGCGCGACCATCCCTATCGC
CAGCTCGCCACGCTATACTTTATTACCTGGTGCGCTGCCTCTCCCCNNNNNNNNNNNNNNNNNNNNNNNNNNCCC
CCCCCTTTTTTTTTTGTCGCTCCCGGCTGCTCTTGTCTGAGGTGCCCCCGTAACCCTAACCGGCTTCGTTTGCAG
GATCTTCGGCATCATCGTCTATTTCCTCTTCGCCACCCTCTCCTACTTCCTCATCTTCGACAAGCGCACCCTGGA
TCATCCCAAGTTCATCAAGAATCAGATATGGCTCGAGATCAAGCAGGCAAACAAGTCGATGCCCCTTATGGCCAT
CTTCACCGTCCCCTTCTTCCTCCTTGAGGTCCGCGGCTACGGAAAGCTCTACGATACGACCGACGAAGGGCCGGG
TCTGTGGTACAACATCCTGCAGTTCCCCCTCTTCCTCCTCTTCACGGACTTTTGCATTTACTGGATCCACCGATA
CCTACACCATCCCCTCATCTACAAGCGTCTTCACAAGCCTCACCACAAGTGGATCATGCCCACGCCTTACGCCAG
CCACGCCTTCCACCCGATGGACGGTTTCGCCCAGTCGCTTCCTTACCACATCTTCCCCTTCATCTTCCCACTGCA
GAAGATGGCTTTCGTCTGCCTCTTCGTCTTCGTCAACTTCTGGTCCATCCTCATCCACGACGGAGAATATCTCAC
CAACAACCCTGTCGTCAACGGCGCCGCCTGCCACTCCCTACACCACTCTCGCTTCGAGGTCAACTACGGCCAGTT
CTTCACGGCCTTTGACCGTCTCGGCGGCACCTACAGGCGGCCCGAGGCCTGGATGTTTGAGCGGGAGAAGAAGAT
GTCGAAAAAGCAGTGGACCAAGGAATCGCGAGCCGTCGACGAGTTTGTCAAGGAGATCGAGGGTACCGACGAACG
CACCTATGGCCCCGACTCGGCTGCCAAGAAAATCAACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail