Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6850
Gene name
LocationContig_37:19249..21382
Strand+
Gene length (bp)2133
Transcript length (bp)1605
Coding sequence length (bp)1605
Protein length (aa) 535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14324 PINIT PINIT domain 1.3E-43 155 289
PF02891 zf-MIZ MIZ/SP-RING zinc finger 7.8E-22 331 379

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94451|PLI1_SCHPO E3 SUMO-protein ligase pli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pli1 PE=1 SV=3 29 500 1.0E-58
sp|Q04195|SIZ1_YEAST E3 SUMO-protein ligase SIZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIZ1 PE=1 SV=1 29 414 9.0E-45
sp|Q12216|SIZ2_YEAST E3 SUMO-protein ligase SIZ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFI1 PE=1 SV=1 11 414 3.0E-38
sp|O75925|PIAS1_HUMAN E3 SUMO-protein ligase PIAS1 OS=Homo sapiens GN=PIAS1 PE=1 SV=2 209 414 1.0E-27
sp|O88907|PIAS1_MOUSE E3 SUMO-protein ligase PIAS1 OS=Mus musculus GN=Pias1 PE=1 SV=2 209 414 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94451|PLI1_SCHPO E3 SUMO-protein ligase pli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pli1 PE=1 SV=3 29 500 1.0E-58
sp|Q04195|SIZ1_YEAST E3 SUMO-protein ligase SIZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIZ1 PE=1 SV=1 29 414 9.0E-45
sp|Q12216|SIZ2_YEAST E3 SUMO-protein ligase SIZ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFI1 PE=1 SV=1 11 414 3.0E-38
sp|O75925|PIAS1_HUMAN E3 SUMO-protein ligase PIAS1 OS=Homo sapiens GN=PIAS1 PE=1 SV=2 209 414 1.0E-27
sp|O88907|PIAS1_MOUSE E3 SUMO-protein ligase PIAS1 OS=Mus musculus GN=Pias1 PE=1 SV=2 209 414 1.0E-27
sp|Q6AZ28|PIAS2_RAT E3 SUMO-protein ligase PIAS2 OS=Rattus norvegicus GN=Pias2 PE=1 SV=1 209 414 2.0E-27
sp|Q8N2W9|PIAS4_HUMAN E3 SUMO-protein ligase PIAS4 OS=Homo sapiens GN=PIAS4 PE=1 SV=1 208 414 3.0E-27
sp|O75928|PIAS2_HUMAN E3 SUMO-protein ligase PIAS2 OS=Homo sapiens GN=PIAS2 PE=1 SV=3 209 414 4.0E-27
sp|Q8C5D8|PIAS2_MOUSE E3 SUMO-protein ligase PIAS2 OS=Mus musculus GN=Pias2 PE=1 SV=2 209 414 5.0E-27
sp|O70260|PIAS3_RAT E3 SUMO-protein ligase PIAS3 OS=Rattus norvegicus GN=Pias3 PE=1 SV=2 150 414 7.0E-26
sp|O54714|PIAS3_MOUSE E3 SUMO-protein ligase PIAS3 OS=Mus musculus GN=Pias3 PE=1 SV=3 150 414 7.0E-26
sp|Q9Y6X2|PIAS3_HUMAN E3 SUMO-protein ligase PIAS3 OS=Homo sapiens GN=PIAS3 PE=1 SV=2 150 523 4.0E-25
sp|Q9JM05|PIAS4_MOUSE E3 SUMO-protein ligase PIAS4 OS=Mus musculus GN=Pias4 PE=1 SV=2 208 414 6.0E-25
sp|Q8NF64|ZMIZ2_HUMAN Zinc finger MIZ domain-containing protein 2 OS=Homo sapiens GN=ZMIZ2 PE=1 SV=2 268 424 6.0E-19
sp|Q8CIE2|ZMIZ2_MOUSE Zinc finger MIZ domain-containing protein 2 OS=Mus musculus GN=Zmiz2 PE=2 SV=2 268 414 6.0E-19
sp|Q9ULJ6|ZMIZ1_HUMAN Zinc finger MIZ domain-containing protein 1 OS=Homo sapiens GN=ZMIZ1 PE=1 SV=3 268 414 1.0E-18
sp|Q6P1E1|ZMIZ1_MOUSE Zinc finger MIZ domain-containing protein 1 OS=Mus musculus GN=Zmiz1 PE=2 SV=1 268 414 2.0E-18
sp|Q94361|GEI17_CAEEL E3 SUMO-protein ligase gei-17 OS=Caenorhabditis elegans GN=gei-17 PE=1 SV=4 251 414 2.0E-18
sp|A0A0A7EPL0|PIAL1_ARATH E4 SUMO-protein ligase PIAL1 OS=Arabidopsis thaliana GN=PIAL1 PE=2 SV=1 308 446 6.0E-18
sp|Q6L4L4|SIZ1_ORYSJ E3 SUMO-protein ligase SIZ1 OS=Oryza sativa subsp. japonica GN=SIZ1 PE=1 SV=1 186 529 2.0E-16
sp|Q6ASW7|SIZ2_ORYSJ E3 SUMO-protein ligase SIZ2 OS=Oryza sativa subsp. japonica GN=SIZ2 PE=2 SV=1 158 419 1.0E-13
sp|F4JYG0|PIAL2_ARATH E4 SUMO-protein ligase PIAL2 OS=Arabidopsis thaliana GN=PIAL2 PE=1 SV=1 299 414 2.0E-13
sp|Q680Q4|SIZ1_ARATH E3 SUMO-protein ligase SIZ1 OS=Arabidopsis thaliana GN=SIZ1 PE=1 SV=2 222 417 5.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, MIZ-type

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6850
MASPMTPISKHEVSQLIRQVQSNQLYNRQLSSICQVNGLKSTGVKADLQRRIADLIQSTFNENDLPRYHQVRQSI
LNAHAQRSSPSSKSTSAARGNSSASSPSSLSTQFAPSTMTAYNTNGAVNAYQQRGYHATTSTPSAAHSSGASFAP
AVPLLNFRPSPFYQVETHVSTLRVCEVMSQHRNSISIPLKLADHPSLQHCLTDKSYRVLIFCAGDHTGVQDIAFP
HQSELKVNGSEIKANLRGLKNKPGSTRPVDITQSLRLKPNQVNTIEFTYALTNKKFYLVANLCKVTSVPELVRIV
STRRRIPKESVVAELNKKARDPDVVATSQVLSLKCPLSYMRLDLPCRSVSCTHVQCFDATSYLQLQEQGPQWLCP
ICNKSAPFDQLAVDDYVRDILENTPKDLETVTIEPNGRWMLKSSPDDAADTTNGTSLEDDDLLEISEVNLGGRRM
ETPKTATPSIRTPISSGRDGSASAPRGIASTSAKRPASAVIDLTADSDDEEPVQRSRKRQNTGTNGIRDRNGSFL
SESPVGFQH*
Coding >Hirsu2|6850
ATGGCGTCACCCATGACTCCCATCTCGAAGCACGAAGTCTCACAACTGATCCGACAAGTGCAGAGCAACCAGCTC
TACAACCGCCAGCTCTCGTCCATCTGCCAGGTCAACGGCCTCAAGAGCACTGGCGTCAAGGCTGACCTCCAGCGC
CGCATTGCCGATCTCATTCAGAGTACTTTCAACGAAAACGACCTGCCCCGATATCACCAGGTTCGCCAGAGCATC
CTCAACGCACATGCCCAACGATCCAGTCCCTCCTCCAAGTCCACCTCTGCAGCGCGAGGCAACAGCTCCGCCTCA
TCGCCCTCCTCTTTGTCGACCCAGTTTGCGCCGTCGACGATGACGGCCTACAATACCAACGGCGCTGTCAACGCC
TACCAGCAGCGAGGCTATCACGCCACTACCTCGACGCCTTCCGCTGCCCATTCTTCGGGAGCTTCATTTGCCCCC
GCCGTGCCGTTGCTGAACTTCCGGCCGAGTCCCTTCTATCAGGTGGAGACTCATGTCAGCACACTTCGTGTCTGC
GAAGTCATGTCGCAGCACCGGAACTCCATCTCCATACCTCTAAAGCTGGCCGATCATCCTTCCCTCCAGCACTGC
TTGACCGACAAGTCTTACAGGGTCCTGATCTTCTGTGCCGGCGATCATACCGGCGTCCAGGACATTGCCTTCCCC
CACCAATCTGAGCTCAAGGTCAACGGGAGCGAGATCAAGGCGAATTTGCGAGGCCTGAAGAACAAGCCGGGCTCG
ACGAGGCCCGTCGACATCACGCAATCATTGCGCCTTAAACCGAACCAAGTCAATACCATCGAGTTCACTTACGCG
TTGACGAACAAGAAATTTTATCTTGTCGCCAACCTCTGCAAAGTCACATCAGTCCCCGAATTGGTCAGAATCGTA
TCGACCCGCCGCAGGATACCGAAGGAATCGGTTGTCGCGGAACTCAACAAGAAAGCACGAGACCCCGACGTTGTG
GCGACGTCGCAAGTCTTGTCCTTGAAATGCCCTCTCTCGTACATGAGGCTCGACCTGCCTTGTCGGAGCGTAAGC
TGCACACACGTCCAGTGTTTTGACGCGACGTCGTATCTCCAGCTGCAGGAGCAGGGCCCGCAATGGCTCTGCCCG
ATCTGCAACAAATCGGCACCGTTTGACCAGCTTGCCGTCGACGATTACGTCCGGGACATTCTCGAGAACACACCC
AAAGACTTGGAGACGGTCACAATCGAACCGAACGGCCGATGGATGCTCAAATCGTCGCCAGACGATGCTGCCGAC
ACAACCAACGGGACGTCTTTGGAGGACGACGATCTGCTGGAGATTTCCGAGGTCAACCTGGGCGGCCGTCGGATG
GAGACTCCCAAAACGGCGACGCCGAGCATCAGGACACCCATTTCCAGCGGCAGAGATGGGTCAGCAAGTGCTCCC
CGGGGCATTGCCTCGACCAGTGCCAAGCGGCCGGCGTCGGCGGTCATTGACTTGACGGCAGACTCGGACGACGAG
GAGCCAGTCCAGCGATCCCGCAAGAGACAGAACACAGGAACAAACGGGATTCGTGACCGCAACGGCAGTTTTTTG
AGCGAATCTCCGGTGGGCTTCCAGCATTAG
Transcript >Hirsu2|6850
ATGGCGTCACCCATGACTCCCATCTCGAAGCACGAAGTCTCACAACTGATCCGACAAGTGCAGAGCAACCAGCTC
TACAACCGCCAGCTCTCGTCCATCTGCCAGGTCAACGGCCTCAAGAGCACTGGCGTCAAGGCTGACCTCCAGCGC
CGCATTGCCGATCTCATTCAGAGTACTTTCAACGAAAACGACCTGCCCCGATATCACCAGGTTCGCCAGAGCATC
CTCAACGCACATGCCCAACGATCCAGTCCCTCCTCCAAGTCCACCTCTGCAGCGCGAGGCAACAGCTCCGCCTCA
TCGCCCTCCTCTTTGTCGACCCAGTTTGCGCCGTCGACGATGACGGCCTACAATACCAACGGCGCTGTCAACGCC
TACCAGCAGCGAGGCTATCACGCCACTACCTCGACGCCTTCCGCTGCCCATTCTTCGGGAGCTTCATTTGCCCCC
GCCGTGCCGTTGCTGAACTTCCGGCCGAGTCCCTTCTATCAGGTGGAGACTCATGTCAGCACACTTCGTGTCTGC
GAAGTCATGTCGCAGCACCGGAACTCCATCTCCATACCTCTAAAGCTGGCCGATCATCCTTCCCTCCAGCACTGC
TTGACCGACAAGTCTTACAGGGTCCTGATCTTCTGTGCCGGCGATCATACCGGCGTCCAGGACATTGCCTTCCCC
CACCAATCTGAGCTCAAGGTCAACGGGAGCGAGATCAAGGCGAATTTGCGAGGCCTGAAGAACAAGCCGGGCTCG
ACGAGGCCCGTCGACATCACGCAATCATTGCGCCTTAAACCGAACCAAGTCAATACCATCGAGTTCACTTACGCG
TTGACGAACAAGAAATTTTATCTTGTCGCCAACCTCTGCAAAGTCACATCAGTCCCCGAATTGGTCAGAATCGTA
TCGACCCGCCGCAGGATACCGAAGGAATCGGTTGTCGCGGAACTCAACAAGAAAGCACGAGACCCCGACGTTGTG
GCGACGTCGCAAGTCTTGTCCTTGAAATGCCCTCTCTCGTACATGAGGCTCGACCTGCCTTGTCGGAGCGTAAGC
TGCACACACGTCCAGTGTTTTGACGCGACGTCGTATCTCCAGCTGCAGGAGCAGGGCCCGCAATGGCTCTGCCCG
ATCTGCAACAAATCGGCACCGTTTGACCAGCTTGCCGTCGACGATTACGTCCGGGACATTCTCGAGAACACACCC
AAAGACTTGGAGACGGTCACAATCGAACCGAACGGCCGATGGATGCTCAAATCGTCGCCAGACGATGCTGCCGAC
ACAACCAACGGGACGTCTTTGGAGGACGACGATCTGCTGGAGATTTCCGAGGTCAACCTGGGCGGCCGTCGGATG
GAGACTCCCAAAACGGCGACGCCGAGCATCAGGACACCCATTTCCAGCGGCAGAGATGGGTCAGCAAGTGCTCCC
CGGGGCATTGCCTCGACCAGTGCCAAGCGGCCGGCGTCGGCGGTCATTGACTTGACGGCAGACTCGGACGACGAG
GAGCCAGTCCAGCGATCCCGCAAGAGACAGAACACAGGAACAAACGGGATTCGTGACCGCAACGGCAGTTTTTTG
AGCGAATCTCCGGTGGGCTTCCAGCATTAG
Gene >Hirsu2|6850
ATGGCGTCACCCATGACTCCCATCTCGAAGCACGAAGTCTCACAACTGATCCGACAAGTGCAGAGCAACCAGCTC
TACAACCGCCAGCTCTCGTCCATCTGCCAGGTCAACGGCCTCAAGAGCACTGGCGTCAAGGCTGACCTCCAGCGC
CGCATTGCCGATCGTAAGTCGCCTGTCCCCGTCGCCCTCTTCCTTTCTCCCCTTTGTGCCTTCGTCTCTTCGGCC
CGCTTCTCGAAGCGGGACAGAAAACCTCTCTCTATCGGCCAACAACGTACACCTCTTCACCCGCCGCCCGCTTTC
GAAGCACGCGCCCTCCCGCAGCCCTTTTCACAGCCGTCACCCCTCGCCGGCCTCTCACCTGCCGCCTCCCGCTGA
CCTCGCCGTCGCAGTCATTCAGAGTACTTTCAACGAAAACGACCTGCCCCGATATCACCAGGTTCGCCAGAGCAT
CCTCAACGCACATGCCCAACGATCCAGTCCCTCCTCCAAGTCCACCTCTGCAGCGCGAGGCAACAGCTCCGCCTC
ATCGCCCTCCTCTTTGTCGACCCAGTTTGCGCCGTCGACGATGACGGCCTACAATACCAACGGCGCTGTCAACGC
CTACCAGCAGCGAGGCTATCACGCCACTACCTCGACGCCTTCCGCTGCCCATTCTTCGGGAGCTTCATTTGCCCC
CGCCGTGCCGTTGCTGAACTTCCGGCCGAGTCCCTTCTATCAGGTGGAGACTCATGTCAGCACACTTCGTGTCTG
CGAAGGCAAGTTGTCGCCACCTCTACCGCCCGCGCCAAATCTTGCTTTGTGTAGCTGACCGTACCCGCTCTCCTG
CAGTCATGTCGCAGCACCGGAACTCCATCTCCATACCTCTAAAGCTGGCCGATCATCCTTCCCTCCAGCACTGCT
TGACCGACAAGTCTTACAGGGTCCTGATCTTCTGTGCCGGCGATCATACCGGCGTCCAGGACATTGCCTTCCCCC
ACCAATCTGAGCTCAAGGTCAACGGGAGCGAGATCAAGGCGAATTTGCGAGGCCTGAAGAACAAGCCGGGCTCGA
CGAGGCCCGTCGACATCACGCAATCATTGCGCCTTAAACCGAACCAAGTCAATACCATCGAGTTCACTTACGCGT
TGACGAACAAGGTAAGGCACCCCTACTTTCTTACACATTGCGCTCGCGCGATGTTCCTGTCCCCTTCCAGCTTCC
GGATTGTGCTGACTCGAGGCATGCGCCGCATGGCAGAAATTTTATCTTGTCGCCAACCTCTGCAAAGTCACATCA
GTCCCCGAATTGGTCAGAATCGTATCGACCCGCCGCAGGATACCGAAGGAATCGGTTGTCGCGGAACGTAAGCGN
NNNNNNNNNNNNCCCCCCCCCCCCCCCCTCTTGTTGTCCCGTCGTGGGAGTCTTCTGACGAATATTTCCAGTCAA
CAAGAAAGCACGAGACCCCGACGTTGTGGCGACGTCGCAAGTCTTGTCCTTGAAATGCCCTCTCTCGTACATGAG
GCTCGACCTGCCTTGTCGGAGCGTAAGCTGCACACACGTCCAGTGTTTTGACGCGACGTCGTATCTCCAGCTGCA
GGAGCAGGGCCCGCAATGGCTCTGCCCGATCTGCAACAAATCGGCACCGTTTGACCAGCTTGCCGTCGACGAGTA
CGTAGTCCAGCTGGGTCACAGGAACATGGACACTGACAGTCGAGCAGTTACGTCCGGGACATTCTCGAGAACACA
CCCAAAGACTTGGAGACGGTCACAATCGAACCGAACGGCCGATGGATGCTCAAATCGTCGCCAGACGATGCTGCC
GACACAACCAACGGGACGTCTTTGGAGGACGACGATCTGCTGGAGATTTCCGAGGTCAACCTGGGCGGCCGTCGG
ATGGAGACTCCCAAAACGGCGACGCCGAGCATCAGGACACCCATTTCCAGCGGCAGAGATGGGTCAGCAAGTGCT
CCCCGGGGCATTGCCTCGACCAGTGCCAAGCGGCCGGCGTCGGCGGTCATTGACTTGACGGCAGACTCGGACGAC
GAGGAGCCAGTCCAGCGATCCCGCAAGAGACAGAACACAGGAACAAACGGGATTCGTGACCGCAACGGCAGTTTT
TTGAGCGAATCTCCGGTGGGCTTCCAGCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail